Query         gi|254780750|ref|YP_003065163.1| DNA mismatch repair protein [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 920
No_of_seqs    324 out of 3234
Neff          8.0 
Searched_HMMs 39220
Date          Tue May 31 15:11:03 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780750.hhm -d /home/congqian_1/database/cdd/Cdd.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 TIGR01070 mutS1 DNA mismatch r 100.0       0       0 2046.2  58.5  850   25-899     1-863 (863)
  2 PRK05399 DNA mismatch repair p 100.0       0       0 1947.7  83.2  842   21-902     4-848 (848)
  3 COG0249 MutS Mismatch repair A 100.0       0       0 1745.8  74.9  837   21-899     2-843 (843)
  4 KOG0218 consensus              100.0       0       0 1317.2  48.2  816   23-859   160-1047(1070)
  5 KOG0217 consensus              100.0       0       0 1275.5  37.8  815    7-844   234-1094(1125)
  6 KOG0219 consensus              100.0       0       0  970.3  46.2  787   26-845    13-840 (902)
  7 KOG0220 consensus              100.0       0       0  817.7  40.9  772  106-905    56-865 (867)
  8 PRK00409 recombination and DNA 100.0       0       0  726.1  46.1  502  292-836     2-509 (780)
  9 KOG0221 consensus              100.0       0       0  729.4  33.6  710  151-884    49-828 (849)
 10 pfam00488 MutS_V MutS domain V 100.0       0       0  587.5  23.8  233  601-841     1-233 (234)
 11 cd03285 ABC_MSH2_euk MutS2 hom 100.0       0       0  563.0  22.6  220  613-840     1-222 (222)
 12 cd03284 ABC_MutS1 MutS1 homolo 100.0       0       0  558.6  22.5  216  613-836     1-216 (216)
 13 TIGR01069 mutS2 MutS2 family p 100.0       0       0  529.1  34.7  495  314-836    15-544 (834)
 14 cd03287 ABC_MSH3_euk MutS3 hom 100.0       0       0  537.2  22.2  213  612-832     1-222 (222)
 15 cd03286 ABC_MSH6_euk MutS6 hom 100.0       0       0  528.6  21.3  211  614-832     2-218 (218)
 16 cd03282 ABC_MSH4_euk MutS4 hom 100.0       0       0  507.5  22.9  202  613-824     1-204 (204)
 17 cd03281 ABC_MSH5_euk MutS5 hom 100.0       0       0  500.9  21.2  203  613-824     1-213 (213)
 18 cd03280 ABC_MutS2 MutS2 homolo 100.0       0       0  479.5  21.2  199  613-824     1-200 (200)
 19 cd03243 ABC_MutS_homologs The  100.0       0       0  479.0  21.1  202  613-824     1-202 (202)
 20 cd03283 ABC_MutS-like MutS-lik 100.0       0       0  465.8  22.6  197  613-824     1-199 (199)
 21 smart00534 MUTSac ATPase domai 100.0       0       0  466.9  20.2  185  652-836     1-185 (185)
 22 COG1193 Mismatch repair ATPase 100.0       0       0  432.4  24.4  480  316-836    15-499 (753)
 23 pfam05192 MutS_III MutS domain 100.0       0       0  423.3  26.4  305  287-598     1-306 (306)
 24 smart00533 MUTSd DNA-binding d 100.0       0       0  410.1  26.7  307  311-624     1-307 (308)
 25 pfam01624 MutS_I MutS domain I 100.0   5E-38 1.3E-42  302.5  12.6  113   26-143     1-113 (113)
 26 cd03227 ABC_Class2 ABC-type Cl 100.0 3.2E-34 8.2E-39  274.1  16.5  156  614-791     2-159 (162)
 27 pfam05188 MutS_II MutS domain   99.8   1E-17 2.5E-22  150.9  13.7  129  151-279     1-133 (133)
 28 pfam05190 MutS_IV MutS family   99.6 2.8E-16 7.2E-21  140.0   3.6   91  456-552     1-91  (92)
 29 KOG0219 consensus               99.5 1.5E-15 3.8E-20  134.6  -2.5  222  614-850   626-848 (902)
 30 cd00267 ABC_ATPase ABC (ATP-bi  98.6 5.9E-07 1.5E-11   70.4  10.4  124  635-779    14-146 (157)
 31 cd03238 ABC_UvrA The excision   98.5 2.8E-06 7.2E-11   65.3  10.6  140  635-780    10-156 (176)
 32 cd03230 ABC_DR_subfamily_A Thi  98.3 1.6E-05 4.2E-10   59.6  10.7  127  635-780    15-163 (173)
 33 PRK13538 cytochrome c biogenes  98.3 3.6E-05 9.2E-10   57.1  12.4   52  727-781   145-196 (204)
 34 cd03217 ABC_FeS_Assembly ABC-t  98.2 4.4E-05 1.1E-09   56.4  12.2  137  634-778    14-169 (200)
 35 cd03233 ABC_PDR_domain1 The pl  98.2 2.8E-05 7.1E-10   57.9  11.2  130  635-773    22-179 (202)
 36 cd03216 ABC_Carb_Monos_I This   98.2   4E-05   1E-09   56.7  11.8  130  634-780    14-150 (163)
 37 PRK13543 cytochrome c biogenes  98.2 0.00023   6E-09   51.0  15.7  153  603-776     3-200 (214)
 38 PRK13541 cytochrome c biogenes  98.2 7.9E-05   2E-09   54.5  13.2  128  636-779    16-189 (195)
 39 cd03221 ABCF_EF-3 ABCF_EF-3  E  98.2 3.6E-05 9.1E-10   57.1  11.3  118  634-777    14-131 (144)
 40 PRK11144 modC molybdate transp  98.2 8.3E-06 2.1E-10   61.8   8.0  143  633-781    12-198 (352)
 41 cd03232 ABC_PDR_domain2 The pl  98.2 0.00013 3.2E-09   53.0  13.1  136  634-780    21-177 (192)
 42 cd03255 ABC_MJ0796_Lo1CDE_FtsE  98.1 3.8E-05 9.7E-10   56.9  10.3  135  635-780    19-208 (218)
 43 cd03218 ABC_YhbG The ABC trans  98.1 4.1E-05   1E-09   56.7  10.3  131  635-780    15-201 (232)
 44 cd03265 ABC_DrrA DrrA is the A  98.1 3.3E-05 8.3E-10   57.4   9.7  134  634-780    14-200 (220)
 45 cd03271 ABC_UvrA_II The excisi  98.1   1E-04 2.5E-09   53.8  12.0   54  724-779   185-238 (261)
 46 cd03240 ABC_Rad50 The catalyti  98.1 7.7E-05   2E-09   54.6  11.4   51  727-780   137-190 (204)
 47 PRK11247 ssuB aliphatic sulfon  98.1 4.6E-05 1.2E-09   56.3  10.2  183  602-808     3-221 (257)
 48 cd03267 ABC_NatA_like Similar   98.1 4.3E-05 1.1E-09   56.5   9.8  140  631-780    32-222 (236)
 49 PRK11614 livF leucine/isoleuci  98.1 6.3E-05 1.6E-09   55.2  10.6  133  635-780    20-205 (237)
 50 cd03213 ABCG_EPDR ABCG transpo  98.1 0.00011 2.7E-09   53.6  11.5  132  635-780    24-180 (194)
 51 cd03299 ABC_ModC_like Archeal   98.1 9.9E-05 2.5E-09   53.8  11.1  133  634-780    13-198 (235)
 52 PRK13547 hmuV hemin importer A  98.1 0.00015 3.8E-09   52.5  12.0  139  634-777    15-220 (273)
 53 COG0396 sufC Cysteine desulfur  98.0 2.2E-05 5.7E-10   58.6   7.5  133  635-780    19-211 (251)
 54 cd03222 ABC_RNaseL_inhibitor T  98.0 0.00012 3.2E-09   53.1  11.2  111  648-777    23-136 (177)
 55 PRK10247 putative ABC transpor  98.0 9.3E-05 2.4E-09   54.0  10.5  141  633-778    20-203 (225)
 56 PRK13544 consensus              98.0   6E-05 1.5E-09   55.4   9.2  133  634-775    15-188 (208)
 57 cd03215 ABC_Carb_Monos_II This  98.0 7.1E-05 1.8E-09   54.9   9.6  135  634-780    14-172 (182)
 58 cd03214 ABC_Iron-Siderophores_  98.0  0.0001 2.6E-09   53.6  10.4  127  635-777    14-162 (180)
 59 cd03223 ABCD_peroxisomal_ALDP   98.0 0.00025 6.3E-09   50.8  12.0  120  635-780    16-155 (166)
 60 cd03229 ABC_Class3 This class   98.0 0.00018 4.5E-09   51.9  11.2  130  634-780    14-169 (178)
 61 PRK13540 cytochrome c biogenes  98.0  0.0002 5.1E-09   51.5  11.4  136  635-779    16-193 (200)
 62 cd03270 ABC_UvrA_I The excisio  98.0 0.00051 1.3E-08   48.5  13.4   55  724-780   152-206 (226)
 63 TIGR03608 L_ocin_972_ABC putat  98.0 0.00017 4.4E-09   52.0  11.0  130  634-780    12-201 (206)
 64 PRK13539 cytochrome c biogenes  98.0 3.8E-05 9.7E-10   56.9   7.6   46  727-774   142-187 (206)
 65 cd03250 ABCC_MRP_domain1 Domai  98.0 0.00038 9.7E-09   49.4  12.7   35  633-671    18-52  (204)
 66 cd03269 ABC_putative_ATPase Th  98.0 0.00027 6.9E-09   50.5  11.8  133  634-775    14-190 (210)
 67 PRK10575 iron-hydroxamate tran  98.0 0.00022 5.7E-09   51.1  11.4  136  634-776    25-211 (265)
 68 cd03220 ABC_KpsT_Wzt ABC_KpsT_  98.0 0.00025 6.3E-09   50.8  11.5  132  634-780    36-210 (224)
 69 PRK10771 thiQ thiamine transpo  98.0 0.00095 2.4E-08   46.5  14.4  133  635-780    14-198 (233)
 70 COG0488 Uup ATPase components   97.9  0.0015 3.8E-08   45.0  15.3  134  634-777   336-500 (530)
 71 TIGR01978 sufC FeS assembly AT  97.9 4.3E-05 1.1E-09   56.5   7.4  132  635-779    15-215 (248)
 72 cd03268 ABC_BcrA_bacitracin_re  97.9 0.00043 1.1E-08   49.0  12.3  141  634-780    14-194 (208)
 73 cd03231 ABC_CcmA_heme_exporter  97.9 0.00041   1E-08   49.2  12.2  131  635-780    15-193 (201)
 74 PRK10253 iron-enterobactin tra  97.9 0.00016 4.1E-09   52.2  10.1   49  727-776   159-207 (265)
 75 cd03263 ABC_subfamily_A The AB  97.9 0.00013 3.3E-09   53.0   9.5  130  635-781    17-201 (220)
 76 PRK09544 znuC high-affinity zi  97.9 0.00014 3.6E-09   52.7   9.6  136  634-777    18-185 (251)
 77 PRK10584 putative ABC transpor  97.9 0.00028 7.2E-09   50.4  11.2  131  635-779    25-213 (228)
 78 cd03226 ABC_cobalt_CbiO_domain  97.9 0.00017 4.3E-09   52.0  10.0  134  634-780    14-194 (205)
 79 cd03235 ABC_Metallic_Cations A  97.9 0.00014 3.5E-09   52.7   9.5   48  727-776   148-195 (213)
 80 KOG0062 consensus               97.9 1.7E-05 4.3E-10   59.5   4.6   43  731-778   502-544 (582)
 81 PRK13647 cbiO cobalt transport  97.9 0.00013 3.4E-09   52.8   9.2  138  635-780    20-206 (273)
 82 cd03224 ABC_TM1139_LivF_branch  97.9 0.00012 3.1E-09   53.1   8.9  133  635-780    15-200 (222)
 83 PRK09700 D-allose transporter   97.9 0.00023   6E-09   51.0  10.3   52  728-781   426-478 (510)
 84 PRK13546 teichoic acids export  97.9 0.00011 2.7E-09   53.5   8.5  163  635-841    39-243 (264)
 85 PRK03695 vitamin B12-transport  97.9 0.00011 2.9E-09   53.4   8.6  136  635-776    12-193 (245)
 86 TIGR03522 GldA_ABC_ATP gliding  97.9 0.00029 7.3E-09   50.3  10.6  138  634-781    16-201 (301)
 87 PRK13648 cbiO cobalt transport  97.9 0.00019 4.9E-09   51.6   9.7  131  631-777    20-207 (269)
 88 PRK10938 putative molybdenum t  97.9 0.00026 6.7E-09   50.6  10.4   50  727-777   417-466 (490)
 89 COG1131 CcmA ABC-type multidru  97.9 0.00016 4.1E-09   52.2   9.1  137  633-777    18-201 (293)
 90 PRK11000 maltose/maltodextrin   97.9 0.00059 1.5E-08   48.0  12.0  140  634-780    17-202 (369)
 91 PRK10895 putative ABC transpor  97.9 0.00072 1.8E-08   47.3  12.3  139  634-780    17-205 (241)
 92 PRK13649 cbiO cobalt transport  97.8 0.00063 1.6E-08   47.8  11.8  171  635-834    22-255 (280)
 93 cd03292 ABC_FtsE_transporter F  97.8 0.00038 9.6E-09   49.4  10.7  131  635-780    16-204 (214)
 94 cd03228 ABCC_MRP_Like The MRP   97.8 0.00021 5.4E-09   51.3   9.3  123  634-780    16-162 (171)
 95 cd03237 ABC_RNaseL_inhibitor_d  97.8 0.00017 4.3E-09   52.0   8.9  138  635-777     9-180 (246)
 96 COG1121 ZnuC ABC-type Mn/Zn tr  97.8 4.5E-05 1.1E-09   56.3   5.8  133  635-774    19-200 (254)
 97 TIGR03375 type_I_sec_LssB type  97.8 0.00052 1.3E-08   48.4  11.1  131  634-781   479-668 (694)
 98 PRK13548 hmuV hemin importer A  97.8 0.00024 6.1E-09   50.9   9.3  136  635-776    17-203 (257)
 99 cd03239 ABC_SMC_head The struc  97.8 0.00019 4.8E-09   51.7   8.8  129  651-787    23-172 (178)
100 PRK13640 cbiO cobalt transport  97.8 0.00016 4.2E-09   52.1   8.5   51  727-778   160-210 (283)
101 PRK10851 sulfate/thiosulfate t  97.8 0.00013 3.4E-09   52.8   7.9  141  635-781    17-206 (352)
102 PRK13632 cbiO cobalt transport  97.8 0.00022 5.6E-09   51.2   8.9  174  634-828    24-246 (273)
103 PRK11300 livG leucine/isoleuci  97.8 0.00034 8.6E-09   49.8   9.8   52  728-780   170-222 (255)
104 CHL00131 ycf16 sulfate ABC tra  97.8  0.0007 1.8E-08   47.4  11.4  135  634-777    20-214 (252)
105 PRK11231 fecE iron-dicitrate t  97.8 0.00077   2E-08   47.1  11.6  125  634-776    16-201 (255)
106 PRK10535 macrolide transporter  97.8 0.00021 5.4E-09   51.3   8.7   12  881-892   635-646 (648)
107 cd03234 ABCG_White The White s  97.8 0.00052 1.3E-08   48.4  10.7   33  635-671    22-54  (226)
108 PRK13537 lipooligosaccharide t  97.8 0.00067 1.7E-08   47.6  11.2  139  634-781    19-205 (304)
109 cd03225 ABC_cobalt_CbiO_domain  97.8 0.00013 3.3E-09   52.9   7.6  137  634-780    15-202 (211)
110 COG1119 ModF ABC-type molybden  97.8 0.00081 2.1E-08   47.0  11.4   21  651-671    58-78  (257)
111 PRK09493 glnQ glutamine ABC tr  97.8 0.00065 1.7E-08   47.7  10.9  134  635-777    16-200 (240)
112 PRK13542 consensus              97.8 0.00024 6.2E-09   50.8   8.8  131  635-772    33-206 (224)
113 cd03300 ABC_PotA_N PotA is an   97.8 0.00039 9.8E-09   49.4   9.7  133  634-780    14-199 (232)
114 cd03246 ABCC_Protease_Secretio  97.8 0.00042 1.1E-08   49.1   9.9  128  634-780    16-163 (173)
115 cd03245 ABCC_bacteriocin_expor  97.8 0.00028 7.1E-09   50.4   9.0  136  633-781    17-207 (220)
116 PRK09984 phosphonate/organopho  97.8 0.00043 1.1E-08   49.0   9.9   48  728-776   169-216 (262)
117 PRK09452 potA putrescine/sperm  97.8 0.00032 8.3E-09   49.9   9.2  142  634-781    31-217 (378)
118 PRK11629 lolD lipoprotein tran  97.7  0.0013 3.4E-08   45.4  12.3  130  635-779    24-212 (233)
119 cd03256 ABC_PhnC_transporter A  97.7 0.00021 5.3E-09   51.4   8.2   34  635-672    16-49  (241)
120 PRK11831 putative ABC transpor  97.7  0.0011 2.9E-08   45.9  11.9  138  635-780    23-213 (269)
121 PRK10619 histidine/lysine/argi  97.7 0.00058 1.5E-08   48.0  10.4   49  727-777   168-216 (257)
122 TIGR03410 urea_trans_UrtE urea  97.7 0.00037 9.4E-09   49.5   9.4  133  635-780    15-200 (230)
123 PRK11248 tauB taurine transpor  97.7  0.0011 2.8E-08   45.9  11.8  132  635-780    16-197 (255)
124 cd03296 ABC_CysA_sulfate_impor  97.7  0.0004   1E-08   49.2   9.5  132  635-780    17-205 (239)
125 cd03301 ABC_MalK_N The N-termi  97.7  0.0004   1E-08   49.2   9.5  134  634-781    14-200 (213)
126 cd03236 ABC_RNaseL_inhibitor_d  97.7 0.00062 1.6E-08   47.8  10.4   48  727-776   155-202 (255)
127 PRK11650 ugpC glycerol-3-phosp  97.7 0.00035 8.8E-09   49.7   9.1  131  635-781    19-204 (358)
128 cd03264 ABC_drug_resistance_li  97.7   0.001 2.6E-08   46.2  11.3   47  727-776   146-192 (211)
129 PRK11819 putative ABC transpor  97.7 0.00022 5.6E-09   51.2   7.7  134  634-777   338-506 (556)
130 PRK11432 fbpC ferric transport  97.7 0.00045 1.1E-08   48.9   9.3  153  607-781     2-206 (351)
131 cd03293 ABC_NrtD_SsuB_transpor  97.7 0.00014 3.6E-09   52.6   6.7  130  635-780    19-200 (220)
132 PRK13637 cbiO cobalt transport  97.7  0.0015 3.9E-08   44.9  11.9  139  635-780    22-213 (287)
133 PRK11288 araG L-arabinose tran  97.7 0.00068 1.7E-08   47.5  10.0   53  727-781   412-465 (501)
134 PRK13650 cbiO cobalt transport  97.7  0.0004   1E-08   49.2   8.9  139  633-777    17-202 (276)
135 PRK13635 cbiO cobalt transport  97.7 0.00015 3.9E-09   52.4   6.5  128  634-777    21-205 (279)
136 TIGR03269 met_CoM_red_A2 methy  97.7 0.00047 1.2E-08   48.7   9.0   32  636-671   300-331 (520)
137 cd03247 ABCC_cytochrome_bd The  97.7  0.0011 2.8E-08   45.9  10.7  126  634-777    16-161 (178)
138 COG3910 Predicted ATPase [Gene  97.6 0.00032   8E-09   50.0   7.8  127  651-790    38-201 (233)
139 cd03266 ABC_NatA_sodium_export  97.6  0.0015 3.7E-08   45.0  11.1  131  635-780    20-204 (218)
140 PRK09536 btuD corrinoid ABC tr  97.6 0.00039 9.8E-09   49.4   8.1  125  635-777    17-202 (409)
141 PRK13536 nodulation factor exp  97.6 0.00099 2.5E-08   46.3  10.2   47  728-776   155-201 (306)
142 cd03219 ABC_Mj1267_LivG_branch  97.6  0.0013 3.3E-08   45.4  10.8  137  635-780    15-211 (236)
143 PRK13641 cbiO cobalt transport  97.6  0.0015 3.8E-08   45.0  11.0   52  727-780   161-213 (286)
144 PRK11607 potG putrescine trans  97.6  0.0031   8E-08   42.6  12.7  141  635-781    34-219 (377)
145 PRK13631 cbiO cobalt transport  97.6 0.00076 1.9E-08   47.1   9.4   52  727-780   192-244 (320)
146 cd03278 ABC_SMC_barmotin Barmo  97.6 0.00083 2.1E-08   46.9   9.6   55  729-791   135-191 (197)
147 cd03259 ABC_Carb_Solutes_like   97.6 0.00047 1.2E-08   48.7   8.3  139  635-780    15-199 (213)
148 PRK11147 ABC transporter ATPas  97.6 0.00048 1.2E-08   48.7   8.2  134  634-777   333-501 (632)
149 COG2274 SunT ABC-type bacterio  97.6  0.0054 1.4E-07   40.8  13.6  128  633-777   486-672 (709)
150 PRK13651 cobalt transporter AT  97.6  0.0013 3.2E-08   45.5  10.3   48  727-776   177-224 (304)
151 cd03298 ABC_ThiQ_thiamine_tran  97.6  0.0034 8.7E-08   42.3  12.4  129  638-780    16-197 (211)
152 PRK10982 galactose/methyl gala  97.6 0.00075 1.9E-08   47.2   9.0   52  728-781   408-460 (491)
153 PRK10762 D-ribose transporter   97.6  0.0003 7.7E-09   50.2   7.0   53  727-781   411-464 (501)
154 PRK13636 cbiO cobalt transport  97.6  0.0025 6.4E-08   43.3  11.7   50  727-777   157-206 (285)
155 PRK11147 ABC transporter ATPas  97.6  0.0041 1.1E-07   41.7  12.8   13  308-320    39-51  (632)
156 cd03257 ABC_NikE_OppD_transpor  97.6  0.0019 4.8E-08   44.2  11.0   53  727-780   161-214 (228)
157 PRK11819 putative ABC transpor  97.6 0.00076 1.9E-08   47.2   8.9   16  697-715   353-368 (556)
158 PRK13634 cbiO cobalt transport  97.6  0.0022 5.6E-08   43.7  11.2   53  727-780   148-201 (276)
159 COG4586 ABC-type uncharacteriz  97.6 0.00068 1.7E-08   47.5   8.6  147  637-790    41-235 (325)
160 COG1120 FepC ABC-type cobalami  97.6 0.00086 2.2E-08   46.7   9.1  129  632-777    14-203 (258)
161 PRK13652 cbiO cobalt transport  97.6  0.0016 4.1E-08   44.7  10.4   52  728-780   154-206 (277)
162 PRK13638 cbiO cobalt transport  97.6  0.0013 3.2E-08   45.5   9.8   87  727-829   152-240 (271)
163 PRK10908 cell division protein  97.5  0.0024 6.1E-08   43.4  11.2  134  635-777    17-201 (222)
164 PRK13549 xylose transporter AT  97.5 0.00056 1.4E-08   48.1   7.9   53  727-781   421-474 (513)
165 PRK13633 cobalt transporter AT  97.5 0.00063 1.6E-08   47.8   8.1  130  634-777    25-210 (281)
166 PRK10938 putative molybdenum t  97.5  0.0034 8.6E-08   42.3  11.7   33  635-671   275-307 (490)
167 PRK11124 artP arginine transpo  97.5  0.0031   8E-08   42.6  11.5   52  727-780   157-209 (242)
168 PRK10636 putative ABC transpor  97.5 0.00053 1.3E-08   48.3   7.5  134  634-777   326-491 (638)
169 PRK09580 sufC cysteine desulfu  97.5   0.002 5.2E-08   44.0  10.5   35  634-672    15-49  (248)
170 PRK13643 cbiO cobalt transport  97.5 0.00073 1.8E-08   47.3   8.1  135  635-777    21-208 (288)
171 PRK10636 putative ABC transpor  97.5  0.0033 8.3E-08   42.4  11.4   17  308-324    37-53  (638)
172 PRK11701 phnK phosphonates tra  97.5  0.0013 3.3E-08   45.5   9.3   53  727-780   167-220 (258)
173 PRK13642 cbiO cobalt transport  97.5  0.0012   3E-08   45.8   9.0  129  635-777    22-205 (277)
174 COG4555 NatA ABC-type Na+ tran  97.5 0.00059 1.5E-08   48.0   7.5  129  648-780    26-201 (245)
175 PRK13646 cbiO cobalt transport  97.5 0.00059 1.5E-08   48.0   7.4   53  727-780   161-214 (286)
176 PRK13644 cbiO cobalt transport  97.5  0.0011 2.8E-08   45.9   8.7  133  635-775    17-198 (274)
177 cd03261 ABC_Org_Solvent_Resist  97.5  0.0021 5.4E-08   43.8  10.0  133  635-781    15-206 (235)
178 TIGR02673 FtsE cell division A  97.5  0.0017 4.4E-08   44.5   9.6  132  637-779    19-203 (215)
179 PRK11264 putative amino-acid A  97.5  0.0022 5.5E-08   43.8  10.0   35  634-672    15-49  (248)
180 TIGR03265 PhnT2 putative 2-ami  97.5 0.00017 4.3E-09   52.0   4.4  142  635-781    19-204 (353)
181 cd03251 ABCC_MsbA MsbA is an e  97.5  0.0032 8.1E-08   42.5  10.9   41  633-685    15-55  (234)
182 PRK10744 phosphate transporter  97.4   0.003 7.7E-08   42.7  10.5   36  634-673    24-59  (257)
183 PRK13639 cbiO cobalt transport  97.4 0.00071 1.8E-08   47.4   7.2   48  728-777   154-201 (275)
184 TIGR03258 PhnT 2-aminoethylpho  97.4  0.0017 4.4E-08   44.5   9.1  137  635-776    20-202 (362)
185 cd03248 ABCC_TAP TAP, the Tran  97.4  0.0032 8.1E-08   42.5  10.4  131  633-780    27-216 (226)
186 cd03289 ABCC_CFTR2 The CFTR su  97.4  0.0042 1.1E-07   41.7  10.9   34  634-671    18-51  (275)
187 COG1118 CysA ABC-type sulfate/  97.4  0.0022 5.7E-08   43.7   9.5  138  637-780    19-206 (345)
188 cd03260 ABC_PstB_phosphate_tra  97.4  0.0064 1.6E-07   40.3  11.7   37  634-674    14-50  (227)
189 TIGR03411 urea_trans_UrtD urea  97.4  0.0028 7.2E-08   42.9   9.8  132  635-776    17-205 (242)
190 PRK13409 putative ATPase RIL;   97.4  0.0057 1.5E-07   40.6  11.1  157  649-840   364-555 (590)
191 cd03290 ABCC_SUR1_N The SUR do  97.4  0.0031   8E-08   42.6   9.8   33  635-671    16-48  (218)
192 cd03254 ABCC_Glucan_exporter_l  97.3  0.0028   7E-08   43.0   9.5   34  634-671    17-50  (229)
193 cd03297 ABC_ModC_molybdenum_tr  97.3  0.0057 1.5E-07   40.6  11.1  141  633-781    12-201 (214)
194 cd03369 ABCC_NFT1 Domain 2 of   97.3  0.0055 1.4E-07   40.7  11.0   34  634-671    22-55  (207)
195 PRK13549 xylose transporter AT  97.3  0.0052 1.3E-07   40.9  10.7   33  635-671   277-309 (513)
196 cd03253 ABCC_ATM1_transporter   97.3  0.0088 2.3E-07   39.2  11.8   41  634-686    15-55  (236)
197 PRK11288 araG L-arabinose tran  97.3  0.0042 1.1E-07   41.7  10.1   33  635-671   268-300 (501)
198 COG4619 ABC-type uncharacteriz  97.3  0.0058 1.5E-07   40.6  10.6  133  633-774    16-195 (223)
199 COG4152 ABC-type uncharacteriz  97.3  0.0017 4.2E-08   44.6   7.7  121  635-773    17-190 (300)
200 cd03295 ABC_OpuCA_Osmoprotecti  97.3  0.0073 1.9E-07   39.8  11.0  139  635-781    16-205 (242)
201 PRK10762 D-ribose transporter   97.3  0.0063 1.6E-07   40.3  10.5   31  637-671   269-299 (501)
202 cd03291 ABCC_CFTR1 The CFTR su  97.2  0.0089 2.3E-07   39.2  11.2  124  635-776    52-222 (282)
203 PRK09700 D-allose transporter   97.2   0.013 3.4E-07   37.9  12.1   31  637-671   280-310 (510)
204 pfam01695 IstB IstB-like ATP b  97.2   0.015 3.7E-07   37.6  12.1  101  652-773    49-150 (178)
205 TIGR01189 ccmA heme ABC export  97.2 0.00036 9.2E-09   49.6   3.7  124  633-772    15-190 (204)
206 PRK13645 cbiO cobalt transport  97.2  0.0035   9E-08   42.2   8.4   53  727-780   166-219 (289)
207 KOG0927 consensus               97.2   0.025 6.5E-07   35.8  12.7  144  635-791   405-585 (614)
208 cd03249 ABC_MTABC3_MDL1_MDL2 M  97.2   0.009 2.3E-07   39.1  10.4   34  634-671    17-50  (238)
209 COG1122 CbiO ABC-type cobalt t  97.1  0.0035   9E-08   42.2   7.9   49  728-777   155-203 (235)
210 cd03252 ABCC_Hemolysin The ABC  97.1   0.015 3.7E-07   37.6  11.0   36  632-671    14-49  (237)
211 pfam00154 RecA recA bacterial   97.1  0.0069 1.8E-07   40.0   9.3  130  637-774    40-190 (322)
212 COG3845 ABC-type uncharacteriz  97.0   0.012 3.1E-07   38.1  10.1   54  728-785   420-476 (501)
213 PRK06526 transposase; Provisio  97.0   0.023 5.8E-07   36.1  11.4   95  653-773   101-201 (254)
214 cd03262 ABC_HisP_GlnQ_permease  97.0   0.014 3.6E-07   37.7  10.2  138  635-780    15-203 (213)
215 TIGR02982 heterocyst_DevA ABC   97.0  0.0069 1.8E-07   40.0   8.5  134  632-782    17-211 (220)
216 PRK13657 cyclic beta-1,2-gluca  97.0   0.025 6.3E-07   35.9  11.2   32  635-670   350-381 (585)
217 pfam03266 DUF265 Protein of un  97.0   0.019 4.8E-07   36.7  10.6  134  653-792     2-157 (168)
218 PRK11153 metN DL-methionine tr  96.9   0.019   5E-07   36.6  10.5   49  727-776   156-204 (343)
219 cd03288 ABCC_SUR2 The SUR doma  96.9   0.029 7.3E-07   35.4  11.4   35  633-671    34-68  (257)
220 PRK09354 recA recombinase A; P  96.9   0.017 4.4E-07   37.1  10.0  137  635-775    46-199 (350)
221 PRK11160 cysteine/glutathione   96.9   0.011 2.7E-07   38.6   8.9   34  634-671   355-388 (575)
222 PRK10261 glutathione transport  96.9   0.013 3.3E-07   38.0   9.0   32  636-671   340-371 (623)
223 cd00009 AAA The AAA+ (ATPases   96.9   0.016 4.1E-07   37.2   9.5  108  650-775    19-132 (151)
224 PRK10418 nikD nickel transport  96.8   0.038 9.7E-07   34.5  11.2   34  634-671    17-50  (254)
225 KOG0064 consensus               96.8   0.011 2.7E-07   38.6   8.3   44  648-698   506-549 (728)
226 PRK10982 galactose/methyl gala  96.8   0.014 3.6E-07   37.7   8.8   31  637-671   265-295 (491)
227 COG2401 ABC-type ATPase fused   96.7   0.017 4.4E-07   37.1   9.0  137  633-778   396-573 (593)
228 PRK10419 nikE nickel transport  96.7   0.054 1.4E-06   33.3  11.5   51  727-780   167-220 (266)
229 PRK08116 hypothetical protein;  96.7   0.058 1.5E-06   33.1  12.6  113  649-780   107-221 (262)
230 TIGR00954 3a01203 Peroxysomal   96.7  0.0014 3.6E-08   45.2   3.1   50  636-687   544-605 (788)
231 PRK13545 tagH teichoic acids e  96.7  0.0073 1.9E-07   39.8   6.7   24   43-66      5-28  (549)
232 COG4133 CcmA ABC-type transpor  96.7  0.0023 5.8E-08   43.6   4.1   34  633-672    17-50  (209)
233 COG4988 CydD ABC-type transpor  96.7   0.064 1.6E-06   32.8  11.4   81  576-670   281-367 (559)
234 TIGR03415 ABC_choXWV_ATP choli  96.7   0.013 3.2E-07   38.1   7.7   34  636-673    40-73  (382)
235 COG4178 ABC-type uncharacteriz  96.6    0.03 7.5E-07   35.3   9.3  197  561-780   331-581 (604)
236 COG1136 SalX ABC-type antimicr  96.6   0.031 7.9E-07   35.1   9.4   51  727-781   158-211 (226)
237 cd03294 ABC_Pro_Gly_Bertaine T  96.5   0.025 6.4E-07   35.8   8.6  138  634-780    38-229 (269)
238 COG1129 MglA ABC-type sugar tr  96.5   0.081 2.1E-06   32.0  11.9   54  727-781   417-470 (500)
239 KOG0927 consensus               96.5   0.021 5.3E-07   36.4   7.9   38  299-336    95-139 (614)
240 TIGR02858 spore_III_AA stage I  96.5   0.016 4.2E-07   37.2   7.4  129  614-780   105-248 (282)
241 TIGR01842 type_I_sec_PrtD type  96.5   0.042 1.1E-06   34.2   9.4  147  609-782   318-535 (556)
242 COG3839 MalK ABC-type sugar tr  96.5  0.0036 9.2E-08   42.1   4.0  131  635-781    18-203 (338)
243 PRK08181 transposase; Validate  96.4   0.089 2.3E-06   31.7  11.0   96  653-773   109-209 (269)
244 COG0410 LivF ABC-type branched  96.3   0.017 4.4E-07   37.1   6.8  130  635-772    18-196 (237)
245 PRK08939 primosomal protein Dn  96.3     0.1 2.6E-06   31.3  12.1  105  649-782   156-270 (306)
246 KOG0056 consensus               96.3     0.1 2.6E-06   31.3  15.6  150  600-771   526-731 (790)
247 TIGR03269 met_CoM_red_A2 methy  96.3   0.052 1.3E-06   33.5   9.1   54  727-781   443-497 (520)
248 PRK09183 transposase/IS protei  96.2   0.046 1.2E-06   33.8   8.4   95  653-773   104-205 (258)
249 pfam03215 Rad17 Rad17 cell cyc  96.2   0.052 1.3E-06   33.4   8.6   34  658-692   449-483 (490)
250 cd03258 ABC_MetN_methionine_tr  96.2   0.099 2.5E-06   31.4  10.0  138  635-780    20-209 (233)
251 KOG0059 consensus               96.2   0.091 2.3E-06   31.6   9.7   64  727-792   714-778 (885)
252 cd00983 recA RecA is a  bacter  96.1    0.07 1.8E-06   32.5   9.0  122  648-775    53-194 (325)
253 TIGR01288 nodI nodulation ABC   96.1   0.027 6.8E-07   35.6   6.8  140  631-776    15-198 (303)
254 KOG0217 consensus               96.0 1.8E-05 4.7E-10   59.3  -9.6  176  648-833   752-941 (1125)
255 PRK10790 putative multidrug tr  96.0    0.14 3.5E-06   30.3  13.4  123  634-773   355-535 (593)
256 PRK00440 rfc replication facto  96.0    0.12 3.1E-06   30.7   9.8   99  653-773    40-141 (318)
257 cd01122 GP4d_helicase GP4d_hel  95.9   0.025 6.4E-07   35.8   6.0   44  648-692    28-71  (271)
258 PRK13695 putative NTPase; Prov  95.8    0.13 3.3E-06   30.5   9.3  115  653-773     6-139 (174)
259 PRK04195 replication factor C   95.8    0.15 3.8E-06   30.0   9.6   15  530-544   324-338 (403)
260 PRK09473 oppD oligopeptide tra  95.8    0.12 3.2E-06   30.6   9.0   33  635-671    31-63  (330)
261 smart00382 AAA ATPases associa  95.7  0.0092 2.3E-07   39.1   3.1   90  651-746     3-95  (148)
262 KOG0060 consensus               95.7   0.085 2.2E-06   31.9   8.0  125  648-777   459-631 (659)
263 COG0411 LivG ABC-type branched  95.6   0.013 3.3E-07   37.9   3.4  133  635-772    19-209 (250)
264 PRK10869 recombination and rep  95.5    0.22 5.6E-06   28.8  26.0  112  710-837   436-552 (553)
265 cd03244 ABCC_MRP_domain2 Domai  95.4   0.024 6.1E-07   36.0   4.3   35  633-671    17-51  (221)
266 cd03275 ABC_SMC1_euk Eukaryoti  95.4    0.23 5.8E-06   28.6  10.2   74  704-785   154-231 (247)
267 PRK07952 DNA replication prote  95.4    0.16   4E-06   29.9   8.5  103  652-772    98-201 (242)
268 PRK11308 dppF dipeptide transp  95.2    0.27 6.8E-06   28.2  11.2   47  727-777   170-219 (327)
269 PRK12402 replication factor C   95.2    0.22 5.6E-06   28.8   8.7  104  653-773    39-165 (337)
270 PRK10261 glutathione transport  95.2    0.27 6.8E-06   28.1  11.2   47  727-776   479-527 (623)
271 COG1618 Predicted nucleotide k  95.1   0.052 1.3E-06   33.4   5.3  127  653-786     8-156 (179)
272 COG4559 ABC-type hemin transpo  95.1    0.02 5.2E-07   36.5   3.2   40  635-686    16-55  (259)
273 pfam05729 NACHT NACHT domain.   95.1    0.18 4.6E-06   29.4   8.0  121  651-782     1-138 (165)
274 PRK06921 hypothetical protein;  95.1    0.26 6.5E-06   28.3   8.7  130  652-806   118-262 (265)
275 cd00984 DnaB_C DnaB helicase C  94.9    0.18 4.5E-06   29.5   7.5   42  649-691    12-53  (242)
276 PRK10789 putative multidrug tr  94.9    0.08   2E-06   32.1   5.6   33  635-671   330-362 (569)
277 cd03279 ABC_sbcCD SbcCD and ot  94.7   0.052 1.3E-06   33.4   4.4   35  637-674    18-52  (213)
278 PRK03918 chromosome segregatio  94.7   0.033 8.5E-07   34.9   3.3   71  704-781   790-865 (882)
279 cd01120 RecA-like_NTPases RecA  94.6    0.05 1.3E-06   33.6   4.1   86  653-738     2-94  (165)
280 pfam00004 AAA ATPase family as  94.6    0.38 9.7E-06   27.0  10.0  103  653-777     1-115 (131)
281 PRK06835 DNA replication prote  94.5     0.4   1E-05   26.9  10.9  102  652-773   185-289 (330)
282 PRK13342 recombination factor   94.4    0.41   1E-05   26.8   8.9   13  534-546   393-405 (417)
283 COG0497 RecN ATPase involved i  94.4    0.42 1.1E-05   26.7  11.6  113  710-838   437-554 (557)
284 COG3842 PotA ABC-type spermidi  94.4   0.067 1.7E-06   32.6   4.3  136  633-776    18-200 (352)
285 COG3950 Predicted ATP-binding   94.1   0.066 1.7E-06   32.7   3.8   38  731-772   297-335 (440)
286 TIGR00618 sbcc exonuclease Sbc  94.1   0.056 1.4E-06   33.2   3.4   72  705-778   970-1046(1063)
287 TIGR00968 3a0106s01 sulfate AB  94.1   0.065 1.7E-06   32.7   3.7  149  635-791    15-214 (241)
288 KOG0922 consensus               94.0   0.048 1.2E-06   33.7   3.0   29   84-112    48-76  (674)
289 PRK10070 glycine betaine trans  94.0   0.062 1.6E-06   32.9   3.5   33  636-672    44-76  (400)
290 TIGR03185 DNA_S_dndD DNA sulfu  93.9     0.1 2.5E-06   31.3   4.4   36   66-101    28-77  (650)
291 COG4138 BtuD ABC-type cobalami  93.9    0.51 1.3E-05   26.0  10.5   22  648-669    23-44  (248)
292 KOG0065 consensus               93.9    0.13 3.3E-06   30.5   4.9  112  654-776   821-993 (1391)
293 cd03241 ABC_RecN RecN ATPase i  93.9    0.52 1.3E-05   26.0  11.3   92  719-823   182-275 (276)
294 cd03277 ABC_SMC5_euk Eukaryoti  93.8   0.069 1.8E-06   32.5   3.5  103  649-760    22-175 (213)
295 PRK02224 chromosome segregatio  93.8   0.071 1.8E-06   32.4   3.5   75  704-781   780-862 (880)
296 PRK01156 chromosome segregatio  93.8   0.063 1.6E-06   32.8   3.3   74  704-781   800-878 (895)
297 COG0419 SbcC ATPase involved i  93.8   0.072 1.8E-06   32.4   3.4   73  704-781   814-891 (908)
298 PTZ00243 ABC transporter; Prov  93.8    0.54 1.4E-05   25.9   9.6   31  634-668  1324-1354(1560)
299 TIGR02324 CP_lyasePhnL phospho  93.7   0.059 1.5E-06   33.0   2.9   32  635-670    23-54  (224)
300 PRK13409 putative ATPase RIL;   93.5    0.12 3.1E-06   30.6   4.3   16  696-714   367-382 (590)
301 pfam09818 ABC_ATPase Predicted  93.5    0.23 5.7E-06   28.7   5.6   48  652-704   245-292 (447)
302 PRK09112 DNA polymerase III su  93.5    0.26 6.6E-06   28.2   5.9  119  649-774    44-182 (352)
303 pfam01580 FtsK_SpoIIIE FtsK/Sp  93.4    0.22 5.6E-06   28.8   5.5  119  653-773    41-200 (202)
304 COG1106 Predicted ATPases [Gen  93.4     0.1 2.5E-06   31.3   3.7   50  730-780   271-320 (371)
305 TIGR01166 cbiO cobalt ABC tran  93.4   0.063 1.6E-06   32.8   2.6  114  648-775    16-189 (190)
306 PRK10246 exonuclease subunit S  93.4   0.097 2.5E-06   31.4   3.6   95  680-777   919-1021(1047)
307 cd01394 radB RadB. The archaea  93.3    0.64 1.6E-05   25.3   9.2  119  649-772    18-157 (218)
308 COG1126 GlnQ ABC-type polar am  93.2    0.11 2.8E-06   31.1   3.7  130  634-774    16-197 (240)
309 PRK10522 multidrug transporter  93.2    0.56 1.4E-05   25.7   7.3   33  634-670   337-369 (547)
310 TIGR03015 pepcterm_ATPase puta  93.2    0.27   7E-06   28.1   5.7   83  650-738    43-132 (269)
311 pfam03796 DnaB_C DnaB-like hel  93.2    0.59 1.5E-05   25.6   7.4  116  649-773    18-139 (186)
312 TIGR02169 SMC_prok_A chromosom  93.1    0.04   1E-06   34.3   1.3   21  173-193   131-153 (1202)
313 cd03276 ABC_SMC6_euk Eukaryoti  93.0     0.1 2.7E-06   31.2   3.3   24  650-673    21-44  (198)
314 PRK13341 recombination factor   92.9    0.55 1.4E-05   25.8   6.9   23  813-837   682-704 (726)
315 COG2884 FtsE Predicted ATPase   92.9    0.12   3E-06   30.8   3.4   47  728-778   154-202 (223)
316 PRK11174 cysteine/glutathione   92.8    0.74 1.9E-05   24.8   7.4   33  634-670   364-396 (588)
317 TIGR00972 3a0107s01c2 phosphat  92.8    0.11 2.9E-06   31.0   3.2  121  635-772    16-202 (248)
318 COG4987 CydC ABC-type transpor  92.7    0.61 1.6E-05   25.5   6.8   45  729-779   492-537 (573)
319 PRK00064 recF recombination pr  92.7    0.13 3.3E-06   30.5   3.4   59  726-791   297-355 (355)
320 COG1193 Mismatch repair ATPase  92.7  0.0024   6E-08   43.5  -5.5  119  650-772   532-653 (753)
321 PRK09361 radB DNA repair and r  92.6    0.79   2E-05   24.6   7.9  121  649-772    22-160 (224)
322 pfam00910 RNA_helicase RNA hel  92.6    0.54 1.4E-05   25.8   6.5   64  654-745     2-65  (105)
323 PRK11664 ATP-dependent RNA hel  92.5    0.32 8.2E-06   27.5   5.3   27   83-109     1-27  (812)
324 pfam05496 RuvB_N Holliday junc  92.5    0.56 1.4E-05   25.8   6.5   62  653-742    53-114 (234)
325 COG3638 ABC-type phosphate/pho  92.5    0.24 6.2E-06   28.4   4.6   35  634-672    18-52  (258)
326 TIGR02315 ABC_phnC phosphonate  92.5    0.13 3.2E-06   30.6   3.1   30  638-671    20-49  (253)
327 smart00763 AAA_PrkA PrkA AAA d  92.4    0.15 3.8E-06   30.1   3.4   18  651-668    79-96  (361)
328 TIGR00602 rad24 checkpoint pro  92.4    0.12 3.2E-06   30.6   3.0   39  290-332   250-288 (670)
329 TIGR02012 tigrfam_recA protein  92.4    0.17 4.3E-06   29.6   3.7  133  635-772    41-191 (322)
330 TIGR03420 DnaA_homol_Hda DnaA   92.4    0.84 2.1E-05   24.4  10.6   96  650-773    38-133 (226)
331 COG1134 TagH ABC-type polysacc  92.3    0.18 4.6E-06   29.4   3.7  127  634-776    41-210 (249)
332 COG1480 Predicted membrane-ass  92.3    0.58 1.5E-05   25.6   6.3   76  748-834   498-582 (700)
333 PRK11176 lipid transporter ATP  92.2    0.43 1.1E-05   26.6   5.6   33  634-670   356-388 (581)
334 COG4604 CeuD ABC-type enteroch  92.2    0.22 5.5E-06   28.8   4.1   72  632-728    13-84  (252)
335 KOG0057 consensus               92.2    0.87 2.2E-05   24.3   7.2  122  653-781   381-554 (591)
336 COG4615 PvdE ABC-type sideroph  92.2    0.44 1.1E-05   26.5   5.6  151  601-773   311-509 (546)
337 pfam05707 Zot Zonular occluden  92.2    0.88 2.3E-05   24.3   9.8  108  652-775     2-118 (183)
338 PRK06995 flhF flagellar biosyn  92.1     0.9 2.3E-05   24.2   7.9  159  649-831   175-346 (404)
339 COG3044 Predicted ATPase of th  92.0    0.18 4.7E-06   29.3   3.5   21  652-672   244-264 (554)
340 KOG0743 consensus               91.9    0.85 2.2E-05   24.4   6.8  145  648-841   233-397 (457)
341 COG4161 ArtP ABC-type arginine  91.9    0.25 6.5E-06   28.3   4.1   36  635-674    17-52  (242)
342 KOG0979 consensus               91.8    0.24   6E-06   28.5   3.8   68   40-110    19-94  (1072)
343 COG1125 OpuBA ABC-type proline  91.6    0.23   6E-06   28.6   3.7   32  635-670    16-47  (309)
344 pfam00931 NB-ARC NB-ARC domain  91.5    0.68 1.7E-05   25.1   5.9  174  648-836    17-206 (285)
345 PRK09519 recA recombinase A; R  91.4    0.53 1.3E-05   25.9   5.3   10  823-832   719-728 (790)
346 COG1127 Ttg2A ABC-type transpo  91.3     1.1 2.7E-05   23.6  13.1  126  633-772    21-205 (263)
347 COG4717 Uncharacterized conser  91.3    0.15 3.8E-06   30.1   2.4   89  685-777   863-971 (984)
348 cd03242 ABC_RecF RecF is a rec  91.2    0.23 5.9E-06   28.6   3.3   30  728-761   209-238 (270)
349 PRK12727 flagellar biosynthesi  90.9     1.2   3E-05   23.3   7.2  127  649-786   347-483 (557)
350 TIGR01186 proV glycine betaine  90.8    0.27 6.9E-06   28.1   3.4   11  603-613   339-349 (372)
351 PRK11022 dppD dipeptide transp  90.8     0.3 7.7E-06   27.8   3.6   33  635-671    22-54  (327)
352 COG4674 Uncharacterized ABC-ty  90.8    0.11 2.8E-06   31.1   1.3   45  729-776   165-209 (249)
353 pfam02463 SMC_N RecF/RecN/SMC   90.6    0.29 7.4E-06   27.9   3.4   12  180-191   117-128 (1162)
354 COG4637 Predicted ATPase [Gene  90.6    0.36 9.1E-06   27.2   3.8  124  655-786   207-344 (373)
355 TIGR02533 type_II_gspE general  90.5    0.16   4E-06   29.9   1.9   19  652-670   247-265 (495)
356 pfam01637 Arch_ATPase Archaeal  90.3     1.3 3.4E-05   23.0  10.7   24  649-672    19-42  (223)
357 PRK12726 flagellar biosynthesi  90.2    0.79   2E-05   24.6   5.3   89  648-742   204-298 (407)
358 PRK04296 thymidine kinase; Pro  90.2     1.1 2.7E-05   23.7   5.9  147  650-808     2-161 (197)
359 pfam08298 AAA_PrkA PrkA AAA do  90.1    0.31 7.9E-06   27.7   3.2   21  649-669    84-104 (358)
360 COG0470 HolB ATPase involved i  90.1     1.4 3.5E-05   22.9   7.7  107  651-773    25-149 (325)
361 pfam00265 TK Thymidine kinase.  90.1     0.6 1.5E-05   25.5   4.6  142  650-808     1-155 (175)
362 COG4778 PhnL ABC-type phosphon  90.1     0.4   1E-05   26.9   3.7   33  635-671    26-58  (235)
363 KOG1970 consensus               90.0    0.27 6.9E-06   28.1   2.8   25  658-682   516-540 (634)
364 KOG0996 consensus               89.9     1.4 3.6E-05   22.7   7.8   13  124-136   104-116 (1293)
365 COG1116 TauB ABC-type nitrate/  89.8    0.37 9.4E-06   27.1   3.4  127  635-774    18-192 (248)
366 COG1196 Smc Chromosome segrega  89.8    0.32 8.1E-06   27.6   3.0   17  612-628   525-541 (1163)
367 TIGR01194 cyc_pep_trnsptr cycl  89.7    0.39   1E-05   26.9   3.4   58  611-686   337-396 (555)
368 TIGR01420 pilT_fam twitching m  89.7    0.22 5.5E-06   28.8   2.1   65  582-667    68-144 (350)
369 PRK06851 hypothetical protein;  89.6    0.42 1.1E-05   26.7   3.5   54  630-692   202-255 (368)
370 PRK10787 DNA-binding ATP-depen  89.6    0.46 1.2E-05   26.4   3.7   60  745-833   679-740 (784)
371 TIGR00929 VirB4_CagE type IV s  89.6    0.26 6.7E-06   28.2   2.5  184  653-845   519-751 (931)
372 PRK05703 flhF flagellar biosyn  89.6     1.5 3.7E-05   22.6   7.0  165  648-835   208-384 (412)
373 PRK00411 cdc6 cell division co  89.5    0.69 1.8E-05   25.1   4.6  121  653-777    58-187 (394)
374 COG1101 PhnK ABC-type uncharac  89.5    0.32 8.1E-06   27.6   2.8  128  635-772    21-208 (263)
375 TIGR01188 drrA daunorubicin re  89.4    0.38 9.6E-06   27.0   3.1  124  648-777    19-193 (343)
376 TIGR00611 recf DNA replication  89.3    0.29 7.5E-06   27.8   2.5   25  576-600   339-365 (399)
377 cd03115 SRP The signal recogni  89.1     1.6 4.1E-05   22.3   7.1  154  652-826     2-169 (173)
378 COG0466 Lon ATP-dependent Lon   89.0    0.73 1.9E-05   24.9   4.4  103  651-775   351-460 (782)
379 COG1643 HrpA HrpA-like helicas  88.9     1.6 4.2E-05   22.3   6.7   30  188-217   188-218 (845)
380 TIGR00960 3a0501s02 Type II (G  88.9    0.58 1.5E-05   25.7   3.8  123  649-778    28-203 (216)
381 cd01393 recA_like RecA is a  b  88.8     1.7 4.3E-05   22.2   8.0  116  649-773    18-169 (226)
382 COG3854 SpoIIIAA ncharacterize  88.6     1.7 4.4E-05   22.1   8.2  107  653-780   140-260 (308)
383 COG1117 PstB ABC-type phosphat  88.3    0.52 1.3E-05   26.0   3.2   35  635-673    22-56  (253)
384 KOG0061 consensus               88.3     1.8 4.6E-05   21.9  10.2   15  125-139    44-58  (613)
385 KOG2355 consensus               88.2    0.51 1.3E-05   26.1   3.1   38  731-773   167-208 (291)
386 KOG0744 consensus               88.1     1.8 4.7E-05   21.9   6.9  101  650-771   177-304 (423)
387 TIGR00606 rad50 rad50; InterPr  88.0    0.32 8.1E-06   27.6   2.0   50  128-177    21-95  (1328)
388 PRK12377 putative replication   87.9     1.9 4.8E-05   21.8  11.7  103  652-772   103-205 (248)
389 KOG2004 consensus               87.9     1.6   4E-05   22.4   5.5  104  648-776   436-549 (906)
390 TIGR02142 modC_ABC molybdate A  87.7     1.7 4.4E-05   22.1   5.6  139  636-782    13-202 (361)
391 PRK10078 ribose 1,5-bisphospho  87.4    0.59 1.5E-05   25.6   3.1   21  650-670     2-22  (184)
392 PRK06647 DNA polymerase III su  87.4       2 5.1E-05   21.6   7.2   15  255-269   131-145 (560)
393 PRK06893 DNA replication initi  87.2     2.1 5.2E-05   21.5  10.5  112  650-791    39-159 (229)
394 TIGR02868 CydC ABC transporter  87.1    0.74 1.9E-05   24.8   3.4  144  608-772   356-565 (566)
395 pfam00437 GSPII_E Type II/IV s  87.0    0.65 1.7E-05   25.2   3.1   22  650-671   139-160 (283)
396 COG1484 DnaC DNA replication p  86.9     2.1 5.5E-05   21.4  10.8   97  652-774   107-210 (254)
397 COG2256 MGS1 ATPase related to  86.9     1.9 4.9E-05   21.7   5.5   14  535-548   408-421 (436)
398 cd01123 Rad51_DMC1_radA Rad51_  86.8     2.2 5.5E-05   21.4  12.1  116  649-772    18-169 (235)
399 KOG0250 consensus               86.8    0.67 1.7E-05   25.1   3.1   11  754-764   586-596 (1074)
400 COG1419 FlhF Flagellar GTP-bin  86.6     2.2 5.6E-05   21.3   6.8  118  649-784   202-337 (407)
401 KOG1533 consensus               86.4    0.58 1.5E-05   25.6   2.6   37  285-337    95-131 (290)
402 TIGR00763 lon ATP-dependent pr  86.3     1.4 3.6E-05   22.8   4.5  104  649-780   448-568 (941)
403 COG1124 DppF ABC-type dipeptid  86.2     2.3 5.9E-05   21.1   9.4  133  635-777    22-206 (252)
404 cd01131 PilT Pilus retraction   86.2    0.71 1.8E-05   25.0   2.9   19  652-670     3-21  (198)
405 TIGR03263 guanyl_kin guanylate  86.1    0.84 2.1E-05   24.4   3.3   22  650-671     1-22  (180)
406 pfam05621 TniB Bacterial TniB   86.1     1.2   3E-05   23.3   4.0   48  721-771   138-189 (302)
407 pfam06745 KaiC KaiC. This fami  86.0     2.4   6E-05   21.1  10.3  122  649-775    18-167 (231)
408 COG4618 ArpD ABC-type protease  85.8     2.4 6.2E-05   21.0  11.1   53  728-782   489-541 (580)
409 cd01130 VirB11-like_ATPase Typ  85.7    0.75 1.9E-05   24.8   2.9  105  652-776    27-138 (186)
410 COG2804 PulE Type II secretory  85.3    0.81 2.1E-05   24.5   2.9   20  651-670   259-278 (500)
411 COG4185 Uncharacterized protei  85.2    0.33 8.3E-06   27.5   0.8   18  650-667     2-19  (187)
412 COG0194 Gmk Guanylate kinase [  85.0    0.94 2.4E-05   24.0   3.1  110  649-783     3-113 (191)
413 PRK08118 topology modulation p  84.7    0.89 2.3E-05   24.2   2.9   62  653-736     4-65  (167)
414 COG4148 ModC ABC-type molybdat  84.5     2.7   7E-05   20.6   8.8  149  636-790    14-207 (352)
415 cd01129 PulE-GspE PulE/GspE Th  84.5    0.93 2.4E-05   24.1   2.9   19  651-669    81-99  (264)
416 COG2805 PilT Tfp pilus assembl  84.3    0.74 1.9E-05   24.8   2.3   63  651-746   126-188 (353)
417 PRK10436 hypothetical protein;  84.1    0.99 2.5E-05   23.9   2.9   74  651-738   216-293 (461)
418 PRK01184 hypothetical protein;  83.9     1.4 3.5E-05   22.9   3.5  122  651-810     2-126 (183)
419 pfam00625 Guanylate_kin Guanyl  83.9     1.1 2.9E-05   23.5   3.1  110  651-783     2-112 (182)
420 cd03273 ABC_SMC2_euk Eukaryoti  83.9    0.99 2.5E-05   23.9   2.8   22  651-672    26-47  (251)
421 PRK00300 gmk guanylate kinase;  83.8     1.2   3E-05   23.3   3.2   23  648-670     5-27  (208)
422 PRK13768 GTPase; Provisional    83.7     1.2 2.9E-05   23.4   3.1   30  652-683     4-33  (253)
423 smart00072 GuKc Guanylate kina  83.6     1.2 3.2E-05   23.2   3.2   22  650-671     2-23  (184)
424 PRK11519 tyrosine kinase; Prov  83.5       2 5.1E-05   21.6   4.3   61  612-683   497-558 (720)
425 KOG0085 consensus               83.5    0.89 2.3E-05   24.2   2.4   11  606-616   264-274 (359)
426 pfam00308 Bac_DnaA Bacterial d  83.5       3 7.7E-05   20.3   6.6   97  652-772    36-139 (219)
427 PRK07261 topology modulation p  83.4     1.1 2.8E-05   23.6   2.8   63  653-737     3-65  (171)
428 COG4175 ProV ABC-type proline/  83.2     1.3 3.3E-05   23.0   3.2   56  301-356    55-113 (386)
429 KOG1969 consensus               83.1     3.1 7.9E-05   20.2   9.1   42  768-809   711-756 (877)
430 pfam00448 SRP54 SRP54-type pro  83.1     3.1 7.9E-05   20.2   6.5  163  651-841     2-184 (196)
431 TIGR01832 kduD 2-deoxy-D-gluco  83.1     1.3 3.3E-05   23.0   3.1   13  340-352    87-99  (249)
432 COG1132 MdlB ABC-type multidru  83.0     1.5 3.8E-05   22.6   3.4  122  635-772   344-523 (567)
433 PRK06731 flhF flagellar biosyn  82.9     3.2 8.1E-05   20.1  10.4  171  649-840    74-255 (270)
434 TIGR00634 recN DNA repair prot  82.8     3.2 8.1E-05   20.1  10.6  119  710-837   471-604 (605)
435 KOG0734 consensus               82.7     3.2 8.2E-05   20.1   8.9   43  653-702   340-382 (752)
436 COG4167 SapF ABC-type antimicr  82.3     1.9   5E-05   21.7   3.8   24  307-330    48-71  (267)
437 pfam08497 Radical_SAM_N Radica  82.0       2 5.2E-05   21.6   3.8   41   64-112    15-56  (298)
438 COG3172 NadR Predicted ATPase/  81.8     1.3 3.3E-05   23.0   2.8   23  651-673     9-31  (187)
439 PRK06217 hypothetical protein;  81.7     1.4 3.5E-05   22.8   2.8   21  653-673     4-24  (185)
440 COG1137 YhbG ABC-type (unclass  81.6     1.1 2.8E-05   23.5   2.3   33  631-667    15-47  (243)
441 PRK00955 hypothetical protein;  81.3     2.2 5.6E-05   21.3   3.8   42   64-112    12-53  (599)
442 TIGR00956 3a01205 Pleiotropic   81.3     1.4 3.5E-05   22.8   2.7  108  654-780   857-1034(1466)
443 pfam03205 MobB Molybdopterin g  81.2     1.6 4.1E-05   22.3   3.0   30  652-683     2-31  (122)
444 COG4938 Uncharacterized conser  81.1     2.4   6E-05   21.1   3.9   47  727-775   258-304 (374)
445 CHL00181 cbbX CbbX; Provisiona  81.0     3.7 9.4E-05   19.6  10.3  115  653-785    62-183 (287)
446 PRK05917 DNA polymerase III su  80.8     3.7 9.5E-05   19.6   5.9  105  650-773    19-135 (290)
447 PRK08451 DNA polymerase III su  80.8     3.7 9.5E-05   19.6   6.1   12   49-60     11-22  (523)
448 COG4639 Predicted kinase [Gene  80.7     2.3   6E-05   21.1   3.7   77  745-840    52-138 (168)
449 COG3911 Predicted ATPase [Gene  80.7     2.1 5.5E-05   21.4   3.5   91  650-758     9-101 (183)
450 PRK09841 cryptic autophosphory  80.6     3.1 7.9E-05   20.2   4.3   35  648-684   529-564 (726)
451 TIGR01187 potA polyamine ABC t  80.2       1 2.7E-05   23.7   1.8   16  340-355    73-88  (331)
452 PRK13853 type IV secretion sys  80.1     1.1 2.8E-05   23.6   1.9   41  649-695   426-466 (789)
453 cd03274 ABC_SMC4_euk Eukaryoti  80.0     1.5 3.9E-05   22.5   2.6   58  724-785   144-202 (212)
454 PRK10416 cell division protein  79.9       4  0.0001   19.4   7.1   23  649-671   294-316 (499)
455 CHL00176 ftsH cell division pr  79.8       4  0.0001   19.4   6.1   16  612-627   435-450 (631)
456 TIGR02788 VirB11 P-type DNA tr  79.7     1.7 4.3E-05   22.1   2.8   32  652-692   160-191 (328)
457 TIGR00958 3a01208 antigen pept  79.3     4.1 0.00011   19.3   7.4   75  650-733   559-653 (770)
458 cd00227 CPT Chloramphenicol (C  78.9     2.2 5.7E-05   21.2   3.2   23  649-671     1-23  (175)
459 PRK11331 5-methylcytosine-spec  78.8     2.5 6.3E-05   20.9   3.4   84  651-744   195-287 (459)
460 pfam06414 Zeta_toxin Zeta toxi  78.7     2.6 6.6E-05   20.8   3.5   24  648-671    10-33  (191)
461 TIGR00630 uvra excinuclease AB  78.7     2.7 6.8E-05   20.7   3.5   47  611-675   644-690 (956)
462 PRK07078 hypothetical protein;  78.6     4.3 0.00011   19.1   7.2   80  648-759   240-319 (510)
463 pfam02492 cobW CobW/HypB/UreG,  78.3       2 5.2E-05   21.6   2.8   20  652-671     2-21  (174)
464 cd02019 NK Nucleoside/nucleoti  78.0     1.7 4.2E-05   22.2   2.3   22  653-674     2-23  (69)
465 PRK07132 DNA polymerase III su  78.0     4.5 0.00011   19.0   7.0  110  649-773    19-132 (303)
466 cd01124 KaiC KaiC is a circadi  78.0     4.5 0.00011   19.0  10.0  119  653-775     2-142 (187)
467 TIGR03574 selen_PSTK L-seryl-t  77.7     4.6 0.00012   18.9   6.4   29  653-683     2-30  (249)
468 COG4650 RtcR Sigma54-dependent  77.7     3.8 9.8E-05   19.5   4.1   72  652-740   210-293 (531)
469 cd03114 ArgK-like The function  77.6     4.6 0.00012   18.9   7.9   87  654-746     3-108 (148)
470 PRK08727 hypothetical protein;  77.6     4.6 0.00012   18.9   9.8   94  649-772    40-135 (233)
471 COG4598 HisP ABC-type histidin  77.6     2.3 5.9E-05   21.2   2.9   26  648-673    30-55  (256)
472 COG4088 Predicted nucleotide k  77.4     2.1 5.3E-05   21.5   2.6   85  651-749     2-89  (261)
473 TIGR01193 bacteriocin_ABC ABC-  77.4     2.2 5.5E-05   21.4   2.7  141  592-778   476-676 (710)
474 cd00071 GMPK Guanosine monopho  77.0     2.1 5.3E-05   21.5   2.6  107  652-784     1-111 (137)
475 KOG2373 consensus               77.0     1.9 4.8E-05   21.8   2.3  138  616-771   257-423 (514)
476 cd02021 GntK Gluconate kinase   76.8     2.1 5.3E-05   21.5   2.5   20  652-671     1-20  (150)
477 TIGR02755 TraX_Ftype type-F co  76.7    0.67 1.7E-05   25.2  -0.0   56  652-720    47-107 (232)
478 PRK01254 hypothetical protein;  76.6     3.8 9.6E-05   19.5   3.8   41   64-112    37-78  (742)
479 PRK08084 DNA replication initi  76.5     4.9 0.00012   18.7  10.4   95  649-773    44-141 (235)
480 TIGR03029 EpsG chain length de  76.4     4.9 0.00013   18.7   4.5   88  649-746   102-192 (274)
481 TIGR02633 xylG D-xylose ABC tr  76.3     3.1   8E-05   20.1   3.3   79  720-799   411-491 (501)
482 PRK05416 hypothetical protein;  76.3     2.8 7.1E-05   20.5   3.1   11  612-622   253-263 (292)
483 PRK13830 conjugal transfer pro  76.1     2.2 5.6E-05   21.3   2.5   29  653-686   459-487 (818)
484 PRK04690 murD UDP-N-acetylmura  76.0     4.5 0.00012   19.0   4.1   17  815-831   445-461 (468)
485 pfam07724 AAA_2 AAA domain (Cd  75.9     4.7 0.00012   18.8   4.1   23  652-674     5-27  (168)
486 KOG0962 consensus               75.8     2.5 6.3E-05   20.9   2.7   18  126-143    18-35  (1294)
487 PRK04301 radA DNA repair and r  75.7     5.1 0.00013   18.5   8.5  116  649-771   102-252 (318)
488 COG4608 AppF ABC-type oligopep  75.6     5.2 0.00013   18.5  11.3  120  635-777    28-174 (268)
489 TIGR01087 murD UDP-N-acetylmur  75.6     3.3 8.3E-05   20.0   3.3   21   95-115    17-37  (476)
490 COG0771 MurD UDP-N-acetylmuram  75.6     3.7 9.4E-05   19.6   3.5   20   95-114    23-42  (448)
491 TIGR02857 CydD ABC transporter  75.3     3.5 8.9E-05   19.8   3.3   61  591-671   337-399 (570)
492 PRK00081 coaE dephospho-CoA ki  75.3     3.7 9.4E-05   19.6   3.5   26  652-683     4-29  (199)
493 PRK13900 type IV secretion sys  75.3     2.8 7.1E-05   20.5   2.8   19  653-671   163-181 (332)
494 cd01121 Sms Sms (bacterial rad  75.2     5.3 0.00013   18.5   7.1  156  650-815    82-250 (372)
495 KOG0082 consensus               75.0       3 7.5E-05   20.3   2.9   21  653-673    36-56  (354)
496 PRK11823 DNA repair protein Ra  74.9     1.6   4E-05   22.4   1.5   80  650-736    90-172 (454)
497 PRK03806 murD UDP-N-acetylmura  74.6     5.4 0.00014   18.4   4.2   54  618-680    78-131 (438)
498 PRK13851 type IV secretion sys  74.6       3 7.6E-05   20.3   2.8   19  653-671   165-183 (343)
499 pfam09439 SRPRB Signal recogni  74.4     3.6 9.3E-05   19.7   3.2   24  648-671     1-24  (181)
500 TIGR00017 cmk cytidylate kinas  74.3     2.2 5.6E-05   21.3   2.1   17  655-671     7-23  (223)

No 1  
>TIGR01070 mutS1 DNA mismatch repair protein MutS; InterPro: IPR005748   Mismatch repair contributes to the overall fidelity of DNA replication and is essential for combating the adverse effects of damage to the genome. It involves the correction of mismatched base pairs that have been missed by the proofreading element of the DNA polymerase complex. The post-replicative Mismatch Repair System (MMRS) of Escherichia coli involves MutS (Mutator S), MutL and MutH proteins, and acts to correct point mutations or small insertion/deletion loops produced during DNA replication . MutS and MutL are involved in preventing recombination between partially homologous DNA sequences. The assembly of MMRS is initiated by MutS, which recognises and binds to mispaired nucleotides and allows further action of MutL and MutH to eliminate a portion of newly synthesized DNA strand containing the mispaired base . MutS can also collaborate with methyltransferases in the repair of O(6)-methylguanine damage, which would otherwise pair with thymine during replication to create an O(6)mG:T mismatch . MutS exists as a dimer, where the two monomers have different conformations and form a heterodimer at the structural level . Only one monomer recognises the mismatch specifically and has ADP bound. Non-specific major groove DNA-binding domains from both monomers embrace the DNA in a clamp-like structure. Mismatch binding induces ATP uptake and a conformational change in the MutS protein, resulting in a clamp that translocates on DNA.    MutS is a modular protein with a complex structure , and is composed of:    N-terminal mismatch-recognition domain, which is similar in structure to tRNA endonuclease. Connector domain, which is similar in structure to Holliday junction resolvase ruvC. Core domain, which is composed of two separate subdomains that join together to form a helical bundle; from within the core domain, two helices act as levers that extend towards (but do not touch) the DNA. Clamp domain, which is inserted between the two subdomains of the core domain at the top of the lever helices; the clamp domain has a beta-sheet structure. ATPase domain (connected to the core domain), which has a classical Walker A motif. HTH (helix-turn-helix) domain, which is involved in dimer contacts.    Homologues of MutS have been found in many species including eukaryotes (MSH 1, 2, 3, 4, 5, and 6 proteins), archaea and bacteria, and together these proteins have been grouped into the MutS family. Although many of these proteins have similar activities to the E. coli MutS, there is significant diversity of function among the MutS family members. This diversity is even seen within species, where many species encode multiple MutS homologues with distinct functions . Inter-species homologues may have arisen through frequent ancient horizontal gene transfer of MutS (and MutL) from bacteria to archaea and eukaryotes via endosymbiotic ancestors of mitochondria and chloroplasts .    This entry represents a family of MutS proteins.; GO: 0005524 ATP binding, 0030983 mismatched DNA binding, 0006298 mismatch repair.
Probab=100.00  E-value=0  Score=2046.16  Aligned_cols=850  Identities=37%  Similarity=0.642  Sum_probs=794.4

Q ss_pred             CCHHHHHHHHHHHHCCCCEEEEEECCCHHHHHHHHHHHHHHHCCEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCE
Q ss_conf             89168999999987799299998088222007999999986181891078899888762656176699999999988985
Q gi|254780750|r   25 STPMMRQYIEIKSINPDSLVFYRMGDFYELFFDDALLASRCLGITLTKRGKHLGKDIPMCGVPVHTANHYIQKLIKIGHR  104 (920)
Q Consensus        25 ~TP~~~Qy~~iK~~~~D~il~fr~G~FYE~f~~DA~~aa~~L~i~lt~r~~~~~~~~pmaGvP~~~l~~yl~~Lv~~Gyk  104 (920)
                      +||||||||+||++|||.+||||||||||||||||..||++|+|+||+||++.|+++||||||+|+++.|+.+||+.|||
T Consensus         1 ~tPmmQQY~~lK~~~PD~lLffRmGDFYElFyeDAk~Aa~~L~I~LT~R~~sA~~~IPMAGiPyHs~~~Y~~~L~~~G~~   80 (863)
T TIGR01070         1 LTPMMQQYLKLKAEHPDALLFFRMGDFYELFYEDAKKAAQLLDISLTSRGQSADEPIPMAGIPYHSVEAYLEKLVKQGYK   80 (863)
T ss_pred             CCCCHHHHHHHHHHCCCHHHHHHCCCEEECCHHHHHHHHHHHCCHHCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCE
T ss_conf             98702578999864751577641363001107899999985032002457888888884787588899999999863986


Q ss_pred             EEEEEECCCHHHHHHCCCCCCEEEEEEEEECCCCEECCHHCCCCCCCEEEEEEECCCEEEEEEEECCCCEEEEEECC-HH
Q ss_conf             99995028978874128998455458999775303020103878773699999529849999999786559996058-78
Q gi|254780750|r  105 IAICEQIESPLEAKKRGNKSLVRRNVVRLVTPGTLTEDQLLSPTDSNYLMAVARIRTEWAIAWIDISTGIFKISTSN-HD  183 (920)
Q Consensus       105 VaiveQ~E~p~~~~~~~~~~~v~R~Vt~IiTpGT~~d~~~l~~~~~nyL~aI~~~~~~~Gia~iDisTG~~~~~~~~-~d  183 (920)
                      ||||||+|+|+.+     +|+|+|+|||||||||+.|+.++.+.++|||+||+.++..||+|++|+|||+|.++... .+
T Consensus        81 VAIcEQ~eDP~~a-----kG~V~ReVVq~iTPGTv~Deall~er~~N~lAai~~~~~~fGLA~lD~~tG~F~~~~~~~~e  155 (863)
T TIGR01070        81 VAICEQIEDPKTA-----KGVVKREVVQIITPGTVSDEALLPERQDNLLAAIAQESNGFGLATLDLTTGEFKVTELADKE  155 (863)
T ss_pred             EEEECCCCCHHHC-----CCCEEEEEEEEECCCEECCCCCCHHHHHHHHEEEEECCCCCCEEEEEEEECCEEEECCCCHH
T ss_conf             8985368886465-----78625689898528711135664033411212100068852147852243510022000178


Q ss_pred             HHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHCCCCEECCCCCCCCHHHHHHHHHHHCCCCCCCCHHHHH-HHHHHHHHH
Q ss_conf             9999985229857997077689678998874238815718521147134478899870878642102444-346888777
Q gi|254780750|r  184 RLISDIMRIDPREIIFSEKELSHAEYKSLFETLGNVAVAQPNVFFDHSISESRIADYYNITTVDTFGSFS-QVEKTAAAA  262 (920)
Q Consensus       184 ~l~~~L~~l~P~EIii~~~~~~~~~~~~l~~~~~~~~~~~~~~~f~~~~~~~~l~~~~~~~~l~~~~~~~-~~~~~a~~a  262 (920)
                      .+.++|.+++|+|||+++...+....   ..  ..-...+|-|.|+...+...++..|...++..|+... ...++|.|+
T Consensus       156 ~l~~El~r~~p~E~l~~~~l~e~~~~---~~--rrG~~RR~~Wef~~~~a~~~~e~~f~~~dl~~~~~~~~~~~~~A~g~  230 (863)
T TIGR01070       156 TLLAELQRLNPAEVLLAEDLSEEEAI---EL--RRGLRRRPLWEFRLDTAVLSLEKQFETEDLKGLGLRNAPLGLKAAGC  230 (863)
T ss_pred             HHHHHHHCCCCEEEEECCCCCHHHHH---HH--CCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCHHHHHHHH
T ss_conf             99999860797388616572012799---96--37875788542331136887625766346410000234036678889


Q ss_pred             HHHHHHHHHCCCCCCCCCCCCCCCCCEEEECCHHHCCEEEEECCCCCCCCHHHHHHCCCCCCHHHHHHHHHHHHHCCCHH
Q ss_conf             76436874112222221134457454014251332015454127877641278763012343378999986310023456
Q gi|254780750|r  263 AISYIKKTQMVNKPTIGYPEREDIQSTLFIDSAARSNLEILRTLSGSREQSLLKTIDYSITGAGGRLFAERIASPLTDST  342 (920)
Q Consensus       263 ll~Yl~~~~~~~~~~i~~~~~~~~~~~m~LD~~Tl~nLEI~~~~~g~~~gSL~~~Ln~t~T~~G~RlLr~wL~~PL~d~~  342 (920)
                      |+.|++.||...++|++++..++.+++|.||..|.+||||++|++|++++||+|+||+|+||||+|||++||-+||.|.+
T Consensus       231 LL~Ya~~TQ~~~L~Hl~p~~~~~~~d~~~ld~At~rnLEl~~nlrgG~~~tL~svLD~t~TAMG~RLL~~Wl~~PL~d~~  310 (863)
T TIGR01070       231 LLQYAKRTQRTALPHLRPVRLYELQDFVQLDAATRRNLELTENLRGGKQNTLFSVLDETKTAMGSRLLKRWLHRPLRDRE  310 (863)
T ss_pred             HHHHHHHHHCCCCCCCCCEEEECHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCHH
T ss_conf             99999986102443036302455487773578876531000344678877630000446799861589986116632137


Q ss_pred             HHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHH
Q ss_conf             78989999997402212588999997520483444456775210000212068999998655675430258457787676
Q gi|254780750|r  343 KINTRLDSINFFIQNPILINPIQKILKSSPDVPRSLSRLKIGRGEPKDIAVIRDGIRSGINILNLFLKNDLPEELRGAVE  422 (920)
Q Consensus       343 ~I~~R~daVe~l~~~~~~~~~l~~~L~~i~DleRll~ri~~~~~~p~dl~~L~~sl~~~~~i~~~l~~~~~~~~l~~~~~  422 (920)
                      .|++|||.|+.|+++...++.++..|+.++||||+++|+.+++++||||..|+++|..+|.+...+.... .+.+..+..
T Consensus       311 ~l~~Rq~~V~~l~~~f~~~~~L~~~L~~v~DlERla~Rv~l~~a~PrDL~~Lr~~L~~lP~lra~l~~~~-~~~l~~l~~  389 (863)
T TIGR01070       311 VLEARQDTVETLLRHFFLREDLRPLLKEVGDLERLAARVALGNARPRDLARLRTALEQLPELRALLEELE-QPKLQALAK  389 (863)
T ss_pred             HHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHCC-CHHHHHHHH
T ss_conf             7999999999998521012115898888877999999987327898899999999998699999862115-568999998


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHCCCCEECCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCEEE
Q ss_conf             57767899999999985431012210460101685411455799886389999977687788738875110255862237
Q gi|254780750|r  423 KLKKLPQSLEKTLSSMLSDDLPTFKRDGGFLRDGADASLDETRSLRDQSKRIIASLQLKYAEETKIKNLKIKHNNNLGYF  502 (920)
Q Consensus       423 ~l~~l~~~l~~~l~~~i~~~~~~~~~~~~~ik~g~d~eLD~lr~~~~~~~~~l~~l~~~~~~~~~i~sLki~~n~~~gy~  502 (920)
                      .+..+++ +.++|..+|.++||..++|||+||+|||++||++|.+.+++.+||.+|+.++|++|||++|||+||+++|||
T Consensus       390 ~~~~~~e-l~eLL~~Al~e~PP~~v~dGG~I~~GYd~~LDe~R~~~~~g~~yl~~LE~rErE~TGi~tLKvGyN~v~GYY  468 (863)
T TIGR01070       390 QLDDLSE-LLELLERALIENPPLVVRDGGVIREGYDEELDEYRALSREGTDYLAELEARERERTGIPTLKVGYNAVFGYY  468 (863)
T ss_pred             HHHCCCC-HHHHHHHHCCCCCCCEEECCCEECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCEEEEE
T ss_conf             5001674-699999704688692650486123578863799999987578999999988776358864551454211026


Q ss_pred             EEECCHHHHHCCCCCCCCCCEEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHH
Q ss_conf             62041143334411168765279852120001113456664334643777776433447888765430112579888899
Q gi|254780750|r  503 IEVTSSSASVLKKDLESKDRFIHRQTMSNLTRFTTLELIDLENRITNATNSALLIELESFEILSNAIIEQSESLDNASQV  582 (920)
Q Consensus       503 iEV~~~~~~~i~~~~~~~~~~i~~qt~~~~~Rf~t~eL~~l~~~i~~~~~~~~~~e~~~~~~l~~~i~~~~~~l~~~~~~  582 (920)
                      ||||+++.+.+|.     .+|+|+||+||++||++|||++.+.++..++.++..+|+++|.+|++.+..+.+.|+..+..
T Consensus       469 i~vt~~q~~~~Pe-----~~Y~R~qTLKnaERyi~PELKe~E~~~L~a~~~~~~lE~elf~elre~~~~~~~~Lq~~A~~  543 (863)
T TIGR01070       469 IEVTRGQLHKVPE-----AHYIRRQTLKNAERYITPELKEKEDKVLEAKGKALALEKELFEELRELLKKYLEALQEAAKA  543 (863)
T ss_pred             EECCCHHHCCCCC-----CCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             5226133304875-----56446667788755675789999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHCCCCCEECCCCCCEEECCCCCHHHHHHHHHCCCCCEEEEEEEECCCCCCCCCEEEEEECCCCCC
Q ss_conf             98677887788877525885121047871400004680588763102877044434563587777664399996778440
Q gi|254780750|r  583 IAIIDISIALAILAKEQNYCRPIIDNSTNFIVKDGRHPIVEKTLKQQSSKPFIANDCDLSCPNDKNSGKLWLLTGPNMGG  662 (920)
Q Consensus       583 ia~lD~l~SlA~~a~~~~y~rP~i~~~~~l~i~~gRHPviE~~l~~~~~~~fVpNdi~l~~~~~~~~~~~~iiTGpNmgG  662 (920)
                      +|+||||.|||.+|...+|+||+|.|++.+.|++|||||||+.|.   ..+||||||.|+     ++.+++|||||||||
T Consensus       544 laELDVL~~LAe~A~~~~y~~P~F~d~~~~~I~~GRHPVVE~Vl~---~~~fvpN~~~m~-----~nr~~lliTGPNM~G  615 (863)
T TIGR01070       544 LAELDVLANLAEVAETLHYTRPRFGDDPELRIREGRHPVVEKVLD---RQPFVPNDLEMA-----DNRRLLLITGPNMGG  615 (863)
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCCCCCCCCEEEECCCCCEEEEECC---CCCCCCCCCCCC-----CCCEEEEEECCCCCC
T ss_conf             889999999999997448968701367614675088770434465---778677756558-----885688886687975


Q ss_pred             HHHHHHHHHHHHHHHHCCCCCCHHHCCCCCCCEEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEECCCCCC
Q ss_conf             78999999999999971985303532068221056765237661138532899999999999958998569993258898
Q gi|254780750|r  663 KSTFLRQNALIVIMAQMGSYVPASYAHIGIVDKLFSRVGSADNLASGRSTFMVEMIETASILNQATNQSFVILDEIGRGT  742 (920)
Q Consensus       663 KSt~lRqval~vilAQiG~fVPA~~a~i~~~D~IftRiGa~D~l~~g~STF~vEm~e~~~IL~~at~~SLVllDElGrGT  742 (920)
                      |||||||+|||+|||||||||||++|+|||||+|||||||+|||..|+|||||||.|+++||++||+|||||+|||||||
T Consensus       616 KSTYmRQtALIallAqiGSfVPA~~a~Lp~~D~IFTRIGAsDDLasG~STFMVEM~E~aNil~~AT~~SLvL~DE~GRGT  695 (863)
T TIGR01070       616 KSTYMRQTALIALLAQIGSFVPAESAELPLFDRIFTRIGASDDLASGRSTFMVEMTEAANILHNATENSLVLLDEIGRGT  695 (863)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCC
T ss_conf             31799999999999982785350423028846320111513324799643006789999999986651022331034530


Q ss_pred             CHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHCCCEEEEEEEEEEECCEEEEEEEEEECCCCCCHHHHHHHHC
Q ss_conf             80567999999999999726984999748757976643068858999999960992778777744789887789999982
Q gi|254780750|r  743 ATLDGLSIAWATIEYLHETNRCRGLLATHFHELTDLSKSLKRFHNATLQVSDSNEGIIFLHKVIPGIADHSYGIQVGKLA  822 (920)
Q Consensus       743 st~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~~l~~~~~~v~n~~~~~~~~~~~i~flykl~~G~~~~Sygi~vA~la  822 (920)
                      |||||+|||||+.||||++++|+|||||||||||.|++.+|++.|.|+...|.+++|+|+|++.||++++||||+||+||
T Consensus       696 STyDGlaLA~A~aE~lh~~irA~TLFATHYfELT~L~~~L~~l~NvHv~A~E~~g~~vFlH~v~~GpAsKSYG~~VA~lA  775 (863)
T TIGR01070       696 STYDGLALAWAIAEYLHEHIRAKTLFATHYFELTALEEKLPRLANVHVAALEHNGTIVFLHQVLPGPASKSYGLAVAALA  775 (863)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHCCCEEEEEEEEEECCCCEEEEEEECCCCCCCCHHHHHHHHC
T ss_conf             01678999999999986232121200145567513753486415435433661881589863157988643369999871


Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH-----------HHHCCCHHHHHCCCCCHHHHHHHHHCCCCCCCCHHHHH
Q ss_conf             9998999999999999987630001111211-----------11100001120035473899999860782227989999
Q gi|254780750|r  823 GLPNTVISRAYDILKTFEKLYHHNQKDMRLY-----------YPEIQTKESKNNLSKNDKLFVEKIKCLNLDEMSPLTAL  891 (920)
Q Consensus       823 G~p~~vi~~A~~~~~~le~~~~~~~~~~~~~-----------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~al  891 (920)
                      |+|.+||.||+++|++||+............           ....+.......+.+.++++++..++||||+|||+|||
T Consensus       776 GlP~~vi~RA~~~L~~LE~~s~~~~~p~~~~~~~~~~~q~~lf~~~e~~~~~e~L~~kekqvidafksLdpd~ltP~qAl  855 (863)
T TIGR01070       776 GLPKDVIARARQILTELEARSTESEAPLRKAQKKAEPEQLSLFDEAETHPLLEELAKKEKQVIDAFKSLDPDDLTPLQAL  855 (863)
T ss_pred             CCCHHHHHHHHHHHHHHHHCCCCCCCHHHCCCCCCCHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHH
T ss_conf             89888999999999999852888741333465412104667634303627899998621368877652787787979999


Q ss_pred             HHHHHHHH
Q ss_conf             99999999
Q gi|254780750|r  892 KTLYAVKA  899 (920)
Q Consensus       892 ~~l~~lk~  899 (920)
                      +.|++||+
T Consensus       856 ~~Ly~LK~  863 (863)
T TIGR01070       856 NLLYELKK  863 (863)
T ss_pred             HHHHHHCC
T ss_conf             99997239


No 2  
>PRK05399 DNA mismatch repair protein; Provisional
Probab=100.00  E-value=0  Score=1947.74  Aligned_cols=842  Identities=44%  Similarity=0.730  Sum_probs=777.3

Q ss_pred             HHHHCCHHHHHHHHHHHHCCCCEEEEEECCCHHHHHHHHHHHHHHHCCEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             67728916899999998779929999808822200799999998618189107889988876265617669999999998
Q gi|254780750|r   21 NLKSSTPMMRQYIEIKSINPDSLVFYRMGDFYELFFDDALLASRCLGITLTKRGKHLGKDIPMCGVPVHTANHYIQKLIK  100 (920)
Q Consensus        21 ~~~~~TP~~~Qy~~iK~~~~D~il~fr~G~FYE~f~~DA~~aa~~L~i~lt~r~~~~~~~~pmaGvP~~~l~~yl~~Lv~  100 (920)
                      +++|+||||+|||+||++|||||||||||||||+||+||++||++|||+||+|+++.++++||||||+|+++.|++|||+
T Consensus         4 ~~~k~TPmm~Qy~~iK~~~~D~iLffr~GdFYElF~eDA~~as~~L~i~LT~R~~~~~~~~pm~GvP~ha~~~yl~kLv~   83 (848)
T PRK05399          4 DLSKHTPMMQQYLEIKAQYPDALLFYRMGDFYELFFEDAKKASRLLDITLTKRGKSAGEPIPMAGVPYHAAEGYLAKLVK   83 (848)
T ss_pred             CCCCCCHHHHHHHHHHHHCCCEEEEEECCCEEEECHHHHHHHHHHHCEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHH
T ss_conf             42228989999999999789979999627310353888999998619699547888999888088978899999999998


Q ss_pred             CCCEEEEEEECCCHHHHHHCCCCCCEEEEEEEEECCCCEECCHHCCCCCCCEEEEEEECCCEEEEEEEECCCCEEEEEEC
Q ss_conf             89859999502897887412899845545899977530302010387877369999952984999999978655999605
Q gi|254780750|r  101 IGHRIAICEQIESPLEAKKRGNKSLVRRNVVRLVTPGTLTEDQLLSPTDSNYLMAVARIRTEWAIAWIDISTGIFKISTS  180 (920)
Q Consensus       101 ~GykVaiveQ~E~p~~~~~~~~~~~v~R~Vt~IiTpGT~~d~~~l~~~~~nyL~aI~~~~~~~Gia~iDisTG~~~~~~~  180 (920)
                      +|||||||||+|+|+.+     ||+|+|+|||||||||++|++++++.++|||+||+..+..||+||+|+|||+|.+.++
T Consensus        84 ~G~kVaiceQ~e~p~~~-----kg~v~R~V~rIiTPGT~~d~~~L~~~~~nyL~ai~~~~~~~gla~~DiSTGef~~~~~  158 (848)
T PRK05399         84 KGYKVAICEQVEDPATA-----KGPVKREVVRIVTPGTVTDEALLDEKQNNYLAAIYQDKNRYGLAWLDLSTGEFRVTEL  158 (848)
T ss_pred             CCCEEEEEECCCCCCCC-----CCCCCCCEEEEECCCCEECCCCCCCCCCCEEEEEEECCCEEEEEEEECCCCEEEEEEE
T ss_conf             79969999616782104-----9983203489987861347243688877679999967985999999966663999983


Q ss_pred             C-HHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHCCCCEECCCCCCCCHHHHHHHHHHHCCCCCCCCHHHH-HHHHHH
Q ss_conf             8-78999998522985799707768967899887423881571852114713447889987087864210244-434688
Q gi|254780750|r  181 N-HDRLISDIMRIDPREIIFSEKELSHAEYKSLFETLGNVAVAQPNVFFDHSISESRIADYYNITTVDTFGSF-SQVEKT  258 (920)
Q Consensus       181 ~-~d~l~~~L~~l~P~EIii~~~~~~~~~~~~l~~~~~~~~~~~~~~~f~~~~~~~~l~~~~~~~~l~~~~~~-~~~~~~  258 (920)
                      . .+++.++|.+++|+|||+++...+...       ........+.|.|+...+.+.+.++|++.++++++.. ...+++
T Consensus       159 ~~~~~L~~~L~r~~P~EIl~~~~~~~~~~-------~~~~~~~~~~~~f~~~~a~~~l~~~f~~~~l~~~g~~~~~~~~~  231 (848)
T PRK05399        159 ADEEELLAELARLNPAEILLPEDLAELLL-------ILFGVTRRPDWEFDLDTAEKRLLEQFGVASLDGFGLEDLELALR  231 (848)
T ss_pred             CCHHHHHHHHHHCCCCEEEECCCHHHHHH-------HHCCEEECCCCCCCHHHHHHHHHHHHCCCCHHHCCCCCCHHHHH
T ss_conf             89999999998449734874574024566-------42025547720058678999999984858813217667569999


Q ss_pred             HHHHHHHHHHHHHCCCCCCCCCCCCCCCCCEEEECCHHHCCEEEEECCCCCCCCHHHHHHCCCCCCHHHHHHHHHHHHHC
Q ss_conf             87777643687411222222113445745401425133201545412787764127876301234337899998631002
Q gi|254780750|r  259 AAAAAISYIKKTQMVNKPTIGYPEREDIQSTLFIDSAARSNLEILRTLSGSREQSLLKTIDYSITGAGGRLFAERIASPL  338 (920)
Q Consensus       259 a~~all~Yl~~~~~~~~~~i~~~~~~~~~~~m~LD~~Tl~nLEI~~~~~g~~~gSL~~~Ln~t~T~~G~RlLr~wL~~PL  338 (920)
                      |+|+++.|+.++|...++|+..+..++.+++|.||.+|++||||++|.+|+ +|||||+||+|+|+||+||||+||++||
T Consensus       232 A~g~LL~YL~~tq~~~l~~i~~~~~~~~~~~M~LD~~T~rNLEL~~~~~g~-kgSLl~vLd~T~T~mG~RLLr~WL~~PL  310 (848)
T PRK05399        232 AAGALLQYLKETQKGSLPHLRSPKRYEEGDYLILDAATRRNLELTETLRGG-GGSLLSVLDRTVTAMGGRLLRRWLHRPL  310 (848)
T ss_pred             HHHHHHHHHHHHCCCCCCCCCCCEEECCCCEEEECHHHHHHHHHHCCCCCC-CCCHHHHHCCCCCHHHHHHHHHHHHHHC
T ss_conf             999999999986112334557775876789799887887468874167999-9857888477898589999999987356


Q ss_pred             CCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHH
Q ss_conf             34567898999999740221258899999752048344445677521000021206899999865567543025845778
Q gi|254780750|r  339 TDSTKINTRLDSINFFIQNPILINPIQKILKSSPDVPRSLSRLKIGRGEPKDIAVIRDGIRSGINILNLFLKNDLPEELR  418 (920)
Q Consensus       339 ~d~~~I~~R~daVe~l~~~~~~~~~l~~~L~~i~DleRll~ri~~~~~~p~dl~~L~~sl~~~~~i~~~l~~~~~~~~l~  418 (920)
                      +|+++|++|||+|++|.++..+++.++..|++++|+||+++|++.|+++|+|+..+++++..++.+...+...   ..+.
T Consensus       311 ~d~~~I~~RldaVe~l~~~~~~~~~lr~~Lk~i~DlERllsRi~~~~~~prDl~~L~~sL~~~~~i~~~l~~~---~~l~  387 (848)
T PRK05399        311 RDREAINARLDAVEELLDNPLLREDLRELLKGVYDLERILSRVALGRANPRDLAALRDSLEALPELKELLEES---PLLA  387 (848)
T ss_pred             CCHHHHHHHHHHHHHHHHCHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHCC---HHHH
T ss_conf             2778999999999999749799999999985489889999999808978899999999999999999998467---7899


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEECCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCC
Q ss_conf             76765776789999999998543101221046010168541145579988638999997768778873887511025586
Q gi|254780750|r  419 GAVEKLKKLPQSLEKTLSSMLSDDLPTFKRDGGFLRDGADASLDETRSLRDQSKRIIASLQLKYAEETKIKNLKIKHNNN  498 (920)
Q Consensus       419 ~~~~~l~~l~~~l~~~l~~~i~~~~~~~~~~~~~ik~g~d~eLD~lr~~~~~~~~~l~~l~~~~~~~~~i~sLki~~n~~  498 (920)
                      .+...+..+ ..+.+.|..++.+++|...++|++|++|||++||++|.+.++.++|+.+++.++++++||++||++||++
T Consensus       388 ~l~~~l~~~-~~l~~~i~~~i~~~~p~~~~dg~~Ik~G~d~eLDelr~~~~~~~~~l~~le~~er~~tgI~sLKi~yn~v  466 (848)
T PRK05399        388 ELLAQLDPL-PELADLLERAIVEEPPLLIRDGGVIADGYDAELDELRALSDNGKDWLAELEARERERTGISSLKVGYNKV  466 (848)
T ss_pred             HHHHHCCCH-HHHHHHHHHHHHCCCHHHCCCCCEECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHCCC
T ss_conf             998853148-9999999998710557554368863588798899999999868999999999999870865110111475


Q ss_pred             CEEEEEECCHHHHHCCCCCCCCCCEEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHH
Q ss_conf             22376204114333441116876527985212000111345666433464377777643344788876543011257988
Q gi|254780750|r  499 LGYFIEVTSSSASVLKKDLESKDRFIHRQTMSNLTRFTTLELIDLENRITNATNSALLIELESFEILSNAIIEQSESLDN  578 (920)
Q Consensus       499 ~gy~iEV~~~~~~~i~~~~~~~~~~i~~qt~~~~~Rf~t~eL~~l~~~i~~~~~~~~~~e~~~~~~l~~~i~~~~~~l~~  578 (920)
                      +|||||||+++.+.+|      +.|+++||++|++||+||||++++.++.++++++..+|.++|.++++.+.++.+.|+.
T Consensus       467 ~GY~iEv~k~~~~~vp------~~~ir~qTl~n~~Rf~T~eL~~~e~~il~a~~~~~~lE~~~f~~l~~~~~~~~~~l~~  540 (848)
T PRK05399        467 FGYYIEVTKANADKVP------DDYIRRQTLKNAERYITPELKELEDKILSAEERALALEKELFEELREEVLEHIERLQK  540 (848)
T ss_pred             CEEEEEECHHHHHCCC------CCEEEEEECCCCEEECCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             2289984043340498------4438876124871544588999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCCEECCCCCCEEECCCCCHHHHHHHHHCCCCCEEEEEEEECCCCCCCCCEEEEEECC
Q ss_conf             88999867788778887752588512104787140000468058876310287704443456358777766439999677
Q gi|254780750|r  579 ASQVIAIIDISIALAILAKEQNYCRPIIDNSTNFIVKDGRHPIVEKTLKQQSSKPFIANDCDLSCPNDKNSGKLWLLTGP  658 (920)
Q Consensus       579 ~~~~ia~lD~l~SlA~~a~~~~y~rP~i~~~~~l~i~~gRHPviE~~l~~~~~~~fVpNdi~l~~~~~~~~~~~~iiTGp  658 (920)
                      +++++|+|||++|||.+|..++||||+|++++.|.|++|||||||..+.    .+||||||.|+     ++.+++|||||
T Consensus       541 ~~~~ia~LD~l~SlA~~A~~~~y~rP~i~~~~~l~I~~gRHPvvE~~~~----~~fVpND~~l~-----~~~~~~iiTGP  611 (848)
T PRK05399        541 LAKALAELDVLASLAEVAEELNYVRPEFTDSREIDIEAGRHPVVEQVLG----GPFVPNDCDLD-----PERRMLLITGP  611 (848)
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCCCEECCCCCEEEEECCCCEEEECCC----CCEEEEEEEEC-----CCCCEEEEECC
T ss_conf             9999999999999999999669647713589865898356857640368----87576568866-----87617999568


Q ss_pred             CCCCHHHHHHHHHHHHHHHHCCCCCCHHHCCCCCCCEEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEECC
Q ss_conf             84407899999999999997198530353206822105676523766113853289999999999995899856999325
Q gi|254780750|r  659 NMGGKSTFLRQNALIVIMAQMGSYVPASYAHIGIVDKLFSRVGSADNLASGRSTFMVEMIETASILNQATNQSFVILDEI  738 (920)
Q Consensus       659 NmgGKSt~lRqval~vilAQiG~fVPA~~a~i~~~D~IftRiGa~D~l~~g~STF~vEm~e~~~IL~~at~~SLVllDEl  738 (920)
                      ||||||||||||||+||||||||||||++|++||||+|||||||+|||.+|+|||||||.|||+||++||+|||||+|||
T Consensus       612 NM~GKSTylRQvalivilAQiGsfVPA~~a~i~i~D~IftRiGa~D~l~~g~STFmvEM~E~a~IL~~AT~~SLVilDEl  691 (848)
T PRK05399        612 NMAGKSTYMRQVALIVLLAQIGSFVPAKSARIGIVDRIFTRIGASDDLASGRSTFMVEMTETANILNNATERSLVLLDEI  691 (848)
T ss_pred             CCCCCHHHHHHHHHHHHHHHCCCCCCHHHCCCCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEECC
T ss_conf             87770899999999999997089741876786555767773676300345787599999999999984898848999616


Q ss_pred             CCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHCCCEEEEEEEEEEECCEEEEEEEEEECCCCCCHHHHH
Q ss_conf             88988056799999999999972698499974875797664306885899999996099277877774478988778999
Q gi|254780750|r  739 GRGTATLDGLSIAWATIEYLHETNRCRGLLATHFHELTDLSKSLKRFHNATLQVSDSNEGIIFLHKVIPGIADHSYGIQV  818 (920)
Q Consensus       739 GrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~~l~~~~~~v~n~~~~~~~~~~~i~flykl~~G~~~~Sygi~v  818 (920)
                      ||||||+||+||||||+|||+++++|+||||||||||++++..+++|.|+||++.+ +++|+|||||++|+|++||||+|
T Consensus       692 GRGTST~DG~aIA~Av~e~l~~~~~~~tlFaTHyheL~~l~~~~~~v~n~h~~v~e-~~~i~Flykl~~G~~~~SyGi~V  770 (848)
T PRK05399        692 GRGTSTYDGLSIAWAVAEYLHDKIKARTLFATHYHELTELAEKLPGVKNVHVAAKE-DGDIVFLHKVVPGAADKSYGIHV  770 (848)
T ss_pred             CCCCCCCHHHHHHHHHHHHHHHCCCCCEEEECCCHHHHHHHHHCCCEEEEEEEEEE-CCEEEEEEEECCCCCCCCHHHHH
T ss_conf             78888506799999999999865798699988757888776437782899999998-89278998767788987779999


Q ss_pred             HHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHCC-CCCHHHHHHHHHCCCCCCCCHHHHHHHHHHH
Q ss_conf             998299989999999999999876300011112111110000112003-5473899999860782227989999999999
Q gi|254780750|r  819 GKLAGLPNTVISRAYDILKTFEKLYHHNQKDMRLYYPEIQTKESKNNL-SKNDKLFVEKIKCLNLDEMSPLTALKTLYAV  897 (920)
Q Consensus       819 A~laG~p~~vi~~A~~~~~~le~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~p~~al~~l~~l  897 (920)
                      |||||+|++||+||++++++||+..........       ...+...+ ....+.++++++++|+++|||+|||+.|++|
T Consensus       771 A~lAGlP~~vi~rA~~~l~~lE~~~~~~~~~~~-------~~~q~~lf~~~~~~~~~~~l~~~~~~~~tp~~al~~l~~l  843 (848)
T PRK05399        771 AKLAGLPKSVIKRAREILAQLESASEKAAKAAA-------ESDQLSLFAAPEESPVLEALKALDPDELTPREALNLLYEL  843 (848)
T ss_pred             HHHCCCCHHHHHHHHHHHHHHHCCCCCCCCCCC-------CCCCCCCCCCCCCHHHHHHHHHCCCCCCCHHHHHHHHHHH
T ss_conf             998398999999999999998446554566667-------6322233368983699999970897779999999999999


Q ss_pred             HHHHH
Q ss_conf             99986
Q gi|254780750|r  898 KAWTL  902 (920)
Q Consensus       898 k~~~~  902 (920)
                      |+.++
T Consensus       844 k~~~~  848 (848)
T PRK05399        844 KKLLK  848 (848)
T ss_pred             HHHHC
T ss_conf             99629


No 3  
>COG0249 MutS Mismatch repair ATPase (MutS family) [DNA replication, recombination, and repair]
Probab=100.00  E-value=0  Score=1745.83  Aligned_cols=837  Identities=46%  Similarity=0.739  Sum_probs=776.2

Q ss_pred             HHHHCCHHHHHHHHHHHHCCCCEEEEEECCCHHHHHHHHHHHHHHHCCEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             67728916899999998779929999808822200799999998618189107889988876265617669999999998
Q gi|254780750|r   21 NLKSSTPMMRQYIEIKSINPDSLVFYRMGDFYELFFDDALLASRCLGITLTKRGKHLGKDIPMCGVPVHTANHYIQKLIK  100 (920)
Q Consensus        21 ~~~~~TP~~~Qy~~iK~~~~D~il~fr~G~FYE~f~~DA~~aa~~L~i~lt~r~~~~~~~~pmaGvP~~~l~~yl~~Lv~  100 (920)
                      .++++||||+|||+||++|||++||||||||||+||+||.+||++|+|+||+|++     +||||||+|+++.|+.+||+
T Consensus         2 ~~~~~tP~m~qy~~ik~~~~d~llffr~GdfYelf~~DA~~~s~~l~itlT~r~~-----~pm~gvP~h~~~~yl~~li~   76 (843)
T COG0249           2 SKAKLTPMMQQYLEIKAQYPDTLLFFRMGDFYELFFEDAKIAARLLDITLTKRGN-----IPMAGVPYHALDYYLAKLIE   76 (843)
T ss_pred             CCCCCCCHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHCCEEECCCC-----CCCCCCCCCCHHHHHHHHHH
T ss_conf             7233783899999988758763899845632663699999998760842315788-----76777764327799999996


Q ss_pred             CCCEEEEEEECCCHHHHHHCCCCCCEEEEEEEEECCCCEECCHHCCCCCCCEEEEEEECCC-EEEEEEEECCCCEEEEEE
Q ss_conf             8985999950289788741289984554589997753030201038787736999995298-499999997865599960
Q gi|254780750|r  101 IGHRIAICEQIESPLEAKKRGNKSLVRRNVVRLVTPGTLTEDQLLSPTDSNYLMAVARIRT-EWAIAWIDISTGIFKIST  179 (920)
Q Consensus       101 ~GykVaiveQ~E~p~~~~~~~~~~~v~R~Vt~IiTpGT~~d~~~l~~~~~nyL~aI~~~~~-~~Gia~iDisTG~~~~~~  179 (920)
                      +|||||||||+|+|..+     +++|+|+|+||+||||++|+.++++..+|||+|+...+. .||+||+|+|||+|.+.+
T Consensus        77 ~g~kVAiceQ~e~~~~~-----k~~v~R~v~rv~TpGt~~d~~~l~~~~~n~l~a~~~~~~~~~gla~~dlstGef~~~~  151 (843)
T COG0249          77 LGYKVAICEQLEDPAEA-----KGVVERKVVRVVTPGTLTDEALLSDRENNYLAALAIDRDGKVGLAFIDLSTGEFFVSE  151 (843)
T ss_pred             CCCEEEEEECCCCHHHH-----CCCCEEEEEEEECCCEEECCCCCCCCCCCEEEEEEECCCCEEEEEEEECCCCEEEEEE
T ss_conf             79838999715581641-----6850257899988976422442346666549999966898799999981267499998


Q ss_pred             CCHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHCCCCEECCCCCCCCHHHHHHHHHHHCCCCCCCCHHHHH-HHHHH
Q ss_conf             58789999985229857997077689678998874238815718521147134478899870878642102444-34688
Q gi|254780750|r  180 SNHDRLISDIMRIDPREIIFSEKELSHAEYKSLFETLGNVAVAQPNVFFDHSISESRIADYYNITTVDTFGSFS-QVEKT  258 (920)
Q Consensus       180 ~~~d~l~~~L~~l~P~EIii~~~~~~~~~~~~l~~~~~~~~~~~~~~~f~~~~~~~~l~~~~~~~~l~~~~~~~-~~~~~  258 (920)
                      +..+++.++|.|++|+|||+++...+... .......  .....+.|.|+...+...+..+|++.++++++..+ ..+++
T Consensus       152 ~~~~~l~~~l~r~~p~Eil~~~~~~~~~~-~~~~~~~--~~~~~~~~~f~~~~~~~~l~~~~~~~~l~~~~~~~~~~~~~  228 (843)
T COG0249         152 FEREKLLSELKRLQPKELLLSESLLSSTL-AEIQKGL--FVVRLPASFFDEDDAEEILSEYFGVRDLDGFGLISTPLALS  228 (843)
T ss_pred             EEHHHHHHHHHHCCCCEEEECCCCCCHHH-HHHHHCE--EEEECCHHHCCCCHHHHHHHHHHCCCCCCCCCCCCCHHHHH
T ss_conf             32899999998489857996655576245-6653100--13654445337427999999983866454424224538999


Q ss_pred             HHHHHHHHHHHHHCCCCCCCCCCCCCCCCCEEEECCHHHCCEEEEECCCC-CCCCHHHHHHCCCCCCHHHHHHHHHHHHH
Q ss_conf             87777643687411222222113445745401425133201545412787-76412787630123433789999863100
Q gi|254780750|r  259 AAAAAISYIKKTQMVNKPTIGYPEREDIQSTLFIDSAARSNLEILRTLSG-SREQSLLKTIDYSITGAGGRLFAERIASP  337 (920)
Q Consensus       259 a~~all~Yl~~~~~~~~~~i~~~~~~~~~~~m~LD~~Tl~nLEI~~~~~g-~~~gSL~~~Ln~t~T~~G~RlLr~wL~~P  337 (920)
                      |+++++.|+..+|...++++..++.+...++|.||.+|++||||++|.+| +++|||||+||+|+|+||+|+|++||.+|
T Consensus       229 a~~~ll~Y~~~t~~~~l~~~~~~~~~~~~~~m~lD~~t~~nLEl~~~~~~~~~~gSL~~~ld~t~T~mG~RlL~~wl~~P  308 (843)
T COG0249         229 AAGALLSYLKDTQKTFLPHIQIIQRYDLEDYMVLDAATRRNLELFSNLRGNGKKGSLFWLLDRTVTPMGSRLLKRWLLQP  308 (843)
T ss_pred             HHHHHHHHHHHHHHCCCCCCCCCEEECCCCEEEECHHHHHCCCCCCCCCCCCCCCCHHHHHCCCCCCHHHHHHHHHHHCC
T ss_conf             99999999998653224355634564358679973899711102224778998873999853677824679989976480


Q ss_pred             CCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHCCCCHHH
Q ss_conf             23456789899999974022125889999975204834444567752100002120689999986556754302584577
Q gi|254780750|r  338 LTDSTKINTRLDSINFFIQNPILINPIQKILKSSPDVPRSLSRLKIGRGEPKDIAVIRDGIRSGINILNLFLKNDLPEEL  417 (920)
Q Consensus       338 L~d~~~I~~R~daVe~l~~~~~~~~~l~~~L~~i~DleRll~ri~~~~~~p~dl~~L~~sl~~~~~i~~~l~~~~~~~~l  417 (920)
                      |+|.++|+.|||+|++|..+..+++.++..|++++|+||+++|+++|+++|+|+..+++++..++.+...+........+
T Consensus       309 L~~~~~I~~Rld~Ve~l~~~~~l~~~L~~~L~~v~DleRl~~Rl~~~~~~~rDl~~l~~~l~~~~~i~~~l~~~~~~~~l  388 (843)
T COG0249         309 LLDKEEIEERLDAVEELKDNPELREKLREMLKKVPDLERLLSRLSLGRASPRDLLRLRDSLEKIPEIFKLLSSLKSESDL  388 (843)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCHHHH
T ss_conf             35899999999999999865689999999985076799999999737998656999999999889999998525430235


Q ss_pred             HHHHHHHHHHH--HHHHHHHHHHHHHHHHHHHCCCCEECCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCC
Q ss_conf             87676577678--9999999998543101221046010168541145579988638999997768778873887511025
Q gi|254780750|r  418 RGAVEKLKKLP--QSLEKTLSSMLSDDLPTFKRDGGFLRDGADASLDETRSLRDQSKRIIASLQLKYAEETKIKNLKIKH  495 (920)
Q Consensus       418 ~~~~~~l~~l~--~~l~~~l~~~i~~~~~~~~~~~~~ik~g~d~eLD~lr~~~~~~~~~l~~l~~~~~~~~~i~sLki~~  495 (920)
                      ......+..+.  ..+...+..++.+++|...++ ++|+.||+.+||++|...++.++++.+++.++++++|++++|+.|
T Consensus       389 ~~~~~~i~~~~~~~e~~~ll~~~i~~~~~~~~~~-~ii~~g~~~eLd~lr~~~~~~~~~i~~le~~~r~~~gi~slki~~  467 (843)
T COG0249         389 LLLLEDIESLDYLAELLELLETAINEDPPLAVRD-GIIKEGYNIELDELRDLLNNAKEWIAKLELEERERTGIKSLKIKY  467 (843)
T ss_pred             HHHHHHHHCCCCHHHHHHHHHHHHHHCCHHHCCH-HHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHH
T ss_conf             6776444313407999999998721166233015-577511039999999999888999999999888864972121122


Q ss_pred             CCCCEEEEEECCHHHHHCCCCCCCCCCEEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHH
Q ss_conf             58622376204114333441116876527985212000111345666433464377777643344788876543011257
Q gi|254780750|r  496 NNNLGYFIEVTSSSASVLKKDLESKDRFIHRQTMSNLTRFTTLELIDLENRITNATNSALLIELESFEILSNAIIEQSES  575 (920)
Q Consensus       496 n~~~gy~iEV~~~~~~~i~~~~~~~~~~i~~qt~~~~~Rf~t~eL~~l~~~i~~~~~~~~~~e~~~~~~l~~~i~~~~~~  575 (920)
                      |+++||||||++++.+.+|.+      |+++||++|++||+||+|++++.++.++++++..+|+++|.++++.+..|.+.
T Consensus       468 n~v~Gy~ievt~~~~~~~p~~------~ir~qt~kn~~rf~t~el~~~e~~i~~a~~~i~~lE~~l~~~~~~~i~~~~~~  541 (843)
T COG0249         468 NKVYGYYIEVTKSNAKLVPDD------YIRRQTLKNAERFTTPELKELEEKLLDAEEKILALEYELFDELREKILAHINE  541 (843)
T ss_pred             HCCCEEEEEECHHCCCCCCHH------HHHHHHHHCCEEECCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             034605999542014558437------89998773246864888899999999999998999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCCCCEECCCCCCEEECCCCCHHHHHHHHHCCCCCEEEEEEEECCCCCCCCCEEEEE
Q ss_conf             98888999867788778887752588512104787140000468058876310287704443456358777766439999
Q gi|254780750|r  576 LDNASQVIAIIDISIALAILAKEQNYCRPIIDNSTNFIVKDGRHPIVEKTLKQQSSKPFIANDCDLSCPNDKNSGKLWLL  655 (920)
Q Consensus       576 l~~~~~~ia~lD~l~SlA~~a~~~~y~rP~i~~~~~l~i~~gRHPviE~~l~~~~~~~fVpNdi~l~~~~~~~~~~~~ii  655 (920)
                      |+.++.++|+|||++|||.+|...+||||+++++..+.|++|||||||..+..+    ||||||.|+     ++.+++||
T Consensus       542 l~~~a~aLa~lD~l~slA~~a~~~~y~rP~~~~~~~l~i~~gRHPvvE~~~~~~----fVpNd~~L~-----~~~~i~lI  612 (843)
T COG0249         542 LQALAKALAELDVLSSLAEIAAEQNYVRPEFVDSNDLEIKEGRHPVVEAVLDNG----FVPNDIDLS-----GNRRIILI  612 (843)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCCCCCEECCCCCEEEEECCCCHHHHHCCCC----CCCCCEEEC-----CCCEEEEE
T ss_conf             999999999999999999998657987866638988799845761122212577----446865307-----99548999


Q ss_pred             ECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHCCCCCCCEEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEE
Q ss_conf             67784407899999999999997198530353206822105676523766113853289999999999995899856999
Q gi|254780750|r  656 TGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHIGIVDKLFSRVGSADNLASGRSTFMVEMIETASILNQATNQSFVIL  735 (920)
Q Consensus       656 TGpNmgGKSt~lRqval~vilAQiG~fVPA~~a~i~~~D~IftRiGa~D~l~~g~STF~vEm~e~~~IL~~at~~SLVll  735 (920)
                      |||||||||||||||||++|||||||||||++|++||||+|||||||+|||.+|+|||||||.||++||++||++|||||
T Consensus       613 TGPNM~GKSTylRQvali~imAQiGsfVPA~~A~i~ivD~IfTRiGa~DDL~~G~STFMvEM~Eta~IL~~AT~~SLvil  692 (843)
T COG0249         613 TGPNMGGKSTYLRQVALIVILAQIGSFVPAEKARIGIVDRIFTRIGAADDLASGRSTFMVEMLETANILDNATERSLVIL  692 (843)
T ss_pred             ECCCCCCCHHHHHHHHHHHHHHHCCCCEEHHHCCCCCCCEEEECCCCCCHHHCCCCHHHHHHHHHHHHHHHCCCCCEEEE
T ss_conf             78998861999999999999987499852887436653201121565100211651899999999999985798848999


Q ss_pred             ECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHCCCEEEEEEEEEEECCEEEEEEEEEECCCCCCHH
Q ss_conf             32588988056799999999999972698499974875797664306885899999996099277877774478988778
Q gi|254780750|r  736 DEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFHELTDLSKSLKRFHNATLQVSDSNEGIIFLHKVIPGIADHSYG  815 (920)
Q Consensus       736 DElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~~l~~~~~~v~n~~~~~~~~~~~i~flykl~~G~~~~Syg  815 (920)
                      ||+||||||+||+||||||+|||+++++|+||||||||||+++....+++.|+||.+.+.+++|+|+|++++|+|++|||
T Consensus       693 DEiGRGTsT~DGlaIA~Av~eyL~~~~~~~tLFATHy~ELt~l~~~~~~v~N~h~~~~e~~~~i~Fl~kv~~G~a~~SyG  772 (843)
T COG0249         693 DEIGRGTSTYDGLAIAWAVLEYLHEKIGCRTLFATHYHELTELEEKLPQVKNYHMSAVEEGGDITFLYKVKPGIADKSYG  772 (843)
T ss_pred             ECCCCCCCCCHHHHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHCCCCCCEEEEEEEECCCCEEEEEEECCCCCCCCHH
T ss_conf             64668877413689999999999863583699961688887765115445504788897489658999834688886589


Q ss_pred             HHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHCCCCCHHHHHHHHHCCCCCCCCHHHHHHHHH
Q ss_conf             99999829998999999999999987630001111211111000011200354738999998607822279899999999
Q gi|254780750|r  816 IQVGKLAGLPNTVISRAYDILKTFEKLYHHNQKDMRLYYPEIQTKESKNNLSKNDKLFVEKIKCLNLDEMSPLTALKTLY  895 (920)
Q Consensus       816 i~vA~laG~p~~vi~~A~~~~~~le~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~al~~l~  895 (920)
                      |+||++||+|.+||+||++++++||+.......+.           .+..... ..++.++++++|+++|||+ ||+.|+
T Consensus       773 i~VAklaGlP~~Vi~rA~~il~~le~~~~~~~~~~-----------~~~~~~~-~~~i~~~~~~~~~~~~tp~-al~~l~  839 (843)
T COG0249         773 IHVAKLAGLPEEVIERAREILAELEKESRSSNLEL-----------NQKDLSL-FPKVLKALKSLDPDELTPR-ALNLLY  839 (843)
T ss_pred             HHHHHHHCCCHHHHHHHHHHHHHHHHCCCCCCCCH-----------HHHHHHH-HHHHHHHHHHCCHHHCCHH-HHHHHH
T ss_conf             99999929999999999999998750356753231-----------4566767-9999999870790004878-999999


Q ss_pred             HHHH
Q ss_conf             9999
Q gi|254780750|r  896 AVKA  899 (920)
Q Consensus       896 ~lk~  899 (920)
                      +||+
T Consensus       840 ~lk~  843 (843)
T COG0249         840 ELKK  843 (843)
T ss_pred             HHHC
T ss_conf             8529


No 4  
>KOG0218 consensus
Probab=100.00  E-value=0  Score=1317.17  Aligned_cols=816  Identities=28%  Similarity=0.444  Sum_probs=665.5

Q ss_pred             HHCCHHHHHHHHHHHHCCCCEEEEEECCCHHHHHHHHHHHHHHHCCEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCC
Q ss_conf             72891689999999877992999980882220079999999861818910788998887626561766999999999889
Q gi|254780750|r   23 KSSTPMMRQYIEIKSINPDSLVFYRMGDFYELFFDDALLASRCLGITLTKRGKHLGKDIPMCGVPVHTANHYIQKLIKIG  102 (920)
Q Consensus        23 ~~~TP~~~Qy~~iK~~~~D~il~fr~G~FYE~f~~DA~~aa~~L~i~lt~r~~~~~~~~pmaGvP~~~l~~yl~~Lv~~G  102 (920)
                      +++||+++||.++|.+|+|+||.++|||.|.+||+||++||++|||+|     +.++|+..|+||.|+++.|++|||++|
T Consensus       160 s~yTPLeqQ~~elK~~h~d~VL~ievGYkyRfFgeDAeiasrvLgIyc-----h~dhnFmtaS~P~~Rl~vHleRLv~~g  234 (1070)
T KOG0218         160 SKYTPLEQQVKELKMHHRDKVLVIEVGYKYRFFGEDAEIASRVLGIYC-----HNDHNFMTASFPDVRLNVHLERLVHHG  234 (1070)
T ss_pred             CCCCCHHHHHHHHHHHCCCEEEEEEECCEEEEECCCHHHHHHHHCEEE-----EECCCEEECCCCCCHHHHHHHHHHHCC
T ss_conf             556808999999986388638999942067750530889987641378-----712540104677402467899987527


Q ss_pred             CEEEEEEECCCHHHHHHCC-CCCCEEEEEEEEECCCCEECCH--HC-----CCCCCCEEEEEEECC---------CEEEE
Q ss_conf             8599995028978874128-9984554589997753030201--03-----878773699999529---------84999
Q gi|254780750|r  103 HRIAICEQIESPLEAKKRG-NKSLVRRNVVRLVTPGTLTEDQ--LL-----SPTDSNYLMAVARIR---------TEWAI  165 (920)
Q Consensus       103 ykVaiveQ~E~p~~~~~~~-~~~~v~R~Vt~IiTpGT~~d~~--~l-----~~~~~nyL~aI~~~~---------~~~Gi  165 (920)
                      ||||||+|+||++.++..+ ..++|.|++++|||+||+.+|.  ++     -..+++|++|+..+.         -.+|+
T Consensus       235 ~KVaVVkQtETAAiKs~gasRsslF~RklsavyTKaTl~eds~~~~r~e~~~~~~ssfllcv~dn~~ksk~ksg~v~vgl  314 (1070)
T KOG0218         235 LKVAVVKQTETAAIKSHGASRSSLFERKLSAVYTKATLGEDSTFVLRGERILGDTSSFLLCVRDNVHKSKEKSGVVKVGL  314 (1070)
T ss_pred             CEEEEEEEHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCHHHHCCCCCEEEEEEEHHHHHHHHHCCCEEEEE
T ss_conf             34899962356787751775453677788888532000245654304123047754089997200554454347358999


Q ss_pred             EEEECCCCEEEEEECCHH----HHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHCCC-------CEECCCCCCCCHHHHH
Q ss_conf             999978655999605878----99999852298579970776896789988742388-------1571852114713447
Q gi|254780750|r  166 AWIDISTGIFKISTSNHD----RLISDIMRIDPREIIFSEKELSHAEYKSLFETLGN-------VAVAQPNVFFDHSISE  234 (920)
Q Consensus       166 a~iDisTG~~~~~~~~~d----~l~~~L~~l~P~EIii~~~~~~~~~~~~l~~~~~~-------~~~~~~~~~f~~~~~~  234 (920)
                      ..+.++||++..++|.++    +|++.+..++|.|+|++.. +++.....++...-.       .........++.+.+.
T Consensus       315 igVqlstGevVydeFqdnf~rseLqtrisslqP~ElLl~~~-ls~qt~all~~~~Vsve~~~~rv~r~~naV~q~ikla~  393 (1070)
T KOG0218         315 IGVQLSTGEVVYDEFQDNFARSELQTRISSLQPIELLLNTD-LSPQTVALLFKDNVSVELIHKRVYRLENAVVQAIKLAN  393 (1070)
T ss_pred             EEEECCCCCEEHHHHHHHHHHHHHHHHHHCCCCCEEECCCC-CCHHHHHHHHHCCCCHHHHHHHHHHCHHHHHHHHHHHH
T ss_conf             99962788474686665677777899986068410004898-75888999985344224444345110037999999999


Q ss_pred             HHHHHHCCCCCC-CC------HHHHHHH-HHHHHHHHHHHHHHHHCCCCCCC-CCCCCCCCCCEEEECCHHHCCEEEEEC
Q ss_conf             889987087864-21------0244434-68887777643687411222222-113445745401425133201545412
Q gi|254780750|r  235 SRIADYYNITTV-DT------FGSFSQV-EKTAAAAAISYIKKTQMVNKPTI-GYPEREDIQSTLFIDSAARSNLEILRT  305 (920)
Q Consensus       235 ~~l~~~~~~~~l-~~------~~~~~~~-~~~a~~all~Yl~~~~~~~~~~i-~~~~~~~~~~~m~LD~~Tl~nLEI~~~  305 (920)
                      +.+.++|..... ++      .-..+.+ .++.+++++.|+.+.....+... +..+.++...+|.|+++|+++||||.|
T Consensus       394 e~~q~f~~~k~~l~gs~ii~li~nl~~psvic~la~~is~lkefnlE~~l~~psf~s~~ss~e~Mtls~ntLq~Leif~n  473 (1070)
T KOG0218         394 EKIQNFEDDKEMLEGSEIICLIMNLSHPSVICLLAKLISHLKEFNLEQVLLIPSFYSPFSSKEHMTLSPNTLQSLEIFTN  473 (1070)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHCHHHHEECCCCCCCCCCCCEEEECHHHHHCEEEEEE
T ss_conf             99765311155541245666654278706999999999999970667741033336854553036655423201433550


Q ss_pred             CC-CCCCCHHHHHHCCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHC---CCHHHHHHHHHHHHHHCCHHHHHHHH
Q ss_conf             78-776412787630123433789999863100234567898999999740---22125889999975204834444567
Q gi|254780750|r  306 LS-GSREQSLLKTIDYSITGAGGRLFAERIASPLTDSTKINTRLDSINFFI---QNPILINPIQKILKSSPDVPRSLSRL  381 (920)
Q Consensus       306 ~~-g~~~gSL~~~Ln~t~T~~G~RlLr~wL~~PL~d~~~I~~R~daVe~l~---~~~~~~~~l~~~L~~i~DleRll~ri  381 (920)
                      .+ |+.+|||||+||||.|.+|.|+||+|+.+||+|...|++|+|||+++.   ++...++.++.+|.+.|||+|.++||
T Consensus       474 qtd~~~kGSLfwvldhT~TsfG~RmLr~WvtkPLvd~~~I~eRLDAVeeitshssnS~vf~si~~~l~rlpDl~rgL~rI  553 (1070)
T KOG0218         474 QTDGSEKGSLFWVLDHTRTSFGLRMLREWVTKPLVDVHQIEERLDAVEEITSHSSNSIVFESINQMLNRLPDLLRGLNRI  553 (1070)
T ss_pred             CCCCCCCCCEEEEECCCHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCHHHHHHHHH
T ss_conf             68997454268873331548889999998744002198899987789999861542499999999987480767667887


Q ss_pred             HHHHHCH-HHHHHHHHHHHHHHHHHHHH---HH----C-----CCCHHHHHHHHHHH--HHHHHHHHHHHHHHHHHHHHH
Q ss_conf             7521000-02120689999986556754---30----2-----58457787676577--678999999999854310122
Q gi|254780750|r  382 KIGRGEP-KDIAVIRDGIRSGINILNLF---LK----N-----DLPEELRGAVEKLK--KLPQSLEKTLSSMLSDDLPTF  446 (920)
Q Consensus       382 ~~~~~~p-~dl~~L~~sl~~~~~i~~~l---~~----~-----~~~~~l~~~~~~l~--~l~~~l~~~l~~~i~~~~~~~  446 (920)
                      .+++|+| +++..+.+.+.....-++.+   .+    .     ..+..|+.++..+.  .+...+...+ .+++......
T Consensus       554 y~~tCtp~~eff~vlk~iy~a~s~fq~~~~~~~~~~~s~~~s~~qS~LLrrlisel~~p~~~s~~~hfL-~mln~~aa~~  632 (1070)
T KOG0218         554 YYGTCTPRKEFFFVLKQIYSAVSHFQMHQSYLEHFKSSDGRSGKQSPLLRRLISELNEPLSTSQLPHFL-TMLNVSAAME  632 (1070)
T ss_pred             HCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHCCHHHHHHHHHHCCCCCCCCHHHHH-HHHHHHHHHH
T ss_conf             505679479999999999999999998765554311654310101189999999846720014278999-8843898861


Q ss_pred             HCCCCEECCCCC-CHHHHHHHHH---HHHHHH---HHHHHHHHHHHCCCCCCCCCCCCCCEEEEEECCHHHHHCCCCCCC
Q ss_conf             104601016854-1145579988---638999---997768778873887511025586223762041143334411168
Q gi|254780750|r  447 KRDGGFLRDGAD-ASLDETRSLR---DQSKRI---IASLQLKYAEETKIKNLKIKHNNNLGYFIEVTSSSASVLKKDLES  519 (920)
Q Consensus       447 ~~~~~~ik~g~d-~eLD~lr~~~---~~~~~~---l~~l~~~~~~~~~i~sLki~~n~~~gy~iEV~~~~~~~i~~~~~~  519 (920)
                      ......+++-.| +.+|+-+++.   ++.+..   +.+-.+++|+.++.++|.+.......|.|||+++..+++|.+   
T Consensus       633 gnk~d~fkd~snfpl~~e~~di~~virE~~ms~~~~~~hLaeiRk~Lk~pnlef~~vsgv~flIEvkns~~kkiP~d---  709 (1070)
T KOG0218         633 GNKDDQFKDFSNFPLYDESEDIIKVIRESEMSRSQLKEHLAEIRKYLKRPNLEFRQVSGVDFLIEVKNSQIKKIPDD---  709 (1070)
T ss_pred             CCHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCEEEEEEECCCCCCCCCCC---
T ss_conf             77587662220385111246689999998877877899999999996189850687648069998154313549901---


Q ss_pred             CCCEEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             76527985212000111345666433464377777643344788876543011257988889998677887788877525
Q gi|254780750|r  520 KDRFIHRQTMSNLTRFTTLELIDLENRITNATNSALLIELESFEILSNAIIEQSESLDNASQVIAIIDISIALAILAKEQ  599 (920)
Q Consensus       520 ~~~~i~~qt~~~~~Rf~t~eL~~l~~~i~~~~~~~~~~e~~~~~~l~~~i~~~~~~l~~~~~~ia~lD~l~SlA~~a~~~  599 (920)
                         |++.++++...||+||++.++..++..+++.+.......|..+.+.+..||..|+++...+|.+||+.|||.+|.+.
T Consensus       710 ---WiKvnsTk~vsRfhtP~iq~~l~eL~~~~e~L~i~sea~~~sFL~kiSehYtelrkat~~LatlDCi~SlA~~s~n~  786 (1070)
T KOG0218         710 ---WIKVNSTKMVSRFHTPRIQKLLQELEYYKELLIIESEAQYKSFLNKISEHYTELRKATLNLATLDCILSLAATSCNV  786 (1070)
T ss_pred             ---CEEECCCEEEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             ---35634612244137888999999999888776663488999999999999999999999888999999999986158


Q ss_pred             CCCCEECCCC-CCEEECCCCCHHHHHHHHHCCCCCEEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             8851210478-714000046805887631028770444345635877776643999967784407899999999999997
Q gi|254780750|r  600 NYCRPIIDNS-TNFIVKDGRHPIVEKTLKQQSSKPFIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQ  678 (920)
Q Consensus       600 ~y~rP~i~~~-~~l~i~~gRHPviE~~l~~~~~~~fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQ  678 (920)
                      |||||+|+|+ ..|.|++||||+||.+|..+    |||||+.|++    ++.|++|||||||||||+|+|||||+.||||
T Consensus       787 nYvRPtfvd~~~eI~ikngRhPvIe~Ll~d~----fVPNdi~ls~----egerc~IITGPNMGGKSsyIrQvALitIMAQ  858 (1070)
T KOG0218         787 NYVRPTFVDGQQEIIIKNGRHPVIESLLVDY----FVPNDIMLSP----EGERCNIITGPNMGGKSSYIRQVALITIMAQ  858 (1070)
T ss_pred             CCCCCCCCCCHHHHHHHCCCCCHHHHHHHHC----CCCCCCEECC----CCCEEEEEECCCCCCCHHHHHHHHHHHHHHH
T ss_conf             9548540241245343157883389875312----5788623468----8865899837998870499999999999998


Q ss_pred             CCCCCCHHHCCCCCCCEEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             19853035320682210567652376611385328999999999999589985699932588988056799999999999
Q gi|254780750|r  679 MGSYVPASYAHIGIVDKLFSRVGSADNLASGRSTFMVEMIETASILNQATNQSFVILDEIGRGTATLDGLSIAWATIEYL  758 (920)
Q Consensus       679 iG~fVPA~~a~i~~~D~IftRiGa~D~l~~g~STF~vEm~e~~~IL~~at~~SLVllDElGrGTst~DG~aiA~aile~l  758 (920)
                      +||||||++|++++||.|||||||+|||..|.||||+||.+|++||++||++||||+||+||||||+||+|||||+++||
T Consensus       859 iGsfVPAeea~l~IfdgvltRmGAsDnI~~grSTFm~Emldt~eil~kat~~SlvilDElGRGTsThDGiAIsYAtL~yf  938 (1070)
T KOG0218         859 IGSFVPAEEARLSIFDGVLTRMGASDNIINGRSTFMVEMLDTLEILKKATKRSLVILDELGRGTSTHDGIAISYATLKYF  938 (1070)
T ss_pred             HCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCHHHHHHHHCCCCCCCCCHHHHHHHHHHH
T ss_conf             54766367753157766787605543310451689999988999987603000011576548876665455799999999


Q ss_pred             HHHCCCEEEEECCCHHHHHHHHHCCC-EEEEEEEEEEEC-------CEEEEEEEEEECCCCCCHHHHHHHHCCCCHHHHH
Q ss_conf             97269849997487579766430688-589999999609-------9277877774478988778999998299989999
Q gi|254780750|r  759 HETNRCRGLLATHFHELTDLSKSLKR-FHNATLQVSDSN-------EGIIFLHKVIPGIADHSYGIQVGKLAGLPNTVIS  830 (920)
Q Consensus       759 ~~~~~~~~lfaTHy~eL~~l~~~~~~-v~n~~~~~~~~~-------~~i~flykl~~G~~~~Sygi~vA~laG~p~~vi~  830 (920)
                      .+..+|.+||+|||+.|++++..+++ +.||||.+-+..       +.|+|||||++|+|.+|||++||+||++|.++|.
T Consensus       939 ~~~~k~l~LFvTHfP~l~eie~~f~gqv~nyHmgyl~sedk~~~d~dsVtfLYklvrGlasrSyGlnVAklA~ip~sii~ 1018 (1070)
T KOG0218         939 SELSKCLILFVTHFPMLGEIESGFPGQVRNYHMGYLESEDKTGEDWDSVTFLYKLVRGLASRSYGLNVAKLARIPKSIIN 1018 (1070)
T ss_pred             HHHHCEEEEEEECCCCHHHHHCCCCCCCCCEEEEEEEECCCCCCCCHHHHHHHHHHHHHHHCCCCCCHHHHHCCCHHHHH
T ss_conf             97520257765338406536217985224035312333134578840446599873103103445018988279989999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             99999999987630001111211111000
Q gi|254780750|r  831 RAYDILKTFEKLYHHNQKDMRLYYPEIQT  859 (920)
Q Consensus       831 ~A~~~~~~le~~~~~~~~~~~~~~~~~~~  859 (920)
                      ||.+++++||+.....++..+.++..+..
T Consensus      1019 rA~siSeeleke~rn~rk~lk~fAkL~~i 1047 (1070)
T KOG0218        1019 RAFSISEELEKESRNERKLLKLFAKLKRI 1047 (1070)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99888899998876699999999999998


No 5  
>KOG0217 consensus
Probab=100.00  E-value=0  Score=1275.49  Aligned_cols=815  Identities=30%  Similarity=0.425  Sum_probs=669.3

Q ss_pred             CCCCCCCCHHHHHHHHHHCCHHHHHHHHHHHHCCCCEEEEEECCCHHHHHHHHHHHHHHHCCEEECCCCCCCCCCCCCCC
Q ss_conf             99856778203575677289168999999987799299998088222007999999986181891078899888762656
Q gi|254780750|r    7 SPQKLYSEQIDLEENLKSSTPMMRQYIEIKSINPDSLVFYRMGDFYELFFDDALLASRCLGITLTKRGKHLGKDIPMCGV   86 (920)
Q Consensus         7 ~p~~~~~~~~~~~~~~~~~TP~~~Qy~~iK~~~~D~il~fr~G~FYE~f~~DA~~aa~~L~i~lt~r~~~~~~~~pmaGv   86 (920)
                      -|.+++.+|    .+++++||+++|||+||++|+|||+||++|+|||+|+.||.+++++|+|++|.      .|+|||||
T Consensus       234 Dp~TLyiP~----s~~~kftpg~kqwWeiKs~~fD~ivfFk~GKFyELye~DA~vg~~~~dl~f~~------vN~~~~Gf  303 (1125)
T KOG0217         234 DPRTLYIPP----SFWKKFTPGEKQWWEIKSDNFDTIVFFKKGKFYELYEMDALVGARLFDLKFMD------VNMPHSGF  303 (1125)
T ss_pred             CCCCEECCH----HHHHCCCCHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHHHCCEEECC------CCCCCCCC
T ss_conf             831130487----89731793245465424321617888715528888764666533320335513------66534799


Q ss_pred             CHHHHHHHHHHHHHCCCEEEEEEECCCHHHHHHCCC-----CCCEEEEEEEEECCCCEECCHHCCCCCCCEEEEEEECCC
Q ss_conf             176699999999988985999950289788741289-----984554589997753030201038787736999995298
Q gi|254780750|r   87 PVHTANHYIQKLIKIGHRIAICEQIESPLEAKKRGN-----KSLVRRNVVRLVTPGTLTEDQLLSPTDSNYLMAVARIRT  161 (920)
Q Consensus        87 P~~~l~~yl~~Lv~~GykVaiveQ~E~p~~~~~~~~-----~~~v~R~Vt~IiTpGT~~d~~~l~~~~~nyL~aI~~~~~  161 (920)
                      |+++++.|+.+++++|||||.|||+|+|..+..+..     .++|+|+|++|+|.||++|..++.+..+.||+||.+...
T Consensus       304 PE~sf~~~a~q~iq~GYkvarVEQtEt~l~~e~r~~~~~~kdkvvrRev~~ilt~GT~td~~l~~~~~akylmai~e~~~  383 (1125)
T KOG0217         304 PEGSFDYWADQFIQKGYKVARVEQTETPLGKEIRERKTGKKDKVVRREVCRILTNGTLTDIALLTSDLAKYLMAIKESEE  383 (1125)
T ss_pred             CCCCHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHCCCCCCHHHHHHHHHHHHCCCCCHHHHHHCCHHHHHHHHHHHCCC
T ss_conf             85430567999996064566313666767765420124530256788999986288501577743678888888760677


Q ss_pred             -------EEEEEEEECCCCEEEEEECCHH----HHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHCCC-CEE--CCCCCC
Q ss_conf             -------4999999978655999605878----99999852298579970776896789988742388-157--185211
Q gi|254780750|r  162 -------EWAIAWIDISTGIFKISTSNHD----RLISDIMRIDPREIIFSEKELSHAEYKSLFETLGN-VAV--AQPNVF  227 (920)
Q Consensus       162 -------~~Gia~iDisTG~~~~~~~~~d----~l~~~L~~l~P~EIii~~~~~~~~~~~~l~~~~~~-~~~--~~~~~~  227 (920)
                             .+|+|++|++||++.+++|.||    .|.+.|++..|+|+|...+.++......+.-.+.+ ...  ..+..+
T Consensus       384 ~~~~~~~s~gvc~iDtstge~~~~eF~DDr~~s~L~tlLs~~rp~E~I~e~~~ls~~t~~~ik~~~~~~~~~n~~~~~eF  463 (1125)
T KOG0217         384 SYSTGEVSFGVCFIDTSTGEINIGEFCDDRHCSKLDTLLSQVRPVELIEERKNLSDPTKVIIKLKLSSNLVENLVPKSEF  463 (1125)
T ss_pred             CCCCCCEEEEEEEEECCCCEEEEEEEECCHHHHHHHHHHHCCCHHHHHHHHHCCCCCEEEEEEEEECCHHHHCCCCHHHH
T ss_conf             77767514558999835553889874050556488899870668999987510477514421002235344323673540


Q ss_pred             CCHHHHHHHH--HHHCCC-------CCCCCHHHHHHHHHHHHHHHHHHHHHHHCCC-CCCCCCCCCCCC--CCEEEECCH
Q ss_conf             4713447889--987087-------8642102444346888777764368741122-222211344574--540142513
Q gi|254780750|r  228 FDHSISESRI--ADYYNI-------TTVDTFGSFSQVEKTAAAAAISYIKKTQMVN-KPTIGYPEREDI--QSTLFIDSA  295 (920)
Q Consensus       228 f~~~~~~~~l--~~~~~~-------~~l~~~~~~~~~~~~a~~all~Yl~~~~~~~-~~~i~~~~~~~~--~~~m~LD~~  295 (920)
                      |+.......+  .++|..       ..+...+...+.+..|+|+++.||+...... +..+..+..++.  .+.|.||.+
T Consensus       464 wdsek~~~eii~~dy~~~~g~e~~~sil~~p~~~~~la~safg~~~~Ylk~~~id~~llsm~n~~ey~~~~~s~mvlD~~  543 (1125)
T KOG0217         464 WDSEKTGREIISEDYFESLGLEDSPSILKSPNTDKELALSAFGGLFYYLKKLLIDEELLSMKNFEEYDSLDQSEMVLDGA  543 (1125)
T ss_pred             CCHHHHHHHHHHHHHHHCCCCCCCHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHCCCCEEECCH
T ss_conf             33235888875455430136667433216888542035987788999999876679886213244222011212010433


Q ss_pred             HHCCEEEEECC-CCCCCCHHHHHHCCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCH
Q ss_conf             32015454127-87764127876301234337899998631002345678989999997402212588999997520483
Q gi|254780750|r  296 ARSNLEILRTL-SGSREQSLLKTIDYSITGAGGRLFAERIASPLTDSTKINTRLDSINFFIQNPILINPIQKILKSSPDV  374 (920)
Q Consensus       296 Tl~nLEI~~~~-~g~~~gSL~~~Ln~t~T~~G~RlLr~wL~~PL~d~~~I~~R~daVe~l~~~~~~~~~l~~~L~~i~Dl  374 (920)
                      |++|||||.|. +|+.+|+||..+|+|.||||+|||+.||++||+|.+.|++|||+|+.|..++..+.++...|+++||+
T Consensus       544 tL~NleIf~Ns~~G~~~gtL~~~~~~csTpfGKRllk~Wl~~Pl~~~~~I~~R~dav~~l~~~~~~~~~~~e~l~klPDl  623 (1125)
T KOG0217         544 TLENLEIFSNSRNGGDEGTLFYAVNRCSTPFGKRLLKTWLMAPLCDKEDIKQRQDAVDSLGKAPMDRTKVGETLKKLPDL  623 (1125)
T ss_pred             HHHHHHHHCCCCCCCCCHHHHHHHHHCCCHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHCCCH
T ss_conf             33545540157789973208998762247177788999852767788889998999998741740699999998647729


Q ss_pred             HHHHHHHHHHHHC-HHHHHHHHHHHHHHHHHHHHH---HHCCC-CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHC
Q ss_conf             4444567752100-002120689999986556754---30258-4577876765776789999999998543101-2210
Q gi|254780750|r  375 PRSLSRLKIGRGE-PKDIAVIRDGIRSGINILNLF---LKNDL-PEELRGAVEKLKKLPQSLEKTLSSMLSDDLP-TFKR  448 (920)
Q Consensus       375 eRll~ri~~~~~~-p~dl~~L~~sl~~~~~i~~~l---~~~~~-~~~l~~~~~~l~~l~~~l~~~l~~~i~~~~~-~~~~  448 (920)
                      ||+|.|++.+..+ ++++..+...|.....+...+   ..... ......+.+.+..++ ++...|........- ...+
T Consensus       624 ERlL~Rih~~~~~~~k~i~~f~rvLegfk~~~~~~~~~~~v~~~~~~~~~is~~~~~~p-~~~~~i~~~~~af~r~~a~~  702 (1125)
T KOG0217         624 ERLLVRIHNGGEKNKKKIADFIRVLEGFKEINKLLGSLINVLKEGEGLRLISELLESMP-NLSEEIENWTEAFDRVKAVK  702 (1125)
T ss_pred             HHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC-HHHHHHHHHHHHHHHHHHHH
T ss_conf             99999997047641357999999999999999999999999886678889998746750-03578999999987777754


Q ss_pred             CCCEE-CCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCEEEEEECCHHHHHCCCCCCCCCCEEEEE
Q ss_conf             46010-16854114557998863899999776877887388751102558622376204114333441116876527985
Q gi|254780750|r  449 DGGFL-RDGADASLDETRSLRDQSKRIIASLQLKYAEETKIKNLKIKHNNNLGYFIEVTSSSASVLKKDLESKDRFIHRQ  527 (920)
Q Consensus       449 ~~~~i-k~g~d~eLD~lr~~~~~~~~~l~~l~~~~~~~~~i~sLki~~n~~~gy~iEV~~~~~~~i~~~~~~~~~~i~~q  527 (920)
                      ++.|+ ..|+|.++|+..+..++..+.+.++...++.+.+++++.+....+.-|++|||.+-...++      ..|+..+
T Consensus       703 eg~i~P~~Gfd~eyD~a~k~~~e~e~~L~~~L~~~rk~l~c~si~~~~vGk~~y~lEvP~n~~~~s~------~~~~~~S  776 (1125)
T KOG0217         703 EGVIVPLEGFDEEYDEAMKRVDEAENELLAYLEEYRKRLGCSSIVFVDVGKDVYQLEVPENGGVPSS------LRYELMS  776 (1125)
T ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCEEEEEECCCCCCCCCC------HHHHHHH
T ss_conf             2752778665277887766788899999999999987517883267633754799963765687783------6899987


Q ss_pred             ECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHC--CCCCEE
Q ss_conf             212000111345666433464377777643344788876543011257988889998677887788877525--885121
Q gi|254780750|r  528 TMSNLTRFTTLELIDLENRITNATNSALLIELESFEILSNAIIEQSESLDNASQVIAIIDISIALAILAKEQ--NYCRPI  605 (920)
Q Consensus       528 t~~~~~Rf~t~eL~~l~~~i~~~~~~~~~~e~~~~~~l~~~i~~~~~~l~~~~~~ia~lD~l~SlA~~a~~~--~y~rP~  605 (920)
                      +.++..||.+|++..+...+.+++++........-++++.++..++..|+..+.++|.|||++|+|.+|...  ++|||+
T Consensus       777 ~~Kg~~RY~tp~~~kli~~l~~aee~~~~~~~d~~~r~~~~f~~~~~~w~~tv~~~a~iD~l~sla~~s~~~~~~~Crp~  856 (1125)
T KOG0217         777 AKKGVSRYYTPDLRKLIAHLDEAEERKKSSLSDLKRRLIVRFDEHYIIWQATVKALASIDCLLSLAETSKGLGGPMCRPE  856 (1125)
T ss_pred             HHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCE
T ss_conf             53273324687799999999999999987777889999998632379999999999988999877776503798753524


Q ss_pred             CCC---C-CCEEECCCCCHHHHHHHHHCCCCCEEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCC
Q ss_conf             047---8-714000046805887631028770444345635877776643999967784407899999999999997198
Q gi|254780750|r  606 IDN---S-TNFIVKDGRHPIVEKTLKQQSSKPFIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGS  681 (920)
Q Consensus       606 i~~---~-~~l~i~~gRHPviE~~l~~~~~~~fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~  681 (920)
                      +.+   . +.+.++.+||||+-...   .+..|||||+.+|..   ...++.++||||||||||+|||+|++||||||||
T Consensus       857 i~~~~dt~~~l~~~~~~Hpcfsl~s---~~~~fipN~v~~g~~---~e~~~~llTGpNmgGKSTllRq~c~~vilaq~G~  930 (1125)
T KOG0217         857 IVESTDTPGFLIVKGLRHPCFSLPS---TGTSFIPNDVELGGA---EENREGLLTGPNMGGKSTLLRQACIAVILAQIGC  930 (1125)
T ss_pred             EECCCCCCCEEEEECCCCCEEECCC---CCCCCCCCHHHCCCC---CCCEEEEECCCCCCCCHHHHHHHHHHHHHHHHCC
T ss_conf             6414688861688426672462376---777645632220555---4320223206875772489999999999998578


Q ss_pred             CCCHHHCCCCCCCEEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             53035320682210567652376611385328999999999999589985699932588988056799999999999972
Q gi|254780750|r  682 YVPASYAHIGIVDKLFSRVGSADNLASGRSTFMVEMIETASILNQATNQSFVILDEIGRGTATLDGLSIAWATIEYLHET  761 (920)
Q Consensus       682 fVPA~~a~i~~~D~IftRiGa~D~l~~g~STF~vEm~e~~~IL~~at~~SLVllDElGrGTst~DG~aiA~aile~l~~~  761 (920)
                      +|||+.|+++|+|+||||+||+|+|..|+||||+|+.||+.||++||++|||++||+||||||+||.|||.||+|||...
T Consensus       931 ~VPa~~~~~tpidrI~tRlGA~D~im~g~STF~vELsET~~IL~~aT~~SLvi~DELGRGtst~DG~aIA~aVLe~l~~~ 1010 (1125)
T KOG0217         931 DVPAEVMELTPIDRIFTRLGANDDIMSGESTFFVELSETKKILKHATRHSLVIVDELGRGTSTFDGTAIAEAVLEHLSEG 1010 (1125)
T ss_pred             CCCHHHHCCCCHHHHHHHCCCCCCHHCCCCEEEEECCCHHHHHHHCCCCCEEEEHHHCCCCCCCCCCCHHHHHHHHHHHC
T ss_conf             76588860661677766406653000377528986044387874337652232123237642558742189999999846


Q ss_pred             CCCEEEEECCCHHHHHHHHHCCCEEEEEEEEEEECC-EEEEEEEEEECCCCCCHHHHHHHHCCCCHHHHHHHHHHHHHHH
Q ss_conf             698499974875797664306885899999996099-2778777744789887789999982999899999999999998
Q gi|254780750|r  762 NRCRGLLATHFHELTDLSKSLKRFHNATLQVSDSNE-GIIFLHKVIPGIADHSYGIQVGKLAGLPNTVISRAYDILKTFE  840 (920)
Q Consensus       762 ~~~~~lfaTHy~eL~~l~~~~~~v~n~~~~~~~~~~-~i~flykl~~G~~~~Sygi~vA~laG~p~~vi~~A~~~~~~le  840 (920)
                      ++|+++|+||||.|+.....+|.|++.||.....+. ++|||||+.+|+|++|||++||||||+|..||++|...+.+||
T Consensus      1011 i~c~~fFSTHYhsl~~~~~~~p~Vrl~~Ma~~vd~e~~vtFLYkl~~G~cpkSyG~~vArmaglp~~vi~~a~~~a~E~e 1090 (1125)
T KOG0217        1011 IQCLGFFSTHYHSLCVDFMHHPQVRLLHMACVVDEEIDVTFLYKLEEGICPKSYGFNVARMAGLPDQVIDRAEIKAHELE 1090 (1125)
T ss_pred             CCCCCCCCCCCCCHHHHHHCCCCCCCHHHEEEECCCCCEEEEEHHCCCCCCCCHHHHHHHHCCCCHHHHHHHHHHHHHHH
T ss_conf             63227764342303376624843000011135437750798601104789720668999865985999999999999999


Q ss_pred             HHHH
Q ss_conf             7630
Q gi|254780750|r  841 KLYH  844 (920)
Q Consensus       841 ~~~~  844 (920)
                      +...
T Consensus      1091 ~~~~ 1094 (1125)
T KOG0217        1091 KSSA 1094 (1125)
T ss_pred             HHHH
T ss_conf             8777


No 6  
>KOG0219 consensus
Probab=100.00  E-value=0  Score=970.25  Aligned_cols=787  Identities=26%  Similarity=0.406  Sum_probs=637.7

Q ss_pred             CHHHHHHHHH-HHH--CCCCEEEEEECCCHHHHHHHHHHHHHHHCCEEECCC---CCCCCCCCCCCCCHHHHHHHHHHH-
Q ss_conf             9168999999-987--799299998088222007999999986181891078---899888762656176699999999-
Q gi|254780750|r   26 TPMMRQYIEI-KSI--NPDSLVFYRMGDFYELFFDDALLASRCLGITLTKRG---KHLGKDIPMCGVPVHTANHYIQKL-   98 (920)
Q Consensus        26 TP~~~Qy~~i-K~~--~~D~il~fr~G~FYE~f~~DA~~aa~~L~i~lt~r~---~~~~~~~pmaGvP~~~l~~yl~~L-   98 (920)
                      +-+++-|..+ +..  -.++|-||..|+||-.||+||..+|+.---+-.-.+   -...+++-.+.+--..++..++-| 
T Consensus        13 ~~~~~~f~~f~~~l~~p~~tvr~fdrge~ytv~geDa~~va~~v~kt~~~~k~l~~~~~~~~~~v~ls~~~~e~~vr~~l   92 (902)
T KOG0219          13 EAADRNFLKFYEGLPKPTTTVRFFDRGEYYTVHGEDAEFVARNVYKTQAVIKTLSPDNAKNTKEVSLSKGNFEKVVRELL   92 (902)
T ss_pred             CHHHHHHHHHHHCCCCCCCEEEEECCCCEEEEECCCHHHHHHHHHHHHHHHEECCCCCCCCCEEEEECHHHHHHHHHHHH
T ss_conf             06678999998448998765899427625899566233456555310333001477553343489864777999999999


Q ss_pred             HHCCCEEEEEEECCCHHHHHHCCCCCCEEEEEEEEECCCCEEC-CHHCCCCCC-----CEEEEEE---ECCCEEEEEEEE
Q ss_conf             9889859999502897887412899845545899977530302-010387877-----3699999---529849999999
Q gi|254780750|r   99 IKIGHRIAICEQIESPLEAKKRGNKSLVRRNVVRLVTPGTLTE-DQLLSPTDS-----NYLMAVA---RIRTEWAIAWID  169 (920)
Q Consensus        99 v~~GykVaiveQ~E~p~~~~~~~~~~~v~R~Vt~IiTpGT~~d-~~~l~~~~~-----nyL~aI~---~~~~~~Gia~iD  169 (920)
                      +..+|+|-+.+--+        +...+++|+     +||...+ ++++..+..     -|+.-.+   .+...+|+|++|
T Consensus        93 ~~~~~~Ve~y~~~~--------~~w~l~~~~-----sPGN~~~fedll~~~~~v~is~~~~~v~~~~~~~~~~vgv~~~d  159 (902)
T KOG0219          93 LVLRYRVEVYSSNQ--------GDWKLTKRG-----SPGNLVQFEDLLFSNNDVPISIISLIVKHPGVDGQRRVGVAFVD  159 (902)
T ss_pred             HHHCCCEEEEECCC--------CCEEEEECC-----CCCCHHHHHHHHCCCCCCHHHHHHEEEEEECCCCCCEEEEEEEC
T ss_conf             87502068963476--------640677537-----99968999999713543213101025775224787346799704


Q ss_pred             CCCCEEEEEECCHH----HHHHHHHHCCCCEEEEECCCCCH--HHHHHHHHHCCCCEECCCCCCCCHHHHHHHHHHHCCC
Q ss_conf             78655999605878----99999852298579970776896--7899887423881571852114713447889987087
Q gi|254780750|r  170 ISTGIFKISTSNHD----RLISDIMRIDPREIIFSEKELSH--AEYKSLFETLGNVAVAQPNVFFDHSISESRIADYYNI  243 (920)
Q Consensus       170 isTG~~~~~~~~~d----~l~~~L~~l~P~EIii~~~~~~~--~~~~~l~~~~~~~~~~~~~~~f~~~~~~~~l~~~~~~  243 (920)
                      .+--.+.+++|-++    +++..+..+.|+|+|++.+....  .....+++..+...+......|........+...+..
T Consensus       160 ~~~~k~~~~ef~Dn~~~snle~~l~~lg~kEcll~~~~~~~~~~kl~~~~~r~g~~~t~~~~~e~~~kdv~~~l~~~l~~  239 (902)
T KOG0219         160 TINVKIGLSEFVDDDSFSNLEALLIQLGPKECVLPEGSVAGEMKKLRNIIDRCGVLITLRKKSESSWKDVEQDLNRLLKS  239 (902)
T ss_pred             HHHEEEEHHHHCCCHHHHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHHHCCCC
T ss_conf             04604412240573878799999986197379801766406788999898426748887406402477899998753012


Q ss_pred             CC--CCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCEEEECCHHHCCEEEEECCCC--CCCCHHHH-HH
Q ss_conf             86--421024443468887777643687411222222113445745401425133201545412787--76412787-63
Q gi|254780750|r  244 TT--VDTFGSFSQVEKTAAAAAISYIKKTQMVNKPTIGYPEREDIQSTLFIDSAARSNLEILRTLSG--SREQSLLK-TI  318 (920)
Q Consensus       244 ~~--l~~~~~~~~~~~~a~~all~Yl~~~~~~~~~~i~~~~~~~~~~~m~LD~~Tl~nLEI~~~~~g--~~~gSL~~-~L  318 (920)
                      ..  ..........+..++.+++.|+....-........+..++...+|.+|..|+++|++|+...+  ....+|.. +|
T Consensus       240 ~~~~~~~~e~~~q~a~~~~~~~i~yl~~~~e~~~s~~~ei~~~~~~~~m~ld~~av~alnlf~~~~~~~~~s~~L~~~~L  319 (902)
T KOG0219         240 QEHAAYLPELELQLAMSALSALIKYLDLENEYSNSGKYELTNHGLHQFMRLDSAAVRALNLFPLPYNNPEKSNNLALSLL  319 (902)
T ss_pred             HHHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEECCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHH
T ss_conf             02221563877699999999999998640540100047876334477756889999887535799887432124338998


Q ss_pred             CCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCHHHHHHHH-HHHHHHCCHHHHHHHHHHHHHCHHHHHHHHHH
Q ss_conf             01234337899998631002345678989999997402212588999-99752048344445677521000021206899
Q gi|254780750|r  319 DYSITGAGGRLFAERIASPLTDSTKINTRLDSINFFIQNPILINPIQ-KILKSSPDVPRSLSRLKIGRGEPKDIAVIRDG  397 (920)
Q Consensus       319 n~t~T~~G~RlLr~wL~~PL~d~~~I~~R~daVe~l~~~~~~~~~l~-~~L~~i~DleRll~ri~~~~~~p~dl~~L~~s  397 (920)
                      |||+|++|.|||++|+.+||+|+..|++|+|.|+.+..+...+..++ +.|..+|||-|+..|+.  +++-.|...+++.
T Consensus       320 N~c~t~~G~rll~~w~~qpL~~~~ri~~r~d~v~~l~~~~~~rq~L~~~lL~~~pdi~rl~~~l~--~~~L~d~~r~yq~  397 (902)
T KOG0219         320 NHCKTLQGERLLRQWLKQPLRDIDRINERHDLVEALVEDAEIRQKLRDDLLRRIPDISRLARRLM--KANLQDVNRIYQA  397 (902)
T ss_pred             HHCCCCCCHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHH--HCCHHHHHHHHHH
T ss_conf             64102202466635643125778889887656999985248899999987520724777512322--1206777888988


Q ss_pred             HHHHHHHHHHHHHCCC------CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEECCCCCCHHHHHHHHHHHH
Q ss_conf             9998655675430258------4577876765776789999999998543101221046010168541145579988638
Q gi|254780750|r  398 IRSGINILNLFLKNDL------PEELRGAVEKLKKLPQSLEKTLSSMLSDDLPTFKRDGGFLRDGADASLDETRSLRDQS  471 (920)
Q Consensus       398 l~~~~~i~~~l~~~~~------~~~l~~~~~~l~~l~~~l~~~l~~~i~~~~~~~~~~~~~ik~g~d~eLD~lr~~~~~~  471 (920)
                      ...++.+...+.+..-      ...+......+.++.+.++.    .++.+  .......+||..||++|-++|+..++.
T Consensus       398 ~~~l~~~~~~l~~~~~~~~~ll~~~l~~~~~~~~kf~~~ve~----t~D~d--a~ee~ey~VR~eFdeeL~eLrq~LdeL  471 (902)
T KOG0219         398 AKLLPTVVQVLISLSESHNRLLKSPLTEHLKKLEKFQEMVET----TVDLD--AEEENEYRVRVDFDEELQELREKLDEL  471 (902)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH----HHHHH--HHHCCCEEEECCCCHHHHHHHHHHHHH
T ss_conf             877688999888640156666650565643128999999998----73376--775473798446588899999999999


Q ss_pred             HHHHHHHHHHHHHHCCCCC---CCCCCCCCCEEEEEECCHHHHHCCCCCCCCCCEEEEEECCCCHHHHHHHHHHHHHHHH
Q ss_conf             9999977687788738875---1102558622376204114333441116876527985212000111345666433464
Q gi|254780750|r  472 KRIIASLQLKYAEETKIKN---LKIKHNNNLGYFIEVTSSSASVLKKDLESKDRFIHRQTMSNLTRFTTLELIDLENRIT  548 (920)
Q Consensus       472 ~~~l~~l~~~~~~~~~i~s---Lki~~n~~~gy~iEV~~~~~~~i~~~~~~~~~~i~~qt~~~~~Rf~t~eL~~l~~~i~  548 (920)
                      +..+.++..+....++...   ||...+..+||++.+|.+..+.+++    ..+|...+|.||+++|+|.+|..+++...
T Consensus       472 ~~~m~~~hkrv~~dl~~D~~kklkLe~~~~~G~~~RlTr~e~~~LR~----~k~y~eLstqK~GV~FTtk~L~slN~e~~  547 (902)
T KOG0219         472 ERKMEKLHKKVSADLGLDPKKQLKLENSAQFGWYFRVTRKEEKVLRK----KKNYTELSTQKGGVKFTTKKLSSLNDEFM  547 (902)
T ss_pred             HHHHHHHHHHHHHHCCCCCCCCEEEECCCHHHEEEEEEEHHHHHHHC----CCCCEEEEEEECCEEEEHHHHHHHHHHHH
T ss_conf             99999999998765078942010110300211000001206657630----58936999852768987415766678899


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHH--HCCCCCEECCCCC--CEEECCCCCHHHHH
Q ss_conf             3777776433447888765430112579888899986778877888775--2588512104787--14000046805887
Q gi|254780750|r  549 NATNSALLIELESFEILSNAIIEQSESLDNASQVIAIIDISIALAILAK--EQNYCRPIIDNST--NFIVKDGRHPIVEK  624 (920)
Q Consensus       549 ~~~~~~~~~e~~~~~~l~~~i~~~~~~l~~~~~~ia~lD~l~SlA~~a~--~~~y~rP~i~~~~--~l~i~~gRHPviE~  624 (920)
                      +.+.+....+.++.++++.....|.+.|..+.+.+|.|||+.|||.+|.  --+|+||.+.+.+  .+.++++||||+|.
T Consensus       548 ~~qk~Y~~~Q~~ivrevikia~tY~Ppleal~~vlAhLDv~~SFa~~st~a~~pYvRP~~l~~gs~rl~l~~~rHp~lE~  627 (902)
T KOG0219         548 SLQKEYDEAQNEIVREIIKIAATYTPPLEALNQVLAHLDVFVSFAHAATVAPIPYVRPKLLPLGSKRLELKQSRHPVLEG  627 (902)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHEEEHHHCCCCCCCCCCCCCCCCCHHHHHHHHCCCCHHHC
T ss_conf             98888999999999999999851488188999999877740010111256877753741255522688887425632012


Q ss_pred             HHHHCCCCCEEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHCCCCCCCEEEEEEECCC
Q ss_conf             63102877044434563587777664399996778440789999999999999719853035320682210567652376
Q gi|254780750|r  625 TLKQQSSKPFIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHIGIVDKLFSRVGSAD  704 (920)
Q Consensus       625 ~l~~~~~~~fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a~i~~~D~IftRiGa~D  704 (920)
                          |...+|||||+.+.    .+..+++|||||||||||||+||+|++++||||||||||++|.++++|.|+||+||+|
T Consensus       628 ----Qd~~~fIpNdv~le----~~~~~~~IiTGpNMGGKSTyir~~Gvi~lmAQIGcfVPce~A~i~IvD~Il~RVGA~D  699 (902)
T KOG0219         628 ----QDEIPFIPNDVVLE----KGKCRMLIITGPNMGGKSTYIRQVGVIVLMAQIGCFVPCESATISIVDGILTRVGAGD  699 (902)
T ss_pred             ----CCCCCCCCCCCCCC----CCCCEEEEEECCCCCCCCHHHHHHHHHHHHHHHCCCEEHHHCCCCHHHHHHHHHCCCH
T ss_conf             ----45677777754001----5775189985788676302121336999999818823565538760167876416441


Q ss_pred             CCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHCCC
Q ss_conf             61138532899999999999958998569993258898805679999999999997269849997487579766430688
Q gi|254780750|r  705 NLASGRSTFMVEMIETASILNQATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFHELTDLSKSLKR  784 (920)
Q Consensus       705 ~l~~g~STF~vEm~e~~~IL~~at~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~~l~~~~~~  784 (920)
                      ++++|.||||+||.||+.||+.||++|||++||+||||||+||.+|||||-||++.+++|++||||||||++.++..++.
T Consensus       700 ~q~kG~STFM~Emleta~Ilr~at~~SliiiDELGRGTSt~DGfgiAwai~ehi~~ki~cf~lfATHfhElt~lae~~~~  779 (902)
T KOG0219         700 SQLKGISTFMAEMLETASILRRATKNSLIIIDELGRGTSTYDGFGIAWAIAEHIATKIGCFCLFATHFHELTKLAEQLPT  779 (902)
T ss_pred             HHHCCHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCEECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             54323178999999999999856878289981367874300476178999999998875868778678888766531035


Q ss_pred             EEEEEEEEEEECCEEEEEEEEEECCCCCCHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHH
Q ss_conf             5899999996099277877774478988778999998299989999999999999876300
Q gi|254780750|r  785 FHNATLQVSDSNEGIIFLHKVIPGIADHSYGIQVGKLAGLPNTVISRAYDILKTFEKLYHH  845 (920)
Q Consensus       785 v~n~~~~~~~~~~~i~flykl~~G~~~~Sygi~vA~laG~p~~vi~~A~~~~~~le~~~~~  845 (920)
                      ++|.||.+..++++++.+|++.+|+|++||||+||++||||+.||+.|+..+.+||+....
T Consensus       780 vKn~h~~a~i~~~~~~llY~V~~Gv~d~SFGi~VA~~a~fp~~vie~A~~~~~ele~~~~~  840 (902)
T KOG0219         780 VKNLHVTAQIENDDITLLYKVFEGVCDQSFGIHVAELVGFPEHVIEMAKQKAEELEDELVI  840 (902)
T ss_pred             HHHHEEEEEECCCCHHHHHHHHCCCCCCCCHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             5310003676476301299885222257511467877189757799999999877787744


No 7  
>KOG0220 consensus
Probab=100.00  E-value=0  Score=817.65  Aligned_cols=772  Identities=24%  Similarity=0.344  Sum_probs=595.1

Q ss_pred             EEEEECCCHHHHHHCCCCCCEEEEEEEEECCCCEE---CCHHCCCCCCCEEEEEEECC----CEEEEEEEECCCCEEEEE
Q ss_conf             99950289788741289984554589997753030---20103878773699999529----849999999786559996
Q gi|254780750|r  106 AICEQIESPLEAKKRGNKSLVRRNVVRLVTPGTLT---EDQLLSPTDSNYLMAVARIR----TEWAIAWIDISTGIFKIS  178 (920)
Q Consensus       106 aiveQ~E~p~~~~~~~~~~~v~R~Vt~IiTpGT~~---d~~~l~~~~~nyL~aI~~~~----~~~Gia~iDisTG~~~~~  178 (920)
                      -+.+|+-.|.+.+..-+-+...|..++--+|.--.   ....+.+.....++++++.+    +.+|+|.+|..+|+.+++
T Consensus        56 ~~a~~t~~~q~~~s~~S~~~~qrs~~~~~a~sl~~sssn~s~~~~~~~~v~~~v~e~r~~~~~~Ig~~~~~~~~~q~~l~  135 (867)
T KOG0220          56 SSARDTNYPQTLKTPLSTGNPQRSGYKSWAPSLGYSSSNSSAISAHSPSVIVAVVEGRGLARGEIGMASIDLKNPQIILS  135 (867)
T ss_pred             HHHHHCCCCCCCCCCCCCCCCCHHHHHHCCCHHHCCCCCHHHHCCCCCCEEEEEEECCCCCCCEEEEEEECCCCCCEEHH
T ss_conf             14654156311257532235222245313524310344224423678753799874377566605899843889705343


Q ss_pred             ECCHHH----HHHHHHHCCCCEEEEECCCCCHHHHHHHH----HHCCCC-EECCCCCCCCHHHHHHHHHHHCCCCCCCCH
Q ss_conf             058789----99998522985799707768967899887----423881-571852114713447889987087864210
Q gi|254780750|r  179 TSNHDR----LISDIMRIDPREIIFSEKELSHAEYKSLF----ETLGNV-AVAQPNVFFDHSISESRIADYYNITTVDTF  249 (920)
Q Consensus       179 ~~~~d~----l~~~L~~l~P~EIii~~~~~~~~~~~~l~----~~~~~~-~~~~~~~~f~~~~~~~~l~~~~~~~~l~~~  249 (920)
                      +|-++.    +..-+.-+.|-||+++.+.......+.++    +..++. .......+|+...+.+.+.+++....--.+
T Consensus       136 ~f~dst~y~~v~~~l~i~s~~ei~i~~~~~a~~~skl~~~~~~e~~~~v~~~~~s~k~fns~~gl~~i~~~~~~~~s~vl  215 (867)
T KOG0220         136 QFADSTTYAKVITKLKILSPLEIIISNTACAVGNSKLLFTLITENFKNVNFTTISRKYFNSTKGLEYIEQLCIAEFSTVL  215 (867)
T ss_pred             HHHCCCHHHHHHHHHHCCCHHHEEECCCCCCCCHHHHHHHHHHHCCCCCCEEEHHHHHCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             55355056777867620571432403654453167899998760055522101566641824359999998745667999


Q ss_pred             H--HHHHHHHHHHHHHHHHHHHHHCCCC-CCCCCCCCCCCCCEEEECCHHHCCEEEEECCCCCCCCHHHHHHCCCCCCHH
Q ss_conf             2--4443468887777643687411222-222113445745401425133201545412787764127876301234337
Q gi|254780750|r  250 G--SFSQVEKTAAAAAISYIKKTQMVNK-PTIGYPEREDIQSTLFIDSAARSNLEILRTLSGSREQSLLKTIDYSITGAG  326 (920)
Q Consensus       250 ~--~~~~~~~~a~~all~Yl~~~~~~~~-~~i~~~~~~~~~~~m~LD~~Tl~nLEI~~~~~g~~~gSL~~~Ln~t~T~~G  326 (920)
                      +  .....+++|+++++.|+.+++..-. +.-..+.+....+.+.||..+.++|||+.+..-....+|++++|+|.|++|
T Consensus       216 e~i~~k~~al~a~a~llky~~~~~~~~~~~~slri~~~gs~nT~~id~~~~~~lelV~~~~~kn~~~l~~vl~~T~t~~g  295 (867)
T KOG0220         216 EEIQSKTYALGAAAALLKYVEEIQSSVYAPKSLRICFQGSENTAMIDSSSAQSLELVINNQYKNNHTLFGVLNYTKTPGG  295 (867)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEEECCCCEEEEECCCCCCEEEECHHHHHCCCCEEEEEEEEECCCC
T ss_conf             99999999999999999999998876401000477751245335641146563487562454133320231310104540


Q ss_pred             HHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCHHHHHHHHHHH----HH-----CHHHHHHHHHH
Q ss_conf             8999986310023456789899999974022125889999975204834444567752----10-----00021206899
Q gi|254780750|r  327 GRLFAERIASPLTDSTKINTRLDSINFFIQNPILINPIQKILKSSPDVPRSLSRLKIG----RG-----EPKDIAVIRDG  397 (920)
Q Consensus       327 ~RlLr~wL~~PL~d~~~I~~R~daVe~l~~~~~~~~~l~~~L~~i~DleRll~ri~~~----~~-----~p~dl~~L~~s  397 (920)
                      .|.||..+++||+|...|+.|+++++++..++.+...++..+++.+|+++++++..--    .+     ....+..+..+
T Consensus       296 ~r~lRssilqpl~d~~ti~~rleaiqeL~a~~~L~~~Lr~~~k~~~dld~~~s~~~~~~~~~~i~~~~s~I~~~~~Lk~t  375 (867)
T KOG0220         296 YRRLRSSILQPLTDIETINMRLEAIQELLADEELFFGLRSVIKRFLDLDQLLSVLVQIPTQDTVNAAESKINNLIYLKHT  375 (867)
T ss_pred             HHHHHHHHCCCCCCHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHH
T ss_conf             36677641044520203467999999875283576542788752143789999998653677643226678899998888


Q ss_pred             HHHHHHHHHHHHHCCCCHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHH-------HHHCCCCEECCCCCCHHHHHHHHHH
Q ss_conf             9998655675430258457787676577-6789999999998543101-------2210460101685411455799886
Q gi|254780750|r  398 IRSGINILNLFLKNDLPEELRGAVEKLK-KLPQSLEKTLSSMLSDDLP-------TFKRDGGFLRDGADASLDETRSLRD  469 (920)
Q Consensus       398 l~~~~~i~~~l~~~~~~~~l~~~~~~l~-~l~~~l~~~l~~~i~~~~~-------~~~~~~~~ik~g~d~eLD~lr~~~~  469 (920)
                      +..+..+...+.... ...+....+.+. +-...+.+.+...|+++.-       ...+....+|.+++.-||..|..+.
T Consensus       376 L~lv~~~~~al~~~~-s~~~~e~~~~~~~~r~~~i~~~i~e~I~dd~l~a~~~l~~~~qkcyAvks~i~~~LDiaR~ty~  454 (867)
T KOG0220         376 LELVDPLKIALKNCN-SNLLREYYGSFKDKRFGIILEKIKEVINDDALYAKGCLNLRTQKCYAVKSNINGFLDIARRTYT  454 (867)
T ss_pred             HHHHHHHHHHHHHCH-HHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHCCCHHHHHCCCEEEECCCCCHHHHHHHHHHH
T ss_conf             988988999986020-5789999977444278999878887752787733310554035345421363089999999999


Q ss_pred             HHHHHHHHHHHHHHHHCCCCCCCCCCCCCCEEEEEECCHHHHHCCCCCCCCCCEEEEEECCCCHHHHHHHHHHHHHHHHH
Q ss_conf             38999997768778873887511025586223762041143334411168765279852120001113456664334643
Q gi|254780750|r  470 QSKRIIASLQLKYAEETKIKNLKIKHNNNLGYFIEVTSSSASVLKKDLESKDRFIHRQTMSNLTRFTTLELIDLENRITN  549 (920)
Q Consensus       470 ~~~~~l~~l~~~~~~~~~i~sLki~~n~~~gy~iEV~~~~~~~i~~~~~~~~~~i~~qt~~~~~Rf~t~eL~~l~~~i~~  549 (920)
                      +..+...+...++.+.. ..+++..|+...||++.++..... ++. ...|+.|+.....++..+|++..+.+++.++.+
T Consensus       455 ei~~~~~~~i~~l~E~~-~~nl~~~f~sarGF~~ri~~~~~~-~~~-~~lP~~fi~~~~~~~~~~~~s~~~ik~N~Rlk~  531 (867)
T KOG0220         455 EIVDDIAGMISQLGEKF-SLNLRLSFSSARGFFIRITTDCIA-LPS-DTLPSEFIKISKVKNSYSFTSADLIKMNERLKE  531 (867)
T ss_pred             HHHHHHHHHHHHHHHHC-CCCCCCCCCCCCCEEEEEECCCCC-CCC-CCCCHHHHHHHHHCCEEEECHHHHHHHHHHHHH
T ss_conf             99999999999988624-854103566445179995034202-431-247556642343234255214888887799999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEECCCCCCEEECCCCCHHHHHHHHHC
Q ss_conf             77777643344788876543011257988889998677887788877525885121047871400004680588763102
Q gi|254780750|r  550 ATNSALLIELESFEILSNAIIEQSESLDNASQVIAIIDISIALAILAKEQNYCRPIIDNSTNFIVKDGRHPIVEKTLKQQ  629 (920)
Q Consensus       550 ~~~~~~~~e~~~~~~l~~~i~~~~~~l~~~~~~ia~lD~l~SlA~~a~~~~y~rP~i~~~~~l~i~~gRHPviE~~l~~~  629 (920)
                      ...++......+...+...+..+.+.+..++++++.||+++|||......+||||+|+++  +.|++||||++|....  
T Consensus       532 ~~~E~~l~te~~v~~lld~i~~~I~~L~~iae~~~~lD~l~sfa~~~~~~~y~~P~fT~s--laI~qGRHPILe~i~~--  607 (867)
T KOG0220         532 VLREIFLMTEMIVCKLLDEIYEHISCLYKLAEAVSMLDMLCSFAHACTLSDYVRPEFTDS--LAIKQGRHPILEKISA--  607 (867)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCC--EEECCCCCCHHHHHCC--
T ss_conf             999899999999999999998767889999999999999988887501225556666886--0233678730454402--


Q ss_pred             CCCCEEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHCCCCCCCEEEEEEECCCCCCCC
Q ss_conf             87704443456358777766439999677844078999999999999971985303532068221056765237661138
Q gi|254780750|r  630 SSKPFIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHIGIVDKLFSRVGSADNLASG  709 (920)
Q Consensus       630 ~~~~fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a~i~~~D~IftRiGa~D~l~~g  709 (920)
                        +.+|.||+.+.     .+.+++|||||||+||||||||||+++|||||||||||.+|.+|+|+|||||||..|+|..+
T Consensus       608 --ek~i~N~t~~t-----~~s~f~IITGPNMsGKSTYLKQvAl~~IMAQIGc~IPA~YaS~pIf~RIFtRmg~nDele~N  680 (867)
T KOG0220         608 --EKPIANNTYVT-----EGSNFLIITGPNMSGKSTYLKQVALCQIMAQIGSYVPAEYASFRVFKRIFTRMGTNDELERN  680 (867)
T ss_pred             --CCCCCCCCEEE-----CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCHHHCCCHHHHHHHHHHCCCHHHHHC
T ss_conf             --47666752131-----26623788779877614999999999999986267641102125899998874574455514


Q ss_pred             CCHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHCCCEEEEE
Q ss_conf             53289999999999995899856999325889880567999999999999726984999748757976643068858999
Q gi|254780750|r  710 RSTFMVEMIETASILNQATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFHELTDLSKSLKRFHNAT  789 (920)
Q Consensus       710 ~STF~vEm~e~~~IL~~at~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~~l~~~~~~v~n~~  789 (920)
                      .||||.||.|+|.|+++|+.+|||+||||||||||.||+||+|||+|||+.. ++.|+|||||.+|+.++.-+|.|.|+|
T Consensus       681 sS~F~sEMke~A~Ilq~a~~~SLiVlDELgR~TSteeGiaityAvCE~lL~L-kayTflATHFldIa~lan~~paVdnlH  759 (867)
T KOG0220         681 SSTFMSEMKEAAYILQNANKNSLIVLDELGRGTSTEEGIAITYAVCEYLLSL-KAYTFLATHFLDIAAIANYYPAVDNLH  759 (867)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCEEEEHHHCCCCCCCCCHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHCCCCCCCEE
T ss_conf             4678998998999997377672797765216776100044589999999876-576889998877999963374421025


Q ss_pred             EEEEEECCEEEE-EEEEEECCC-CCCHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHCCC
Q ss_conf             999960992778-777744789-887789999982999899999999999998763000111121111100001120035
Q gi|254780750|r  790 LQVSDSNEGIIF-LHKVIPGIA-DHSYGIQVGKLAGLPNTVISRAYDILKTFEKLYHHNQKDMRLYYPEIQTKESKNNLS  867 (920)
Q Consensus       790 ~~~~~~~~~i~f-lykl~~G~~-~~Sygi~vA~laG~p~~vi~~A~~~~~~le~~~~~~~~~~~~~~~~~~~~~~~~~~~  867 (920)
                      |.++-.++...| .|||..|.. +.-||+++|++.-+|.+|++.|+.+..++-+.....+++...    .+.+..-..  
T Consensus       760 F~~q~~eNssk~~k~kLsrg~~~~~~yG~~~vE~s~iPd~i~e~a~~~~t~i~A~v~~~~rd~~~----~~rq~~Vy~--  833 (867)
T KOG0220         760 FLVQTDENSSKNKKYKLSRGLTEEKNYGLKAAEVSSLPDSIVEDAKEITTQITAQILQNQRDTPE----MERQRAVYH--  833 (867)
T ss_pred             EEEEECCCCHHHHHHHHHHHHHHCCCCCCEEEEEECCCHHHHHHHHHHHHHHHHHHHHHCCCCHH----HHHHHHHHH--
T ss_conf             53453355105656664122330545561478875187899986567899999988751457668----888999999--


Q ss_pred             CCHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             47389999986078222798999999999999986521
Q gi|254780750|r  868 KNDKLFVEKIKCLNLDEMSPLTALKTLYAVKAWTLEKY  905 (920)
Q Consensus       868 ~~~~~~~~~~~~~~~~~~~p~~al~~l~~lk~~~~~~~  905 (920)
                           ..+.+.+..-+. .|.+|+.+|.+|++.+.|+-
T Consensus       834 -----~a~~~~~t~gn~-~e~~~~~klk~l~k~~ve~~  865 (867)
T KOG0220         834 -----LATRLVQTAGNS-DEDSLRIKLKNLKKKYKEDF  865 (867)
T ss_pred             -----HHHHHHHHHCCC-CCHHHHHHHHHHHHHHHHHC
T ss_conf             -----999999860777-76789999999999998661


No 8  
>PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed
Probab=100.00  E-value=0  Score=726.06  Aligned_cols=502  Identities=21%  Similarity=0.321  Sum_probs=430.1

Q ss_pred             ECCHHHCCEEEEECCCCCCCCHHHHHHCCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHH
Q ss_conf             25133201545412787764127876301234337899998631002345678989999997402212588999997520
Q gi|254780750|r  292 IDSAARSNLEILRTLSGSREQSLLKTIDYSITGAGGRLFAERIASPLTDSTKINTRLDSINFFIQNPILINPIQKILKSS  371 (920)
Q Consensus       292 LD~~Tl~nLEI~~~~~g~~~gSL~~~Ln~t~T~~G~RlLr~wL~~PL~d~~~I~~R~daVe~l~~~~~~~~~l~~~L~~i  371 (920)
                      |+..|++.||.-.        =+=.+.++|.|++|+++++.  ++|+.|.++|+.|++.++++.+-....  -.-.+.++
T Consensus         2 m~~~~l~~Lef~~--------i~~~l~~~~~t~~Gk~~l~~--L~P~~~~~~i~~~l~~t~E~~~l~~~~--~~~pl~~i   69 (780)
T PRK00409          2 MNEETLRVLEFNK--------IKEQLKTFAATKLGKEKVED--LKPLTSFEEVKEHLEETDEAAKILRLK--GFPPFEGV   69 (780)
T ss_pred             CCHHHHHHCCHHH--------HHHHHHHHCCCHHHHHHHHC--CCCCCCHHHHHHHHHHHHHHHHHHHHC--CCCCCCCC
T ss_conf             4767888659899--------99999717589999999976--899899999999999999999999707--99996785


Q ss_pred             CCHHHHHHHHHHH-HHCHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             4834444567752-100002120689999986556754302584577876765776789999999998543101221046
Q gi|254780750|r  372 PDVPRSLSRLKIG-RGEPKDIAVIRDGIRSGINILNLFLKNDLPEELRGAVEKLKKLPQSLEKTLSSMLSDDLPTFKRDG  450 (920)
Q Consensus       372 ~DleRll~ri~~~-~~~p~dl~~L~~sl~~~~~i~~~l~~~~~~~~l~~~~~~l~~l~~~l~~~l~~~i~~~~~~~~~~~  450 (920)
                      +|+++++.|+..| ..+|.+|..+...+..+..+...+......+.|..+...+..++ .+.+.|..++.        +.
T Consensus        70 ~Di~~~l~r~~~g~~L~~~EL~~i~~~L~~~~~lk~~l~~~~~~p~L~~l~~~l~~~~-~L~~~I~~~Id--------~~  140 (780)
T PRK00409         70 TDIDDALKRAEKGGVLSGDELLEIAKTLRYFRQLKRFIEDLEELPILEEWVAQIRTLP-ELEQEIHNCID--------EE  140 (780)
T ss_pred             HHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHCCCCH-HHHHHHHHHCC--------CC
T ss_conf             1379999998658978999999999999999999999865544456999998575868-99999998758--------99


Q ss_pred             CEECCCCCCHHHHHHHHHHHHHHHHHHHHHHHH-HHCCCCCCCC--CCCCCCEEEEEECCHHHHHCCCCCCCCCCEEEEE
Q ss_conf             010168541145579988638999997768778-8738875110--2558622376204114333441116876527985
Q gi|254780750|r  451 GFLRDGADASLDETRSLRDQSKRIIASLQLKYA-EETKIKNLKI--KHNNNLGYFIEVTSSSASVLKKDLESKDRFIHRQ  527 (920)
Q Consensus       451 ~~ik~g~d~eLD~lr~~~~~~~~~l~~l~~~~~-~~~~i~sLki--~~n~~~gy~iEV~~~~~~~i~~~~~~~~~~i~~q  527 (920)
                      |.|+++++++|+.+|......+..+.+...++. .....+.|.-  .......|+|.|.....+.+|       ++++.+
T Consensus       141 G~I~D~AS~eL~~IR~~i~~~~~~i~~~l~~~l~~~~~~~~Lqd~~it~R~gRyvlpVk~~~k~~v~-------GiVhd~  213 (780)
T PRK00409        141 GEVKDSASEKLRGIRRQLRRKNSRIREKLNRIVRSKSLQKYLQDTIITIRNDRYVLPVKAEYKHAIK-------GIVHDQ  213 (780)
T ss_pred             CEECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHCCEEEEECCEEEEEEEHHHCCCCC-------EEEEEE
T ss_conf             8288887989999999999999999999999985111124012342799999899996367627788-------189998


Q ss_pred             ECCCCHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEC
Q ss_conf             21200011134-56664334643777776433447888765430112579888899986778877888775258851210
Q gi|254780750|r  528 TMSNLTRFTTL-ELIDLENRITNATNSALLIELESFEILSNAIIEQSESLDNASQVIAIIDISIALAILAKEQNYCRPII  606 (920)
Q Consensus       528 t~~~~~Rf~t~-eL~~l~~~i~~~~~~~~~~e~~~~~~l~~~i~~~~~~l~~~~~~ia~lD~l~SlA~~a~~~~y~rP~i  606 (920)
                      |.++.+.|+.| +++++++++..+..+....+..++.+|...+..+.+.|....+.+++||+++|+|.+|..++|++|.+
T Consensus       214 S~SG~T~fIEP~~vveLnN~l~~L~~~e~~Ei~rIL~eLs~~v~~~~~~l~~~~~~l~~LD~~~AkA~~A~~~~~~~P~~  293 (780)
T PRK00409        214 SSSGATLYIEPQSVVELNNEIRELRNKEKEEIERILKELSAKVAKNLDFLKFLNKIFDTLDFIFARARYAKALKATFPLF  293 (780)
T ss_pred             CCCCCEEEECHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEE
T ss_conf             07998588552999988899999999999999999999999999879999999999999999999999999779863127


Q ss_pred             CCCCCEEECCCCCHHHHHHHHHCCCCCEEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHH
Q ss_conf             47871400004680588763102877044434563587777664399996778440789999999999999719853035
Q gi|254780750|r  607 DNSTNFIVKDGRHPIVEKTLKQQSSKPFIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPAS  686 (920)
Q Consensus       607 ~~~~~l~i~~gRHPviE~~l~~~~~~~fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~  686 (920)
                      ++++.|.++++|||+++.       ..+||||+.|+     .+.+++|||||||||||++|||+||+++|||+|+||||.
T Consensus       294 ~~~~~i~L~~aRHPLL~~-------~~vVP~di~l~-----~~~~~liITGPNtGGKTv~LKtvgL~~lMaq~Gl~vPa~  361 (780)
T PRK00409        294 NDEGKIDLRQARHPLLDG-------EKVVPKDIELG-----FDKTVLVITGPNTGGKTVTLKTLGLAALMAKSGLPIPAA  361 (780)
T ss_pred             CCCCEEEEEECCCCCCCC-------CCCCCCEEEEC-----CCCEEEEEECCCCCCCEEHHHHHHHHHHHHHHCCCCCCC
T ss_conf             799808986035776366-------77257347866-----984189996898888563799999999999829997516


Q ss_pred             H-CCCCCCCEEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCE
Q ss_conf             3-206822105676523766113853289999999999995899856999325889880567999999999999726984
Q gi|254780750|r  687 Y-AHIGIVDKLFSRVGSADNLASGRSTFMVEMIETASILNQATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCR  765 (920)
Q Consensus       687 ~-a~i~~~D~IftRiGa~D~l~~g~STF~vEm~e~~~IL~~at~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~  765 (920)
                      . +++|+||+||++||..+||.+++|||+.+|..++.||.+|+++|||||||||+||+|.+|.|||.||+|||.++ +|+
T Consensus       362 e~s~~~~f~~i~adIGD~QSie~~LSTFS~hm~~i~~il~~a~~~sLVLlDElG~GTDP~EGaALa~aile~l~~~-~~~  440 (780)
T PRK00409        362 EPSEIPVFKEVFADIGDEQSIEQSLSTFSGHMTNIVRILEKADENSLVLFDELGAGTDPDEGAALAISILDYLRKR-GAK  440 (780)
T ss_pred             CCCCCCCCCEEEEEECCCHHHHHCHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCHHHHHHHHHHHHHHHHHC-CCE
T ss_conf             8980423463899827712133265249999999999997389980881232358998456599999999999977-997


Q ss_pred             EEEECCCHHHHHHHHHCCCEEEEEEEEEEECCEEEEEEEEEECCCCCCHHHHHHHHCCCCHHHHHHHHHHH
Q ss_conf             99974875797664306885899999996099277877774478988778999998299989999999999
Q gi|254780750|r  766 GLLATHFHELTDLSKSLKRFHNATLQVSDSNEGIIFLHKVIPGIADHSYGIQVGKLAGLPNTVISRAYDIL  836 (920)
Q Consensus       766 ~lfaTHy~eL~~l~~~~~~v~n~~~~~~~~~~~i~flykl~~G~~~~Sygi~vA~laG~p~~vi~~A~~~~  836 (920)
                      ++++|||.+|+.++...+++.|++|++|.+.  +..+|+|..|++++||+++||+..|||++||++|++.+
T Consensus       441 ~i~TTH~~~lK~~a~~~~~~~nas~~FD~~t--l~PtYrl~~G~pG~S~A~~IA~rlGlp~~ii~~A~~~l  509 (780)
T PRK00409        441 IIATTHYKELKALKYNREGVENASVEFDEET--LRPTYRLLIGIPGRSNAFEIAKRLGLPPNIIEEAKKVY  509 (780)
T ss_pred             EEEECCHHHHHHHHHCCCCCEEEEEEECCCC--CCCCEEEECCCCCCCHHHHHHHHHCCCHHHHHHHHHHH
T ss_conf             9994776999999727998189888874023--78606870599976369999999297999999999885


No 9  
>KOG0221 consensus
Probab=100.00  E-value=0  Score=729.38  Aligned_cols=710  Identities=23%  Similarity=0.344  Sum_probs=529.4

Q ss_pred             CEEEEEEECCCEEEEEEEECCCCEEEEEECC-HHHHH----HHHHHCCCCEEEEECCCCCHHHHHHHH--HHCCCCEECC
Q ss_conf             3699999529849999999786559996058-78999----998522985799707768967899887--4238815718
Q gi|254780750|r  151 NYLMAVARIRTEWAIAWIDISTGIFKISTSN-HDRLI----SDIMRIDPREIIFSEKELSHAEYKSLF--ETLGNVAVAQ  223 (920)
Q Consensus       151 nyL~aI~~~~~~~Gia~iDisTG~~~~~~~~-~d~l~----~~L~~l~P~EIii~~~~~~~~~~~~l~--~~~~~~~~~~  223 (920)
                      --.+||....+..|+|++|.|+.....-... +++-.    ..|--.+|.-++-+... .....+.+-  ..........
T Consensus        49 Eivlcv~f~~G~LG~ayyd~s~~tlk~m~d~~~~~~~~~l~r~ldd~~p~s~~~~~~q-d~~~i~fl~~~~s~~~vp~~~  127 (849)
T KOG0221          49 EIVLCVLFNSGYLGIAYYDTSDSTLKFMPDAPDHESLKLLQRVLDDINPQSVVTSAKQ-DENMIRFLGKLASQEHVPPKR  127 (849)
T ss_pred             HEEEEEEECCCEEEEEEEECCCHHHHHCCCCHHHHHHHHHHHHHHCCCCHHHHHHHHH-HHHHHHHHCCCCCCCCCCCCC
T ss_conf             1788987258711047630430577746785266677899887540375145656765-589999851478511378777


Q ss_pred             CCCCCCHHHH----------------------HHHHHHHCCCC--CCCCH-----------H-HHHHHHHHHHHHHHHHH
Q ss_conf             5211471344----------------------78899870878--64210-----------2-44434688877776436
Q gi|254780750|r  224 PNVFFDHSIS----------------------ESRIADYYNIT--TVDTF-----------G-SFSQVEKTAAAAAISYI  267 (920)
Q Consensus       224 ~~~~f~~~~~----------------------~~~l~~~~~~~--~l~~~-----------~-~~~~~~~~a~~all~Yl  267 (920)
                      +.|.|++...                      .....-+|..+  .-+.+           + ..-..+..+.++++.++
T Consensus       128 ~~~if~~~~t~~~ei~k~~~l~~~~~f~p~~l~~~~~~~f~~s~i~~D~l~t~~~~~~it~~~~~i~~~~r~~g~ll~fl  207 (849)
T KOG0221         128 PEIIFLPSVTFGLEISKQRLLSGNYSFIPDALTATEKILFLSSIIPFDCLLTEEDKYIITKMRFDIEAVVRALGGLLKFL  207 (849)
T ss_pred             CCEEECCCHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEECCCHHHHHHHHHHHHHHC
T ss_conf             44244352015777777775187312382877545776403035652010488885699863144499998611487653


Q ss_pred             HHHHCC-------CCCCCCCCCCCCCCCEEEECCHHHCCEEEEECCCC---CC----C-CHHHHHHCCCCCCHHHHHHHH
Q ss_conf             874112-------22222113445745401425133201545412787---76----4-127876301234337899998
Q gi|254780750|r  268 KKTQMV-------NKPTIGYPEREDIQSTLFIDSAARSNLEILRTLSG---SR----E-QSLLKTIDYSITGAGGRLFAE  332 (920)
Q Consensus       268 ~~~~~~-------~~~~i~~~~~~~~~~~m~LD~~Tl~nLEI~~~~~g---~~----~-gSL~~~Ln~t~T~~G~RlLr~  332 (920)
                      ..+...       ....|..++.+...+.|.||.+|++.|.||.+-+.   .+    . -|||+++|+|....|+|+||.
T Consensus       208 ~~~rigv~l~~~~v~~pI~gik~f~l~~lv~iD~nTisaL~Ifp~e~~~~~~k~~~~~g~Slf~l~n~c~s~~g~k~Lr~  287 (849)
T KOG0221         208 GRRRIGVELEDYNVSVPILGIKKFMLTHLVNIDQNTISALQIFPSESHPSKVKSGLKEGLSLFGLLNRCHSKWGEKLLRL  287 (849)
T ss_pred             CCCEEEEEECCCCCCCCCCCEEEEEECCEEEECCCHHHHHHHCCCCCCCCHHHHHHHCCHHHHHHHHHHHHHHHHHHHHH
T ss_conf             43413346325511121011158751232663422477877524355532124545232169999988756999999999


Q ss_pred             HHHHHCCCHHHHHHHHHHHHHHCC--CHHHHHHHHHHHHHHCCHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             631002345678989999997402--212588999997520483444456775210000212068999998655675430
Q gi|254780750|r  333 RIASPLTDSTKINTRLDSINFFIQ--NPILINPIQKILKSSPDVPRSLSRLKIGRGEPKDIAVIRDGIRSGINILNLFLK  410 (920)
Q Consensus       333 wL~~PL~d~~~I~~R~daVe~l~~--~~~~~~~l~~~L~~i~DleRll~ri~~~~~~p~dl~~L~~sl~~~~~i~~~l~~  410 (920)
                      |+.+|++|..+|..||++|.+|..  |.++...+...|++++|+--++.|+..|+++..+|-.++.++.+...+.+.+..
T Consensus       288 Wf~nPttd~~~l~sR~~~i~~fl~~qNa~~~~~Ls~~lgr~k~~~~~~~~~~sg~t~l~~W~~~~stv~~~~~i~~~~rs  367 (849)
T KOG0221         288 WFTNPTTDLGELSSRLDVIQFFLLPQNADMAQMLSRLLGRIKNVPLILKRMKSGHTKLSDWQVLYSTVYSALGIRDACRS  367 (849)
T ss_pred             HHCCCCCCHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHCCCHHHHHHHHHCCCCEECHHHHHHHHHHHHHHHHHHHHH
T ss_conf             82288873787888999999984612069999999998524337899999854775211389999999999999999974


Q ss_pred             CCCCHHHHHHHH--HHHHHHHHHHHHHHHHHHHHHHHHHCCCCEECCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCC-
Q ss_conf             258457787676--57767899999999985431012210460101685411455799886389999977687788738-
Q gi|254780750|r  411 NDLPEELRGAVE--KLKKLPQSLEKTLSSMLSDDLPTFKRDGGFLRDGADASLDETRSLRDQSKRIIASLQLKYAEETK-  487 (920)
Q Consensus       411 ~~~~~~l~~~~~--~l~~l~~~l~~~l~~~i~~~~~~~~~~~~~ik~g~d~eLD~lr~~~~~~~~~l~~l~~~~~~~~~-  487 (920)
                      ...+..+....+  .+.++ ..+...+...++-+ ........-+.+|+|++||+.|..+.+...++.+...++.+..+ 
T Consensus       368 lp~s~~~~~~~~~~~~~~l-~eia~~~g~vIdF~-~S~~~~r~Tv~~giD~elDE~r~~y~~lp~~Lt~vAr~e~~~L~~  445 (849)
T KOG0221         368 LPQSIQLFRDIAQEFSDDL-HEIASLIGKVIDFE-GSLAENRFTVLPGIDPELDEKRRRYMGLPSFLTEVARKELENLDS  445 (849)
T ss_pred             CCCCHHHHHHHHHHHHHHH-HHHHHHHHHEECCC-CCCCCCEEEECCCCCHHHHHHHHHHCCCHHHHHHHHHHHHHHHCC
T ss_conf             7431455667788889999-99999861102133-321136388548997678999999706508999999999986179


Q ss_pred             -CCCCCCCCCCCCEEEEEECCHHHHHCCCCCCCCCCEEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             -8751102558622376204114333441116876527985212000111345666433464377777643344788876
Q gi|254780750|r  488 -IKNLKIKHNNNLGYFIEVTSSSASVLKKDLESKDRFIHRQTMSNLTRFTTLELIDLENRITNATNSALLIELESFEILS  566 (920)
Q Consensus       488 -i~sLki~~n~~~gy~iEV~~~~~~~i~~~~~~~~~~i~~qt~~~~~Rf~t~eL~~l~~~i~~~~~~~~~~e~~~~~~l~  566 (920)
                       ++++.+.|.+..||++.||.--.-....++...-.++..  ..---+|.+...+++.+.+.+..-++..-|..+.-.|.
T Consensus       446 ~~psv~~VYIPliGfllsiprl~~~~~~~d~~~~~~~mf~--s~E~l~~rnart~eLD~~~GDIy~~i~D~et~i~~~Lq  523 (849)
T KOG0221         446 RIPSVSVVYIPLIGFLLSIPRLPSMVEASDFENGLDFMFL--SEEKLHYRNARTKELDALLGDIYCEIRDQETLIMYQLQ  523 (849)
T ss_pred             CCCCEEEEEEECEEEEEECCCCCCHHHCCCCCCCHHHHHC--CCCEEEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             9983369985020037853356415326782214477744--53005763340776888764688765136889999999


Q ss_pred             HHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEECCCCCC-EEECCCCCHHHHHHHHHCCCCCEEEEEEEECCCC
Q ss_conf             543011257988889998677887788877525885121047871-4000046805887631028770444345635877
Q gi|254780750|r  567 NAIIEQSESLDNASQVIAIIDISIALAILAKEQNYCRPIIDNSTN-FIVKDGRHPIVEKTLKQQSSKPFIANDCDLSCPN  645 (920)
Q Consensus       567 ~~i~~~~~~l~~~~~~ia~lD~l~SlA~~a~~~~y~rP~i~~~~~-l~i~~gRHPviE~~l~~~~~~~fVpNdi~l~~~~  645 (920)
                      .++......+-+.....++||+|+|||..|.++||.||.++++.. +.|.+||||.+|...     ..||||++..|   
T Consensus       524 ~qvl~rk~~lt~~l~laSrldvLls~a~~aa~~gy~~P~lv~e~~il~I~ngrh~l~e~~~-----dtfvPNst~ig---  595 (849)
T KOG0221         524 CQVLARKAVLTRVLDLASRLDVLLSLASAAADYGYSRPRLVPEVLILRIQNGRHPLMELCA-----DTFVPNSTEIG---  595 (849)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHCCCHHHHHHHH-----HHCCCCCEEEC---
T ss_conf             9999888789999888888999999998887639888735607889999707704999999-----73489860236---


Q ss_pred             CCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHCCCCCCCEEEEEEECCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             77664399996778440789999999999999719853035320682210567652376611385328999999999999
Q gi|254780750|r  646 DKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHIGIVDKLFSRVGSADNLASGRSTFMVEMIETASILN  725 (920)
Q Consensus       646 ~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a~i~~~D~IftRiGa~D~l~~g~STF~vEm~e~~~IL~  725 (920)
                       ++.+|+.||||||.+|||.||+||||+|.||||||||||+.|+||++|||||||++.|++..|+||||..+.+++..|+
T Consensus       596 -gdkgri~vITGpNasGKSiYlkqvglivfLahIGsFVPAe~A~IGivDrI~tri~s~esv~~gqSTFmiD~~Qva~aLr  674 (849)
T KOG0221         596 -GDKGRIKVITGPNASGKSIYLKQVGLIVFLAHIGSFVPAEEAEIGIVDRIFTRIHSCESVSLGQSTFMIDLNQVAKALR  674 (849)
T ss_pred             -CCCCEEEEEECCCCCCCEEEEEECHHHHHHHHHCCCCCHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             -9884499985898888557886203565797643666455533250899998862144554003588884999999998


Q ss_pred             HCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCC--EEEEECCCHHHHHHH--HHCCCEEEEEEEEE-EECCEEE
Q ss_conf             589985699932588988056799999999999972698--499974875797664--30688589999999-6099277
Q gi|254780750|r  726 QATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRC--RGLLATHFHELTDLS--KSLKRFHNATLQVS-DSNEGII  800 (920)
Q Consensus       726 ~at~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~--~~lfaTHy~eL~~l~--~~~~~v~n~~~~~~-~~~~~i~  800 (920)
                      +||.+||||+||+|+||.|.||.++-.+|+.|+..+..|  +.+.+||||+|-.+-  .+.+-+..+.|++. +..++|+
T Consensus       675 ~AT~~SLvlIDEfGKGT~tedGlsLlasvm~~w~~rg~~~PrifvcThfheL~ne~~L~~n~i~qfltm~vlr~~ge~I~  754 (849)
T KOG0221         675 NATAQSLVLIDEFGKGTNTEDGLSLLASVMRHWLARGPTCPRIFVCTHFHELVNEQLLPQNPIVQFLTMEVLREDGEDIV  754 (849)
T ss_pred             HHHCCCEEEEHHCCCCCCCCCCHHHHHHHHHHHHHCCCCCCEEEEECCHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCEE
T ss_conf             74037279873106876433118999999999983499997389830177751003477552666541999986068749


Q ss_pred             EEEEEEECCCCCCHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHCCCCCHHHHHHHHHCC
Q ss_conf             87777447898877899999829998999999999999987630001111211111000011200354738999998607
Q gi|254780750|r  801 FLHKVIPGIADHSYGIQVGKLAGLPNTVISRAYDILKTFEKLYHHNQKDMRLYYPEIQTKESKNNLSKNDKLFVEKIKCL  880 (920)
Q Consensus       801 flykl~~G~~~~Sygi~vA~laG~p~~vi~~A~~~~~~le~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  880 (920)
                      |+||+.+|.+..|||+++|+.+|+|++||.||+++++.++...........+...+.+          .-+..++++..+
T Consensus       755 flyrv~~gl~k~sfal~~ak~~glp~~vV~Ra~~v~~ai~sg~~vk~~k~~l~~~q~~----------~~q~~Vdkf~~l  824 (849)
T KOG0221         755 FLYRVCEGLAKASFALHTAKQAGLPDKVVARAKEVSDAIRSGKPVKPVKDLLKKNQME----------NCQTLVDKFMKL  824 (849)
T ss_pred             EEEEECCCHHHHCCCCHHHHHCCCCHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHH----------HHHHHHHHHHHH
T ss_conf             9987345265423221157662999799999999999997699704666554055789----------899999999874


Q ss_pred             CCCC
Q ss_conf             8222
Q gi|254780750|r  881 NLDE  884 (920)
Q Consensus       881 ~~~~  884 (920)
                      |++-
T Consensus       825 Dl~l  828 (849)
T KOG0221         825 DLEL  828 (849)
T ss_pred             CCCC
T ss_conf             1347


No 10 
>pfam00488 MutS_V MutS domain V. This domain is found in proteins of the MutS family (DNA mismatch repair proteins) and is found associated with pfam01624, pfam05188, pfam05192 and pfam05190. The mutS family of proteins is named after the Salmonella typhimurium MutS protein involved in mismatch repair; other members of the family included the eukaryotic MSH 1,2,3, 4,5 and 6 proteins. These have various roles in DNA repair and recombination. Human MSH has been implicated in non-polyposis colorectal carcinoma (HNPCC) and is a mismatch binding protein. The aligned region corresponds with domain V of Thermus aquaticus MutS, which contains a Walker A motif, and is structurally similar to the ATPase domain of ABC transporters.
Probab=100.00  E-value=0  Score=587.45  Aligned_cols=233  Identities=56%  Similarity=0.920  Sum_probs=223.7

Q ss_pred             CCCEECCCCCCEEECCCCCHHHHHHHHHCCCCCEEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCC
Q ss_conf             85121047871400004680588763102877044434563587777664399996778440789999999999999719
Q gi|254780750|r  601 YCRPIIDNSTNFIVKDGRHPIVEKTLKQQSSKPFIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMG  680 (920)
Q Consensus       601 y~rP~i~~~~~l~i~~gRHPviE~~l~~~~~~~fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG  680 (920)
                      ||||+|++++.+.|++||||++|...    ..+|||||+.|+.    +..+++||||||||||||||||+|++++|||+|
T Consensus         1 y~~P~~~~~~~l~i~~~rHPll~~~~----~~~~VpNdi~l~~----~~~~~~iiTGpN~sGKSt~Lk~igl~~~lAq~G   72 (234)
T pfam00488         1 YVRPEFTESDALHIEGGRHPVVEAVL----AENFVPNDVSLGK----ERSRILLITGPNMGGKSTYLRQVALIVIMAQIG   72 (234)
T ss_pred             CCCCEECCCCCEEEEECCCCEEECCC----CCCEECCEEEECC----CCEEEEEEECCCCCCCHHHHHHHHHHHHHHHHC
T ss_conf             97887858996899976687697257----9976876589779----961699997887776199999999999999836


Q ss_pred             CCCCHHHCCCCCCCEEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             85303532068221056765237661138532899999999999958998569993258898805679999999999997
Q gi|254780750|r  681 SYVPASYAHIGIVDKLFSRVGSADNLASGRSTFMVEMIETASILNQATNQSFVILDEIGRGTATLDGLSIAWATIEYLHE  760 (920)
Q Consensus       681 ~fVPA~~a~i~~~D~IftRiGa~D~l~~g~STF~vEm~e~~~IL~~at~~SLVllDElGrGTst~DG~aiA~aile~l~~  760 (920)
                      |||||++|++++||+||||||..||+.+|+|||+.||.+++.||+++|++||||+||+||||++.||.|||+|++|||.+
T Consensus        73 ~~VPA~~a~~~~~d~I~~~i~~~dsl~~~~StF~~e~~~~~~il~~~~~~sLvliDEl~~GT~~~eg~al~~aile~L~~  152 (234)
T pfam00488        73 SFVPAESARIGIVDRIFTRIGASDDLASGRSTFMVEMLETANILHNATDKSLVILDELGRGTSTYDGLAIAWAVAEHLAE  152 (234)
T ss_pred             CCEEECCEEEECCCEEEEEECCCCHHHCCCCHHHHHHHHHHHHHHHCCCCCEECCCCCCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             87422205996365599985675334466117999999999999738877322014245899834679999999999997


Q ss_pred             HCCCEEEEECCCHHHHHHHHHCCCEEEEEEEEEEECCEEEEEEEEEECCCCCCHHHHHHHHCCCCHHHHHHHHHHHHHHH
Q ss_conf             26984999748757976643068858999999960992778777744789887789999982999899999999999998
Q gi|254780750|r  761 TNRCRGLLATHFHELTDLSKSLKRFHNATLQVSDSNEGIIFLHKVIPGIADHSYGIQVGKLAGLPNTVISRAYDILKTFE  840 (920)
Q Consensus       761 ~~~~~~lfaTHy~eL~~l~~~~~~v~n~~~~~~~~~~~i~flykl~~G~~~~Sygi~vA~laG~p~~vi~~A~~~~~~le  840 (920)
                      +.+|+++||||||+|+++....+++.|+||++++.+++++|+|||.+|+++.|||++||+++|+|++||+||++++++||
T Consensus       153 ~~~~~~i~tTH~~~L~~l~~~~~~v~~~~m~~~~~~~~~~f~Ykl~~G~~~~s~ai~ia~~~G~p~~ii~rA~~i~~~le  232 (234)
T pfam00488       153 KIRARTLFATHYHELTKLAEKLPAVKNVHMAAVETNGDIVFLYKVKPGAADKSYGIHVAELAGLPESVVERAREVLAELE  232 (234)
T ss_pred             HCCCEEEEEECHHHHHHHHHHCCCCCCEEEEEEEECCEEEEEEEECCCCCCCCHHHHHHHHHCCCHHHHHHHHHHHHHHH
T ss_conf             35977999713577999987476444148999998997869999775899983999999991969999999999999986


Q ss_pred             H
Q ss_conf             7
Q gi|254780750|r  841 K  841 (920)
Q Consensus       841 ~  841 (920)
                      +
T Consensus       233 ~  233 (234)
T pfam00488       233 D  233 (234)
T ss_pred             C
T ss_conf             6


No 11 
>cd03285 ABC_MSH2_euk MutS2 homolog in eukaryotes.  The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch.  Members of the MutS family possess C-terminal domain with a conserved ATPase activity that belongs to the ATP binding cassette (ABC) superfamily.  MutS homologs (MSH) have been identified in most prokaryotic and all eukaryotic organisms examined.  Prokaryotes have two homologs (MutS1 and MutS2), whereas seven MSH proteins (MSH1 to MSH7) have been identified in eukaryotes.  The homodimer MutS1 and heterodimers MSH2-MSH3 and MSH2-MSH6 are primarily involved in mitotic mismatch repair, whereas MSH4-MSH5 is involved in resolution of Holliday junctions during meiosis.  All members of the MutS family contain the highly conserved Walker A/B ATPase domain, and many share a common mechanism of action.  MutS1, MSH2-MSH3, MSH2-MSH6, and MSH4-MSH5 dimerize to form sliding c
Probab=100.00  E-value=0  Score=563.04  Aligned_cols=220  Identities=45%  Similarity=0.754  Sum_probs=207.4

Q ss_pred             EECCCCCHHHHHHHHHCCCCCEEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHCCCCC
Q ss_conf             00004680588763102877044434563587777664399996778440789999999999999719853035320682
Q gi|254780750|r  613 IVKDGRHPIVEKTLKQQSSKPFIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHIGI  692 (920)
Q Consensus       613 ~i~~gRHPviE~~l~~~~~~~fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a~i~~  692 (920)
                      .|++||||++|..    ....|||||+.|+.    +..+++||||||||||||||||+|++++|||+||||||++|++++
T Consensus         1 ~ik~~RHPlle~~----~~~~~VpNdi~l~~----~~~~i~iiTGpN~sGKSt~lk~i~l~~~laq~G~~vpa~~~~~~~   72 (222)
T cd03285           1 VLKEARHPCVEAQ----DDVAFIPNDVTLTR----GKSRFLIITGPNMGGKSTYIRQIGVIVLMAQIGCFVPCDSADIPI   72 (222)
T ss_pred             CCCCCCCCEEECC----CCCCEECCEEEECC----CCCEEEEEECCCCCCHHHHHHHHHHHHHHHHHCCCEEEEEEEEEC
T ss_conf             9667748659706----89977776689768----982599998999887189999999999999868754632389952


Q ss_pred             CCEEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCC
Q ss_conf             21056765237661138532899999999999958998569993258898805679999999999997269849997487
Q gi|254780750|r  693 VDKLFSRVGSADNLASGRSTFMVEMIETASILNQATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHF  772 (920)
Q Consensus       693 ~D~IftRiGa~D~l~~g~STF~vEm~e~~~IL~~at~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy  772 (920)
                      ||+||||||+.|++..|+||||+||.+++.||+++|++||||+||+||||+|.||.|||||+++||.++.+|+++|||||
T Consensus        73 ~d~i~t~i~~~d~~~~~~StF~~e~~~~~~il~~~~~~sLvliDElg~GT~~~eg~aia~aile~L~~~~~~~~i~tTH~  152 (222)
T cd03285          73 VDCILARVGASDSQLKGVSTFMAEMLETAAILKSATENSLIIIDELGRGTSTYDGFGLAWAIAEYIATQIKCFCLFATHF  152 (222)
T ss_pred             CCEEEEEECCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCEECCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEEEEEC
T ss_conf             76499998899710033528999999999999847677320002346898822679999999999985068509998200


Q ss_pred             HHHHHHHHHCCCEEEEEEEEE--EECCEEEEEEEEEECCCCCCHHHHHHHHCCCCHHHHHHHHHHHHHHH
Q ss_conf             579766430688589999999--60992778777744789887789999982999899999999999998
Q gi|254780750|r  773 HELTDLSKSLKRFHNATLQVS--DSNEGIIFLHKVIPGIADHSYGIQVGKLAGLPNTVISRAYDILKTFE  840 (920)
Q Consensus       773 ~eL~~l~~~~~~v~n~~~~~~--~~~~~i~flykl~~G~~~~Sygi~vA~laG~p~~vi~~A~~~~~~le  840 (920)
                      |+|+.++...+++.|+||.+.  +.+++++|+|||.+|+|++|||+++|+++|+|++||+||++++++||
T Consensus       153 ~~L~~l~~~~~~v~~~~~~~~~~~~~~~l~f~Ykl~~G~~~~s~ai~iA~~~G~p~~ii~rA~~~~~~lE  222 (222)
T cd03285         153 HELTALADEVPNVKNLHVTALTDDASRTLTMLYKVEKGACDQSFGIHVAELANFPKEVIEMAKQKALELE  222 (222)
T ss_pred             HHHHHHHHCCCCCEEEEEEEEEEECCCCEEEEEEECCCCCCCCHHHHHHHHHCCCHHHHHHHHHHHHHCC
T ss_conf             7799986408551357899999605992789999676899984999999992959999999999999629


No 12 
>cd03284 ABC_MutS1 MutS1 homolog in eukaryotes.  The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch.  Members of the MutS family possess C-terminal domain with a conserved ATPase activity that belongs to the ATP binding cassette (ABC) superfamily.  MutS homologs (MSH) have been identified in most prokaryotic and all eukaryotic organisms examined.  Prokaryotes have two homologs (MutS1 and MutS2), whereas seven MSH proteins (MSH1 to MSH7) have been identified in eukaryotes.  The homodimer MutS1 and heterodimers MSH2-MSH3 and MSH2-MSH6 are primarily involved in mitotic mismatch repair, whereas MSH4-MSH5 is involved in resolution of Holliday junctions during meiosis.  All members of the MutS family contain the highly conserved Walker A/B ATPase domain, and many share a common mechanism of action.  MutS1, MSH2-MSH3, MSH2-MSH6, and MSH4-MSH5 dimerize to form sliding clam
Probab=100.00  E-value=0  Score=558.59  Aligned_cols=216  Identities=58%  Similarity=0.987  Sum_probs=206.7

Q ss_pred             EECCCCCHHHHHHHHHCCCCCEEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHCCCCC
Q ss_conf             00004680588763102877044434563587777664399996778440789999999999999719853035320682
Q gi|254780750|r  613 IVKDGRHPIVEKTLKQQSSKPFIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHIGI  692 (920)
Q Consensus       613 ~i~~gRHPviE~~l~~~~~~~fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a~i~~  692 (920)
                      +|++||||++|..+.   .+.|||||+.++     ++.+++||||||||||||||||||++++|||+||||||++|++++
T Consensus         1 ~i~~~RHPlle~~~~---~~~~VpNdi~l~-----~~~~~~iiTGpN~sGKSt~Lk~igl~~ilaq~G~~vpA~~a~i~~   72 (216)
T cd03284           1 EIEGGRHPVVEQVLD---NEPFVPNDTELD-----PERQILLITGPNMAGKSTYLRQVALIALLAQIGSFVPASKAEIGV   72 (216)
T ss_pred             CCCCCCCCEEEEECC---CCCEECCEEEEC-----CCCEEEEEECCCCCCHHHHHHHHHHHHHHHHHCCEEEECCEEEEE
T ss_conf             977586863851058---897776568978-----984599998998774599999999999999868758766159970


Q ss_pred             CCEEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCC
Q ss_conf             21056765237661138532899999999999958998569993258898805679999999999997269849997487
Q gi|254780750|r  693 VDKLFSRVGSADNLASGRSTFMVEMIETASILNQATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHF  772 (920)
Q Consensus       693 ~D~IftRiGa~D~l~~g~STF~vEm~e~~~IL~~at~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy  772 (920)
                      ||+||||||+.|++..|+|||++||.+++.||++||++||||+||+||||++.||.|||||++|+|+++.+|+++|||||
T Consensus        73 ~d~I~t~i~~~d~i~~~~StF~~e~~~~~~il~~a~~~sLvliDEl~~gT~~~eg~ala~aile~L~~~~~~~~i~tTH~  152 (216)
T cd03284          73 VDRIFTRIGASDDLAGGRSTFMVEMVETANILNNATERSLVLLDEIGRGTSTYDGLSIAWAIVEYLHEKIGAKTLFATHY  152 (216)
T ss_pred             CCEEEEEECCCCHHHCCCCHHHHHHHHHHHHHHHCCCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEEEECH
T ss_conf             44699950686213337265899999999999848776156334456899857889999999999997079728975050


Q ss_pred             HHHHHHHHHCCCEEEEEEEEEEECCEEEEEEEEEECCCCCCHHHHHHHHCCCCHHHHHHHHHHH
Q ss_conf             5797664306885899999996099277877774478988778999998299989999999999
Q gi|254780750|r  773 HELTDLSKSLKRFHNATLQVSDSNEGIIFLHKVIPGIADHSYGIQVGKLAGLPNTVISRAYDIL  836 (920)
Q Consensus       773 ~eL~~l~~~~~~v~n~~~~~~~~~~~i~flykl~~G~~~~Sygi~vA~laG~p~~vi~~A~~~~  836 (920)
                      |+|+.++...++++|+||.+++.+++++|+|||.+|+|++|||+++|+++|+|++||+||++++
T Consensus       153 ~~L~~l~~~~~~v~n~~~~~~~~~~~~~f~Ykl~~G~~~~s~ai~~A~~~glp~~ii~rA~eil  216 (216)
T cd03284         153 HELTELEGKLPRVKNFHVAVKEKGGGVVFLHKIVEGAADKSYGIEVARLAGLPEEVIERAREIL  216 (216)
T ss_pred             HHHHHHHHHCCCCEEEEEEEEECCCEEEEEEEECCCCCCCCHHHHHHHHHCCCHHHHHHHHHHC
T ss_conf             8899987628661566789997099571887976489997099999999295999999999659


No 13 
>TIGR01069 mutS2 MutS2 family protein; InterPro: IPR005747   Mismatch repair contributes to the overall fidelity of DNA replication and is essential for combating the adverse effects of damage to the genome. It involves the correction of mismatched base pairs that have been missed by the proofreading element of the DNA polymerase complex. The post-replicative Mismatch Repair System (MMRS) of Escherichia coli involves MutS (Mutator S), MutL and MutH proteins, and acts to correct point mutations or small insertion/deletion loops produced during DNA replication . MutS and MutL are involved in preventing recombination between partially homologous DNA sequences. The assembly of MMRS is initiated by MutS, which recognises and binds to mispaired nucleotides and allows further action of MutL and MutH to eliminate a portion of newly synthesized DNA strand containing the mispaired base . MutS can also collaborate with methyltransferases in the repair of O(6)-methylguanine damage, which would otherwise pair with thymine during replication to create an O(6)mG:T mismatch . MutS exists as a dimer, where the two monomers have different conformations and form a heterodimer at the structural level . Only one monomer recognises the mismatch specifically and has ADP bound. Non-specific major groove DNA-binding domains from both monomers embrace the DNA in a clamp-like structure. Mismatch binding induces ATP uptake and a conformational change in the MutS protein, resulting in a clamp that translocates on DNA.    MutS is a modular protein with a complex structure , and is composed of:    N-terminal mismatch-recognition domain, which is similar in structure to tRNA endonuclease. Connector domain, which is similar in structure to Holliday junction resolvase ruvC. Core domain, which is composed of two separate subdomains that join together to form a helical bundle; from within the core domain, two helices act as levers that extend towards (but do not touch) the DNA. Clamp domain, which is inserted between the two subdomains of the core domain at the top of the lever helices; the clamp domain has a beta-sheet structure. ATPase domain (connected to the core domain), which has a classical Walker A motif. HTH (helix-turn-helix) domain, which is involved in dimer contacts.    Homologues of MutS have been found in many species including eukaryotes (MSH 1, 2, 3, 4, 5, and 6 proteins), archaea and bacteria, and together these proteins have been grouped into the MutS family. Although many of these proteins have similar activities to the E. coli MutS, there is significant diversity of function among the MutS family members. This diversity is even seen within species, where many species encode multiple MutS homologues with distinct functions . Inter-species homologues may have arisen through frequent ancient horizontal gene transfer of MutS (and MutL) from bacteria to archaea and eukaryotes via endosymbiotic ancestors of mitochondria and chloroplasts .    This entry represents a family of MutS proteins.; GO: 0003684 damaged DNA binding, 0005524 ATP binding, 0045005 maintenance of fidelity during DNA-dependent DNA replication.
Probab=100.00  E-value=0  Score=529.08  Aligned_cols=495  Identities=22%  Similarity=0.320  Sum_probs=400.5

Q ss_pred             HHHHHCCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCHH-HHHHHHHHHHHHCCHHHHHHHHHHHH-HCHHH-
Q ss_conf             7876301234337899998631002345678989999997402212-58899999752048344445677521-00002-
Q gi|254780750|r  314 LLKTIDYSITGAGGRLFAERIASPLTDSTKINTRLDSINFFIQNPI-LINPIQKILKSSPDVPRSLSRLKIGR-GEPKD-  390 (920)
Q Consensus       314 L~~~Ln~t~T~~G~RlLr~wL~~PL~d~~~I~~R~daVe~l~~~~~-~~~~l~~~L~~i~DleRll~ri~~~~-~~p~d-  390 (920)
                      +=.++.+|.|+.|+=.++.  +.|..+++++....+-+..+..=.. .+.  .-.|.++-||--.|+|.-++- ..+-| 
T Consensus        15 ~e~~~~~t~t~l~~~~~~~--L~p~~~~~e~~~~l~~~~~~~~I~~s~~~--n~~f~g~~DIr~~L~rae~~~~~~~le~   90 (834)
T TIGR01069        15 KENLLKYTATPLGKEKALE--LKPPKSVEESKELLEKLKALVSIENSLRS--NVRFKGLADIREALKRAELGGIVVGLEE   90 (834)
T ss_pred             HHHHHHHHCCHHHHHHHHH--CCCCCCHHHHHHHHHHHHHHHHHHHCCCC--CCCCCCCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             9887575138045899860--87954078999999988777778732012--6554442144668744456435676899


Q ss_pred             HHHHHHHHHHHHHHHH----HHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEECCC-CCCHHHHHH
Q ss_conf             1206899999865567----54302584577876765776789999999998543101221046010168-541145579
Q gi|254780750|r  391 IAVIRDGIRSGINILN----LFLKNDLPEELRGAVEKLKKLPQSLEKTLSSMLSDDLPTFKRDGGFLRDG-ADASLDETR  465 (920)
Q Consensus       391 l~~L~~sl~~~~~i~~----~l~~~~~~~~l~~~~~~l~~l~~~l~~~l~~~i~~~~~~~~~~~~~ik~g-~d~eLD~lr  465 (920)
                      ++.+...|.....+..    ...+....+.|......+..++ .+++.|...|++        .|.++++ ++++||.+|
T Consensus        91 ~l~I~~~l~~~~~lk~fit~~~~~~~~~~~L~~~~~~~~~L~-~L~n~i~~~iD~--------~G~v~~~GAs~~L~~ir  161 (834)
T TIGR01069        91 ILKIQNLLKKVKELKRFITRLAEERLDLEILSKLLLKLITLS-PLENDIIECIDD--------DGKVKDEGASEELDEIR  161 (834)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHCCCCC-HHHHHHHHHCCC--------CCCHHHHHCCHHHHHHH
T ss_conf             999999999989999999999731244268999998424484-689999974285--------41004222046789999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCC-CCCC--CCCCCCCCEEEEEECCHHHHHCCCCCCCCCCEEEEEECCCCHHHHHHH-HH
Q ss_conf             9886389999977687788738-8751--102558622376204114333441116876527985212000111345-66
Q gi|254780750|r  466 SLRDQSKRIIASLQLKYAEETK-IKNL--KIKHNNNLGYFIEVTSSSASVLKKDLESKDRFIHRQTMSNLTRFTTLE-LI  541 (920)
Q Consensus       466 ~~~~~~~~~l~~l~~~~~~~~~-i~sL--ki~~n~~~gy~iEV~~~~~~~i~~~~~~~~~~i~~qt~~~~~Rf~t~e-L~  541 (920)
                      ......++.+.+-...+..+.. -+.|  .+.+.+.-.|.|-|.......++       +.++..|.+|.+-|+.|+ ++
T Consensus       162 ~~l~~l~~~~~~~l~~~i~~~~~a~~L~d~~vt~r~~r~vlp~K~~~~~~i~-------GiV~~~SsSG~T~Y~EPq~iv  234 (834)
T TIGR01069       162 ESLKALEERVKKRLKKIIRSKELAKYLSDTIVTIRNDRYVLPLKSGFKGKIK-------GIVHDTSSSGETLYVEPQAIV  234 (834)
T ss_pred             HHHHHHHHHHHHHHHHHHCCHHHHHHHHCCCEEEECCEEEEEEECCCCCCCC-------CEEEECCCCCCCCEECHHHHH
T ss_conf             9999999999999998734433455440022265267389866615300147-------616520587750101628999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEECCCC---CCEEECCCC
Q ss_conf             64334643777776433447888765430112579888899986778877888775258851210478---714000046
Q gi|254780750|r  542 DLENRITNATNSALLIELESFEILSNAIIEQSESLDNASQVIAIIDISIALAILAKEQNYCRPIIDNS---TNFIVKDGR  618 (920)
Q Consensus       542 ~l~~~i~~~~~~~~~~e~~~~~~l~~~i~~~~~~l~~~~~~ia~lD~l~SlA~~a~~~~y~rP~i~~~---~~l~i~~gR  618 (920)
                      ++++++.++..+......++++.|.+.+.+|...|....+.+..+|++.|.+.+|...+...|.+.+.   ..+.+.++|
T Consensus       235 ~~nnkL~~~~~~~~~~i~~iLr~Ls~~~~~~~~~L~~l~~~~~~lD~~~Ar~ry~~~~~~~fP~~~~tGd~k~~~L~~ar  314 (834)
T TIGR01069       235 KLNNKLAQLKNEEEEEIEKILRTLSEKVQEYLLELKELFKEFLELDSLQARARYAKAVKAEFPEISNTGDEKVIELEEAR  314 (834)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCEEEHHHCC
T ss_conf             99889999877888999999998889999999999999999988658999988778734726778988863112450177


Q ss_pred             CHHHHHHHHHCCCCCEEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHH-H-CCCCCCCEE
Q ss_conf             80588763102877044434563587777664399996778440789999999999999719853035-3-206822105
Q gi|254780750|r  619 HPIVEKTLKQQSSKPFIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPAS-Y-AHIGIVDKL  696 (920)
Q Consensus       619 HPviE~~l~~~~~~~fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~-~-a~i~~~D~I  696 (920)
                      ||++...=...++...||+++.|+     .+.++++|||||.||||+.|||+||.++|||.|.||||. . .++++|+.|
T Consensus       315 HPlL~~~kE~eGGPavv~~~~~l~-----~~~~~~~iTGPNtGGKTVtLKTLGL~~lm~q~gipi~~~e~hS~~p~F~~i  389 (834)
T TIGR01069       315 HPLLKESKEDEGGPAVVPVTLELK-----SEKRVLIITGPNTGGKTVTLKTLGLLALMAQSGIPIPAKESHSELPLFEEI  389 (834)
T ss_pred             CCCCCCCCCCCCCCEEEECCCCCC-----CCCCEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCEECCCCCCCCHHHHHH
T ss_conf             989887432257964664462316-----641178886779961789999999999998727833117862211101212


Q ss_pred             EEEEECCCCCCCCCCHHHHHHHHHHHHHHHCCC------------------CCEEEEECCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             676523766113853289999999999995899------------------85699932588988056799999999999
Q gi|254780750|r  697 FSRVGSADNLASGRSTFMVEMIETASILNQATN------------------QSFVILDEIGRGTATLDGLSIAWATIEYL  758 (920)
Q Consensus       697 ftRiGa~D~l~~g~STF~vEm~e~~~IL~~at~------------------~SLVllDElGrGTst~DG~aiA~aile~l  758 (920)
                      |+.||...||.++.|||...|...+.||.+.++                  +||||+||||-||++.+|.|||.|+||||
T Consensus       390 faDIGDEQSi~qnLSTFS~Hm~~i~~iL~~~~eGvqdvldPeidsPnhPifnsLVl~DE~gaGTDp~EGsALai~iLe~L  469 (834)
T TIGR01069       390 FADIGDEQSIEQNLSTFSSHMKNISEILKKVDEGVQDVLDPEIDSPNHPIFNSLVLFDELGAGTDPDEGSALAISILEYL  469 (834)
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCHHHHHHCCCCCCCCCCCCCHHHHHHHHHCCCCCHHHHHHHHHHHHHHH
T ss_conf             01358842424337789999999999972144013330265668889874202566633015788868999999999998


Q ss_pred             HHHCCCEEEEECCCHHHHHHHHHCCCEEEEEEEEEEECCEEEEEEEEEECCCCCCHHHHHHHHCCCCHHHHHHHHHHH
Q ss_conf             972698499974875797664306885899999996099277877774478988778999998299989999999999
Q gi|254780750|r  759 HETNRCRGLLATHFHELTDLSKSLKRFHNATLQVSDSNEGIIFLHKVIPGIADHSYGIQVGKLAGLPNTVISRAYDIL  836 (920)
Q Consensus       759 ~~~~~~~~lfaTHy~eL~~l~~~~~~v~n~~~~~~~~~~~i~flykl~~G~~~~Sygi~vA~laG~p~~vi~~A~~~~  836 (920)
                      ++. .|+++.+|||.+|..+..+..+|.|+.|.+|.+.-  ..+|+|..|+.++||+++||..+|||..||++|++..
T Consensus       470 ~~~-n~~v~~TTHy~~LK~~~y~~~~v~nASv~fD~Etl--~PtY~ll~g~~G~S~AF~iA~r~G~P~~iie~AK~~~  544 (834)
T TIGR01069       470 LKQ-NALVLITTHYKELKAYAYNNEGVENASVLFDEETL--SPTYKLLFGVPGRSYAFEIAQRLGIPSEIIEQAKEKY  544 (834)
T ss_pred             HCC-CCEEEEECCCHHHHHHCCCCCCCCHHHHHHCHHHC--CCCCEEEECCCCCHHHHHHHHHHCCCHHHHHHHHHHH
T ss_conf             538-98499973534652200246640037766233422--7431220037871068899998479888999986742


No 14 
>cd03287 ABC_MSH3_euk MutS3 homolog in eukaryotes.  The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch.  Members of the MutS family possess C-terminal domain with a conserved ATPase activity that belongs to the ATP binding cassette (ABC) superfamily.  MutS homologs (MSH) have been identified in most prokaryotic and all eukaryotic organisms examined.  Prokaryotes have two homologs (MutS1 and MutS2), whereas seven MSH proteins (MSH1 to MSH7) have been identified in eukaryotes.  The homodimer MutS1 and heterodimers MSH2-MSH3 and MSH2-MSH6 are primarily involved in mitotic mismatch repair, whereas MSH4-MSH5 is involved in resolution of Holliday junctions during meiosis.  All members of the MutS family contain the highly conserved Walker A/B ATPase domain, and many share a common mechanism of action.  MutS1, MSH2-MSH3, MSH2-MSH6, and MSH4-MSH5 dimerize to form sliding c
Probab=100.00  E-value=0  Score=537.19  Aligned_cols=213  Identities=47%  Similarity=0.838  Sum_probs=198.5

Q ss_pred             EEECCCCCHHHHHHHHHCCCCCEEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHCCCC
Q ss_conf             40000468058876310287704443456358777766439999677844078999999999999971985303532068
Q gi|254780750|r  612 FIVKDGRHPIVEKTLKQQSSKPFIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHIG  691 (920)
Q Consensus       612 l~i~~gRHPviE~~l~~~~~~~fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a~i~  691 (920)
                      |.|++||||++|.+.    .+.|||||+.++.    +..+++||||||||||||||||+|++++|||+||||||++|+++
T Consensus         1 i~ik~~RHPlle~~~----~~~~VpNdi~l~~----~~~~~~iiTGpN~~GKSt~lk~i~l~~ilaq~G~~vpa~~~~~~   72 (222)
T cd03287           1 ILIKEGRHPMIESLL----DKSFVPNDIHLSA----EGGYCQIITGPNMGGKSSYIRQVALITIMAQIGSFVPASSATLS   72 (222)
T ss_pred             CEEECCCCCEEECCC----CCCEECCEEEECC----CCCEEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCHHHCEEE
T ss_conf             937267486784047----9976877479768----88448999789988728999999999999972677214563996


Q ss_pred             CCCEEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECC
Q ss_conf             22105676523766113853289999999999995899856999325889880567999999999999726984999748
Q gi|254780750|r  692 IVDKLFSRVGSADNLASGRSTFMVEMIETASILNQATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATH  771 (920)
Q Consensus       692 ~~D~IftRiGa~D~l~~g~STF~vEm~e~~~IL~~at~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTH  771 (920)
                      +||+||||||..|++..|+|||+.||.+++.|++++|++||||+||+||||++.||.|||||++|||.+..+|+++|+||
T Consensus        73 ~~d~i~~~i~~~d~~~~~~StF~~e~~~~~~il~~~~~~sLvliDEl~~GT~~~eg~ala~aile~l~~~~~~~~i~tTH  152 (222)
T cd03287          73 IFDSVLTRMGASDSIQHGMSTFMVELSETSHILSNCTSRSLVILDELGRGTSTHDGIAIAYATLHYLLEEKKCLVLFVTH  152 (222)
T ss_pred             CCCEEEEECCCCCHHHCCCCHHHHHHHHHHHHHHHCCCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEEECC
T ss_conf             35759995067862344522799999999999986788754423224689983577999999999998605889999476


Q ss_pred             CHHHHHHHHHCC-CEEEEEEEEEE--------ECCEEEEEEEEEECCCCCCHHHHHHHHCCCCHHHHHHH
Q ss_conf             757976643068-85899999996--------09927787777447898877899999829998999999
Q gi|254780750|r  772 FHELTDLSKSLK-RFHNATLQVSD--------SNEGIIFLHKVIPGIADHSYGIQVGKLAGLPNTVISRA  832 (920)
Q Consensus       772 y~eL~~l~~~~~-~v~n~~~~~~~--------~~~~i~flykl~~G~~~~Sygi~vA~laG~p~~vi~~A  832 (920)
                      ||+|+++....+ .++|+||.+.+        .+++++|+|||.+|+|++||||+|||++|+|++||+||
T Consensus       153 ~~~L~~l~~~~~~~v~n~~~~~~~~~~~~~~~~~~~l~f~YkL~~G~~~~s~ai~iA~~~GlP~~ii~rA  222 (222)
T cd03287         153 YPSLGEILRRFEGSIRNYHMSYLESQKDFETSDSQSITFLYKLVRGLASRSFGLNVARLAGLPKSIISRA  222 (222)
T ss_pred             CHHHHHHHHHCCCCEEEEEEEEEEECCCCCCCCCCEEEEEEEECCCCCCCCHHHHHHHHHCCCHHHHHCC
T ss_conf             2789999875878457888889873044444668803288587779999719999999949199998029


No 15 
>cd03286 ABC_MSH6_euk MutS6 homolog in eukaryotes.  The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch.  Members of the MutS family possess C-terminal domain with a conserved ATPase activity that belongs to the ATP binding cassette (ABC) superfamily.  MutS homologs (MSH) have been identified in most prokaryotic and all eukaryotic organisms examined.  Prokaryotes have two homologs (MutS1 and MutS2), whereas seven MSH proteins (MSH1 to MSH7) have been identified in eukaryotes.  The homodimer MutS1 and heterodimers MSH2-MSH3 and MSH2-MSH6 are primarily involved in mitotic mismatch repair, whereas MSH4-MSH5 is involved in resolution of Holliday junctions during meiosis.  All members of the MutS family contain the highly conserved Walker A/B ATPase domain, and many share a common mechanism of action.  MutS1, MSH2-MSH3, MSH2-MSH6, and MSH4-MSH5 dimerize to form sliding c
Probab=100.00  E-value=0  Score=528.55  Aligned_cols=211  Identities=45%  Similarity=0.743  Sum_probs=197.8

Q ss_pred             ECCCCCHHHHHHHHHCCCCCEEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHCCCCCC
Q ss_conf             00046805887631028770444345635877776643999967784407899999999999997198530353206822
Q gi|254780750|r  614 VKDGRHPIVEKTLKQQSSKPFIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHIGIV  693 (920)
Q Consensus       614 i~~gRHPviE~~l~~~~~~~fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a~i~~~  693 (920)
                      ++++|||++|..    ...+|||||+.|+.    ++.+++||||||||||||||||||+++||||+||||||++|++++|
T Consensus         2 lk~~RHPll~~~----~~~~~VpNdi~l~~----~~~~~~iiTGpN~sGKSt~lk~i~l~~ilaq~G~~vpA~~~~~~~~   73 (218)
T cd03286           2 FEELRHPCLNAS----TASSFVPNDVDLGA----TSPRILVLTGPNMGGKSTLLRTVCLAVIMAQMGMDVPAKSMRLSLV   73 (218)
T ss_pred             CCCCCCCEEECC----CCCCEECCEEEECC----CCCEEEEEECCCCCCCHHHHHHHHHHHHHHHCCCCEECCCCEEECC
T ss_conf             766758779726----89975875688679----9740899989998873899999999999998288430146477346


Q ss_pred             CEEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCH
Q ss_conf             10567652376611385328999999999999589985699932588988056799999999999972698499974875
Q gi|254780750|r  694 DKLFSRVGSADNLASGRSTFMVEMIETASILNQATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFH  773 (920)
Q Consensus       694 D~IftRiGa~D~l~~g~STF~vEm~e~~~IL~~at~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~  773 (920)
                      |+||||||+.||+..|+||||.||.+++.||++++++||||+||+||||++.||.|||+|++|||.++.+|+++|+||||
T Consensus        74 d~i~~~i~~~d~~~~~~StF~~e~~~~~~il~~~~~~sLvllDE~~~GT~~~eg~ala~aile~L~~~~~~~~i~tTH~~  153 (218)
T cd03286          74 DRIFTRIGARDDIMKGESTFMVELSETANILRHATPDSLVILDELGRGTSTHDGYAIAHAVLEYLVKKVKCLTLFSTHYH  153 (218)
T ss_pred             CEEEEEECCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCEECCCCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEECCCH
T ss_conf             64899745866143115069999999999998679985010255468998116799999999999863797699976728


Q ss_pred             HHHHHHHHCCCEEEEEEEEEEE------CCEEEEEEEEEECCCCCCHHHHHHHHCCCCHHHHHHH
Q ss_conf             7976643068858999999960------9927787777447898877899999829998999999
Q gi|254780750|r  774 ELTDLSKSLKRFHNATLQVSDS------NEGIIFLHKVIPGIADHSYGIQVGKLAGLPNTVISRA  832 (920)
Q Consensus       774 eL~~l~~~~~~v~n~~~~~~~~------~~~i~flykl~~G~~~~Sygi~vA~laG~p~~vi~~A  832 (920)
                      +|+++....++++++||.+..+      +++++|+|||.+|+|++|||++||+++|+|++||+||
T Consensus       154 el~~~~~~~~~v~~~~m~~~~~~~~~~~~~~l~f~YkL~~G~~~~s~ai~iA~~~G~p~~ii~rA  218 (218)
T cd03286         154 SLCDEFHEHGGVRLGHMACAVKNESDPTIRDITFLYKLVAGICPKSYGLYVALMAGIPDGVVERA  218 (218)
T ss_pred             HHHHHHHHCCCCEEEEEEEEEECCCCCCCCEEEEEEEECCCCCCCCHHHHHHHHHCCCHHHHHCC
T ss_conf             99998864889189889999963677878713288698879998719999999959099999229


No 16 
>cd03282 ABC_MSH4_euk MutS4 homolog in eukaryotes.  The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch.  Members of the MutS family possess C-terminal domain with a conserved ATPase activity that belongs to the ATP binding cassette (ABC) superfamily.  MutS homologs (MSH) have been identified in most prokaryotic and all eukaryotic organisms examined.  Prokaryotes have two homologs (MutS1 and MutS2), whereas seven MSH proteins (MSH1 to MSH7) have been identified in eukaryotes.  The homodimer MutS1 and heterodimers MSH2-MSH3 and MSH2-MSH6 are primarily involved in mitotic mismatch repair, whereas MSH4-MSH5 is involved in resolution of Holliday junctions during meiosis.  All members of the MutS family contain the highly conserved Walker A/B ATPase domain, and many share a common mechanism of action.  MutS1, MSH2-MSH3, MSH2-MSH6, and MSH4-MSH5 dimerize to form sliding c
Probab=100.00  E-value=0  Score=507.47  Aligned_cols=202  Identities=38%  Similarity=0.647  Sum_probs=189.0

Q ss_pred             EECCCCCHHHHHHHHHCCCCCEEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHCCCCC
Q ss_conf             00004680588763102877044434563587777664399996778440789999999999999719853035320682
Q gi|254780750|r  613 IVKDGRHPIVEKTLKQQSSKPFIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHIGI  692 (920)
Q Consensus       613 ~i~~gRHPviE~~l~~~~~~~fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a~i~~  692 (920)
                      .|++||||++|..     .++|||||+.++.    +..+++||||||||||||||||+|++++|||+||||||++|++++
T Consensus         1 iik~~rHPlle~~-----~~~~VpNdi~l~~----~~~~~~iITGpN~gGKSt~Lktigl~~ilAq~G~~vpA~~a~~~~   71 (204)
T cd03282           1 IIRDSRHPILDRD-----KKNFIPNDIYLTR----GSSRFHIITGPNMSGKSTYLKQIALLAIMAQIGCFVPAEYATLPI   71 (204)
T ss_pred             CCCCCCCCEEECC-----CCCEECCEEEECC----CCCEEEEEECCCCCCHHHHHHHHHHHHHHHHHCCEEEHHHCCCCC
T ss_conf             9557708638568-----8967876688669----972599998999887199999999999999968916713210336


Q ss_pred             CCEEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCC
Q ss_conf             21056765237661138532899999999999958998569993258898805679999999999997269849997487
Q gi|254780750|r  693 VDKLFSRVGSADNLASGRSTFMVEMIETASILNQATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHF  772 (920)
Q Consensus       693 ~D~IftRiGa~D~l~~g~STF~vEm~e~~~IL~~at~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy  772 (920)
                      ||+||||||..||+.+|+|||+.||.+++.|++.++++||||+||+||||+|.||.|+|||++++|.+. +|+++|||||
T Consensus        72 ~d~I~t~i~~~d~i~~~~StF~~E~~~~~~il~~~~~~sLvliDEl~~GT~~~eg~a~a~aile~l~~~-~~~~i~tTH~  150 (204)
T cd03282          72 FNRLLSRLSNDDSMERNLSTFASEMSETAYILDYADGDSLVLIDELGRGTSSADGFAISLAILECLIKK-ESTVFFATHF  150 (204)
T ss_pred             CCEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHC-CCEEEEECCH
T ss_conf             677899987666100664589999999999998588898798543348998678999999999999967-9879998976


Q ss_pred             HHHHHHHHHCCCEEEEEEEEEE-ECCEEEEEEEEEECCCC-CCHHHHHHHHCCC
Q ss_conf             5797664306885899999996-09927787777447898-8778999998299
Q gi|254780750|r  773 HELTDLSKSLKRFHNATLQVSD-SNEGIIFLHKVIPGIAD-HSYGIQVGKLAGL  824 (920)
Q Consensus       773 ~eL~~l~~~~~~v~n~~~~~~~-~~~~i~flykl~~G~~~-~Sygi~vA~laG~  824 (920)
                      |+|+++.+..+++.|+||++.+ .+++++|+|||.+|++. +||||++||+||+
T Consensus       151 ~~L~~l~~~~~~v~n~~m~~~~~~~~~l~f~YkL~~G~~~~~~ygi~~ar~~~l  204 (204)
T cd03282         151 RDIAAILGNKSCVVHLHMKAQSINSNGIEMAYKLVLGLYRIVDDGIRFVRVLAL  204 (204)
T ss_pred             HHHHHHHHHCCCEEEEEEEEEEEECCEEEEEEEECCCCCCCCCCHHHHHHHCCC
T ss_conf             899998863888499999999973992889879752788886355999997479


No 17 
>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes.  The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch.  Members of the MutS family possess C-terminal domain with a conserved ATPase activity that belongs to the ATP binding cassette (ABC) superfamily.  MutS homologs (MSH) have been identified in most prokaryotic and all eukaryotic organisms examined.  Prokaryotes have two homologs (MutS1 and MutS2), whereas seven MSH proteins (MSH1 to MSH7) have been identified in eukaryotes.  The homodimer MutS1 and heterodimers MSH2-MSH3 and MSH2-MSH6 are primarily involved in mitotic mismatch repair, whereas MSH4-MSH5 is involved in resolution of Holliday junctions during meiosis.  All members of the MutS family contain the highly conserved Walker A/B ATPase domain, and many share a common mechanism of action.  MutS1, MSH2-MSH3, MSH2-MSH6, and MSH4-MSH5 dimerize to form sliding c
Probab=100.00  E-value=0  Score=500.91  Aligned_cols=203  Identities=41%  Similarity=0.714  Sum_probs=186.4

Q ss_pred             EECCCCCHHHHHHHHHCCCCCEEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHCCCCC
Q ss_conf             00004680588763102877044434563587777664399996778440789999999999999719853035320682
Q gi|254780750|r  613 IVKDGRHPIVEKTLKQQSSKPFIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHIGI  692 (920)
Q Consensus       613 ~i~~gRHPviE~~l~~~~~~~fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a~i~~  692 (920)
                      +|++||||++|...     .+|||||+.|+.    +..+++||||||||||||||||+|++++|||+||||||++|++++
T Consensus         1 ~i~~~RHPlle~~~-----~~~VpNdi~l~~----~~~~~~iiTGpN~gGKSt~lkti~l~~ilaq~G~~vpa~~~~~~~   71 (213)
T cd03281           1 EIQGGRHPLLELFV-----DSFVPNDTEIGG----GGPSIMVITGPNSSGKSVYLKQVALIVFLAHIGSFVPADSATIGL   71 (213)
T ss_pred             CCCCCCCCEEECCC-----CCEECCEEEECC----CCCEEEEEECCCCCCHHHHHHHHHHHHHHHHHCCCEEECCEEEEC
T ss_conf             97757586582567-----964676589779----982599998999876599999999999999858857674039972


Q ss_pred             CCEEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCC--EEEEEC
Q ss_conf             210567652376611385328999999999999589985699932588988056799999999999972698--499974
Q gi|254780750|r  693 VDKLFSRVGSADNLASGRSTFMVEMIETASILNQATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRC--RGLLAT  770 (920)
Q Consensus       693 ~D~IftRiGa~D~l~~g~STF~vEm~e~~~IL~~at~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~--~~lfaT  770 (920)
                      ||+||||||..|++.+|+|||++||.+++.||++++++||||+||+||||++.||.|||||++|||.+...+  +++|||
T Consensus        72 ~~~i~~~i~~~d~~~~~~StF~~E~~~~~~il~~~~~~sLvliDEl~~GT~~~eg~ala~a~le~l~~~~~~~~~~~~tT  151 (213)
T cd03281          72 VDKIFTRMSSRESVSSGQSAFMIDLYQVSKALRLATRRSLVLIDEFGKGTDTEDGAGLLIATIEHLLKRGPECPRVIVST  151 (213)
T ss_pred             CCCEEEEECCHHHHHCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHHCCCCCCEEEEEC
T ss_conf             12237676764344413258999999999999858888658773134788835679999999999996588766499989


Q ss_pred             CCHHHHHHH--HHCCCEEEEEEEEE------EECCEEEEEEEEEECCCCCCHHHHHHHHCCC
Q ss_conf             875797664--30688589999999------6099277877774478988778999998299
Q gi|254780750|r  771 HFHELTDLS--KSLKRFHNATLQVS------DSNEGIIFLHKVIPGIADHSYGIQVGKLAGL  824 (920)
Q Consensus       771 Hy~eL~~l~--~~~~~v~n~~~~~~------~~~~~i~flykl~~G~~~~Sygi~vA~laG~  824 (920)
                      |||+|+++.  .+.+.+.++||++.      ..+++++|+|||.+|+|++|||++||+++|+
T Consensus       152 H~~~L~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~l~f~YkL~~G~~~~S~ai~vA~~~Gl  213 (213)
T cd03281         152 HFHELFNRSLLPERLKIKFLTMEVLLNPTSTSPNEDITYLYRLVPGLADTSFAIHCAKLAGI  213 (213)
T ss_pred             CHHHHHHHHHCCCCCCEEEEEEEEEECCCCCCCCCEEEEEEEECCCCCCCCHHHHHHHHCCC
T ss_conf             72787654401656443788999986364411288485987878689986099999998589


No 18 
>cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes.  The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch.  Members of the MutS family also possess a conserved ATPase activity that belongs to the ATP binding cassette (ABC) superfamily.  MutS homologs (MSH) have been identified in most prokaryotic and all eukaryotic organisms examined. Prokaryotes have two homologs (MutS1 and MutS2), whereas seven MSH proteins (MSH1 to MSH7) have been identified in eukaryotes.  The homodimer MutS1 and heterodimers MSH2-MSH3 and MSH2-MSH6 are primarily involved in mitotic mismatch repair, whereas MSH4-MSH5 is involved in resolution of Holliday junctions during meiosis.  All members of the MutS family contain the highly conserved Walker A/B ATPase domain, and many share a common mechanism of action.  MutS1, MSH2-MSH3, MSH2-MSH6, and MSH4-MSH5 dimerize to form sliding clamps, a
Probab=100.00  E-value=0  Score=479.52  Aligned_cols=199  Identities=27%  Similarity=0.491  Sum_probs=186.4

Q ss_pred             EECCCCCHHHHHHHHHCCCCCEEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHH-HCCCC
Q ss_conf             00004680588763102877044434563587777664399996778440789999999999999719853035-32068
Q gi|254780750|r  613 IVKDGRHPIVEKTLKQQSSKPFIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPAS-YAHIG  691 (920)
Q Consensus       613 ~i~~gRHPviE~~l~~~~~~~fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~-~a~i~  691 (920)
                      .|++||||+++.     ..+.|||||+.++     .+.+++||||||||||||||||+|+++||||+||||||+ .+.+|
T Consensus         1 ki~~~rHPll~~-----~~~~~V~Ndi~l~-----~~~~~~iiTGpN~sGKSt~lk~i~l~~iLAq~G~~vpa~~~~~~~   70 (200)
T cd03280           1 RLREARHPLLPL-----QGEKVVPLDIQLG-----ENKRVLVITGPNAGGKTVTLKTLGLLTLMAQSGLPIPAAEGSSLP   70 (200)
T ss_pred             CCCCCCCCEEEC-----CCCCEECCEEEEC-----CCCEEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEECCCEECC
T ss_conf             987772885975-----7895476258977-----993399998898775099999999999999977780011004726


Q ss_pred             CCCEEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECC
Q ss_conf             22105676523766113853289999999999995899856999325889880567999999999999726984999748
Q gi|254780750|r  692 IVDKLFSRVGSADNLASGRSTFMVEMIETASILNQATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATH  771 (920)
Q Consensus       692 ~~D~IftRiGa~D~l~~g~STF~vEm~e~~~IL~~at~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTH  771 (920)
                      +||+||||||..|++..|+|||+.||.+++.|+++++++||||+||+||||++.||.|+|||++++|.++ +|+++|+||
T Consensus        71 ~~d~i~~~i~~~d~~~~~~S~F~~E~~~~~~il~~~~~~sLvliDE~~~gTn~~eg~~~a~a~l~~l~~~-~~~~i~tTH  149 (200)
T cd03280          71 VFENIFADIGDEQSIEQSLSTFSSHMKNIARILQHADPDSLVLLDELGSGTDPVEGAALAIAILEELLER-GALVIATTH  149 (200)
T ss_pred             CCCEEEEEECCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHC-CCEEEEECC
T ss_conf             6567888846733666778799999999999998588888797556668988789999999999999857-997999897


Q ss_pred             CHHHHHHHHHCCCEEEEEEEEEEECCEEEEEEEEEECCCCCCHHHHHHHHCCC
Q ss_conf             75797664306885899999996099277877774478988778999998299
Q gi|254780750|r  772 FHELTDLSKSLKRFHNATLQVSDSNEGIIFLHKVIPGIADHSYGIQVGKLAGL  824 (920)
Q Consensus       772 y~eL~~l~~~~~~v~n~~~~~~~~~~~i~flykl~~G~~~~Sygi~vA~laG~  824 (920)
                      ||+|+.+....+++.|+||+++++  ++.|+|||++|+|++|||++||+++|+
T Consensus       150 ~~eL~~l~~~~~~v~~~~~~~d~~--~l~~~YKl~~G~~~~s~al~ia~~~Gi  200 (200)
T cd03280         150 YGELKAYAYKREGVENASMEFDPE--TLKPTYRLLIGVPGRSNALEIARRLGL  200 (200)
T ss_pred             CHHHHHHHHHCCCEEEEEEEEECC--CCEEEEEEEECCCCCCHHHHHHHHCCC
T ss_conf             178998775135627889999888--267989981489998699999998589


No 19 
>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch.  Members of the MutS family also possess a conserved ATPase activity that belongs to the ATP binding cassette (ABC) superfamily.  MutS homologs (MSH) have been identified in most prokaryotic and all eukaryotic organisms examined.  Prokaryotes have two homologs (MutS1 and MutS2), whereas seven MSH proteins (MSH1 to MSH7) have been identified in eukaryotes.  The homodimer MutS1 and heterodimers MSH2-MSH3 and MSH2-MSH6 are primarily involved in mitotic mismatch repair, whereas MSH4-MSH5 is involved in resolution of Holliday junctions during meiosis.  All members of the MutS family contain the highly conserved Walker A/B ATPase domain, and many share a common mechanism of action.  MutS1, MSH2-MSH3, MSH2-MSH6, and MSH4-MSH5 dimerize to form sliding clamps, and recognition of specific DNA stru
Probab=100.00  E-value=0  Score=479.01  Aligned_cols=202  Identities=49%  Similarity=0.837  Sum_probs=192.7

Q ss_pred             EECCCCCHHHHHHHHHCCCCCEEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHCCCCC
Q ss_conf             00004680588763102877044434563587777664399996778440789999999999999719853035320682
Q gi|254780750|r  613 IVKDGRHPIVEKTLKQQSSKPFIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHIGI  692 (920)
Q Consensus       613 ~i~~gRHPviE~~l~~~~~~~fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a~i~~  692 (920)
                      +|++||||++|....   .+.|||||+.|+      ..+++||||||||||||||||+|++++|||+||||||++|++++
T Consensus         1 ~i~~~rHPlle~~~~---~~~~VpNdi~l~------~~~~~iiTGpN~sGKSt~lkti~l~~~laq~G~~vpa~~~~~~~   71 (202)
T cd03243           1 EIKGGRHPVLLALTK---GETFVPNDINLG------SGRLLLITGPNMGGKSTYLRSIGLAVLLAQIGCFVPAESASIPL   71 (202)
T ss_pred             CCCCCCCCEEEEECC---CCCEECCEEEEC------CCCEEEEECCCCCCHHHHHHHHHHHHHHHHHCCEEEECCCEEEC
T ss_conf             977574866853437---897787828867------98289998998875399999999999999838737204468944


Q ss_pred             CCEEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCC
Q ss_conf             21056765237661138532899999999999958998569993258898805679999999999997269849997487
Q gi|254780750|r  693 VDKLFSRVGSADNLASGRSTFMVEMIETASILNQATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHF  772 (920)
Q Consensus       693 ~D~IftRiGa~D~l~~g~STF~vEm~e~~~IL~~at~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy  772 (920)
                      ||+|||+|+..|++..|+|||+.||.+++.|+++++++||||+||+|+||++.||.|||+|++++|.++ +|+++|||||
T Consensus        72 ~~~i~~~~~~~d~~~~~~S~F~~e~~~~~~i~~~~~~~slvliDE~~~gT~~~eg~~la~a~l~~l~~~-~~~~i~tTH~  150 (202)
T cd03243          72 VDRIFTRIGAEDSISDGRSTFMAELLELKEILSLATPRSLVLIDELGRGTSTAEGLAIAYAVLEHLLEK-GCRTLFATHF  150 (202)
T ss_pred             CCEEEEEECCCHHHHCCCCHHHHHHHHHHHHHHHCCCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHC-CCEEEEEECC
T ss_conf             666999846602444353549999999999998677777242052347998678799999999999853-6849998253


Q ss_pred             HHHHHHHHHCCCEEEEEEEEEEECCEEEEEEEEEECCCCCCHHHHHHHHCCC
Q ss_conf             5797664306885899999996099277877774478988778999998299
Q gi|254780750|r  773 HELTDLSKSLKRFHNATLQVSDSNEGIIFLHKVIPGIADHSYGIQVGKLAGL  824 (920)
Q Consensus       773 ~eL~~l~~~~~~v~n~~~~~~~~~~~i~flykl~~G~~~~Sygi~vA~laG~  824 (920)
                      |+|+++....++++|+||+++..+++++|+|||.+|+|++|||+++||++|+
T Consensus       151 ~~L~~~~~~~~~~~~~~~~~~~~~~~~~~~Ykl~~G~~~~s~ai~ia~~~Gl  202 (202)
T cd03243         151 HELADLPEQVPGVKNLHMEELITTGGLTFTYKLIDGICDPSYALQIAELAGL  202 (202)
T ss_pred             HHHHHHHHCCCCEEEEEEEEEEECCEEEEEEEECCCCCCCCHHHHHHHHCCC
T ss_conf             8888753138974999999999799086988988899986599999998589


No 20 
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes.  The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch.  Members of the MutS family possess C-terminal domain with a conserved ATPase activity that belongs to the ATP binding cassette (ABC) superfamily.  MutS homologs (MSH) have been identified in most prokaryotic and all eukaryotic organisms examined.  Prokaryotes have two homologs (MutS1 and MutS2), whereas seven MSH proteins (MSH1 to MSH7) have been identified in eukaryotes.  The homodimer MutS1 and heterodimers MSH2-MSH3 and MSH2-MSH6 are primarily involved in mitotic mismatch repair, whereas MSH4-MSH5 is involved in resolution of Holliday junctions during meiosis.  All members of the MutS family contain the highly conserved Walker A/B ATPase domain, and many share a common mechanism of action.  MutS1, MSH2-MSH3, MSH2-MSH6, and MSH4-MSH5 dimerize to form slid
Probab=100.00  E-value=0  Score=465.82  Aligned_cols=197  Identities=30%  Similarity=0.433  Sum_probs=184.3

Q ss_pred             EECCCCCHHHHHHHHHCCCCCEEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHCCCCC
Q ss_conf             00004680588763102877044434563587777664399996778440789999999999999719853035320682
Q gi|254780750|r  613 IVKDGRHPIVEKTLKQQSSKPFIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHIGI  692 (920)
Q Consensus       613 ~i~~gRHPviE~~l~~~~~~~fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a~i~~  692 (920)
                      +++++|||+++.       +++||||+.|+      ..+++||||||||||||||||+|++++|||+||||||+++.+++
T Consensus         1 E~k~~rHPll~~-------~~~V~Ndi~l~------~~~~~iiTGpN~~GKSt~Lk~i~l~~ilaq~G~~vpa~~~~~~~   67 (199)
T cd03283           1 EAKNLGHPLIGR-------EKRVANDIDME------KKNGILITGSNMSGKSTFLRTIGVNVILAQAGAPVCASSFELPP   67 (199)
T ss_pred             CCCCCCCCCCCC-------CCCCCCCEEEC------CCCEEEEECCCCCCHHHHHHHHHHHHHHHHHCCEEEHHHEEECC
T ss_conf             944368883478-------98327725767------98589998999986599999999999999968938624478233


Q ss_pred             CCEEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHCCC--CCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEEC
Q ss_conf             2105676523766113853289999999999995899--85699932588988056799999999999972698499974
Q gi|254780750|r  693 VDKLFSRVGSADNLASGRSTFMVEMIETASILNQATN--QSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLAT  770 (920)
Q Consensus       693 ~D~IftRiGa~D~l~~g~STF~vEm~e~~~IL~~at~--~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaT  770 (920)
                       ++|||||+..||+..|+|||+.||.+++.|++.+++  +||||+||+||||++.||.|||+|++|||.++ +|+++|||
T Consensus        68 -~~i~t~i~~~d~~~~~~S~F~~E~~~~~~il~~~~~~~~sLvliDEl~~GT~~~eg~a~a~a~le~l~~~-~~~~iitT  145 (199)
T cd03283          68 -VKIFTSIRVSDDLRDGISYFYAELRRLKEIVEKAKKGEPVLFLLDEIFKGTNSRERQAASAAVLKFLKNK-NTIGIIST  145 (199)
T ss_pred             -CEEEEEEECCCHHHCCCCHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHHHHHHHHHHHHHHC-CCEEEEEC
T ss_conf             -0899998347512245357999999999999972489857996143247998678999999999999867-98799988


Q ss_pred             CCHHHHHHHHHCCCEEEEEEEEEEECCEEEEEEEEEECCCCCCHHHHHHHHCCC
Q ss_conf             875797664306885899999996099277877774478988778999998299
Q gi|254780750|r  771 HFHELTDLSKSLKRFHNATLQVSDSNEGIIFLHKVIPGIADHSYGIQVGKLAGL  824 (920)
Q Consensus       771 Hy~eL~~l~~~~~~v~n~~~~~~~~~~~i~flykl~~G~~~~Sygi~vA~laG~  824 (920)
                      |||+|+.+.+..+.+.|+||.+...+++++|+|||.+|+|+.|||++|||++|+
T Consensus       146 H~~~l~~~~~~~~~v~~~~~~~~~~~~~~~~~Ykl~~G~~~~s~a~~vak~~Gl  199 (199)
T cd03283         146 HDLELADLLDLDSAVRNYHFREDIDDNKLIFDYKLKPGVSPTRNALRLMKKIGI  199 (199)
T ss_pred             CCHHHHHHHCCCCCEEEEEEEEEEECCEEEEEEEECCCCCCCCHHHHHHHHCCC
T ss_conf             728988643248773899999999999871885977689987199999998589


No 21 
>smart00534 MUTSac ATPase domain of DNA mismatch repair MUTS family.
Probab=100.00  E-value=0  Score=466.87  Aligned_cols=185  Identities=55%  Similarity=0.863  Sum_probs=180.7

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHCCCCCCCEEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHCCCCC
Q ss_conf             99996778440789999999999999719853035320682210567652376611385328999999999999589985
Q gi|254780750|r  652 LWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHIGIVDKLFSRVGSADNLASGRSTFMVEMIETASILNQATNQS  731 (920)
Q Consensus       652 ~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a~i~~~D~IftRiGa~D~l~~g~STF~vEm~e~~~IL~~at~~S  731 (920)
                      ++||||||||||||||||+|++++|||+||||||++|++++||+||||||..|++.+|+|||+.||.+++.|+++++++|
T Consensus         1 v~iiTGpN~sGKSt~lk~i~l~~~laq~G~~vpa~~~~~~~~d~i~~~i~~~d~~~~~~S~F~~e~~~~~~il~~~~~~s   80 (185)
T smart00534        1 VVIITGPNMGGKSTYLRQVGLIVIMAQIGSFVPAESAELPVFDRIFTRIGASDSLAQGLSTFMVEMKETANILKNATENS   80 (185)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHHHHHHHCCCEEECCCEEECCCEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHCCCCE
T ss_conf             98997999884899999999999999978886157719950310023356410021564189999999999998389873


Q ss_pred             EEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHCCCEEEEEEEEEEECCEEEEEEEEEECCCC
Q ss_conf             69993258898805679999999999997269849997487579766430688589999999609927787777447898
Q gi|254780750|r  732 FVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFHELTDLSKSLKRFHNATLQVSDSNEGIIFLHKVIPGIAD  811 (920)
Q Consensus       732 LVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~~l~~~~~~v~n~~~~~~~~~~~i~flykl~~G~~~  811 (920)
                      |||+||+||||++.||.|+|+|+++||.++.+|+++||||||+|+++.+..+++.|+||.+++++++++|+|||.+|+|+
T Consensus        81 LvliDEl~~GT~~~eg~ala~aile~l~~~~~~~~iitTH~~eL~~~~~~~~~v~~~~~~~~~~~~~l~~~Ykl~~G~~~  160 (185)
T smart00534       81 LVLLDELGRGTSTYDGVAIAAAVLEYLLEKIGALTLFATHYHELTKLADEHPGVRNLHMSADEETENLTFLYKLTPGVAG  160 (185)
T ss_pred             EEEECCCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHHHHHHHHCCCCEEEEEEEEECCCCEEEEEEECCCCCC
T ss_conf             76304113688814789999999999996369759986043789998874732000246776417834178886138999


Q ss_pred             CCHHHHHHHHCCCCHHHHHHHHHHH
Q ss_conf             8778999998299989999999999
Q gi|254780750|r  812 HSYGIQVGKLAGLPNTVISRAYDIL  836 (920)
Q Consensus       812 ~Sygi~vA~laG~p~~vi~~A~~~~  836 (920)
                      +|||+++|+++|+|++||+||++++
T Consensus       161 ~s~ai~ia~~~G~p~~ii~rA~~il  185 (185)
T smart00534      161 KSYGIEVAKLAGLPKEVIERAKEIL  185 (185)
T ss_pred             CCHHHHHHHHHCCCHHHHHHHHHHC
T ss_conf             7299999999492999999999759


No 22 
>COG1193 Mismatch repair ATPase (MutS family) [DNA replication, recombination, and repair]
Probab=100.00  E-value=0  Score=432.44  Aligned_cols=480  Identities=23%  Similarity=0.290  Sum_probs=379.7

Q ss_pred             HHHCCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCHHHHHHHHHH-HHHCHHHHHHH
Q ss_conf             76301234337899998631002345678989999997402212588999997520483444456775-21000021206
Q gi|254780750|r  316 KTIDYSITGAGGRLFAERIASPLTDSTKINTRLDSINFFIQNPILINPIQKILKSSPDVPRSLSRLKI-GRGEPKDIAVI  394 (920)
Q Consensus       316 ~~Ln~t~T~~G~RlLr~wL~~PL~d~~~I~~R~daVe~l~~~~~~~~~l~~~L~~i~DleRll~ri~~-~~~~p~dl~~L  394 (920)
                      .+..++.|+.|.-.|+.  +.|..|.+.|+..++-+.++.........  -.+.++.|+--.+.|+-. +..++.++..+
T Consensus        15 ~~~~~~~s~~g~~~~~~--l~p~~~~~~i~~~~~e~~~~~~~~~~~g~--~~~~~l~~i~~~l~~~e~g~~l~~~el~~i   90 (753)
T COG1193          15 LLASYAQSSLGLEELKN--LKPRTDLELIEEELSETAEALDILEDEGL--PPLGGLNDVSEALGRLEKGGRLHVEELLEI   90 (753)
T ss_pred             HHHHHCCCHHHHHHHHH--CCCCCCHHHHHHHHHHHHHHHHHHHCCCC--CCCHHHHHHHHHHHHHHHCCCCCHHHHHHH
T ss_conf             99985468789999982--68654389998777778999998724688--881125545789898864243789999999


Q ss_pred             HHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEECCCCCCHHHHHHHHHHHHHHH
Q ss_conf             89999986556754302584577876765776789999999998543101221046010168541145579988638999
Q gi|254780750|r  395 RDGIRSGINILNLFLKNDLPEELRGAVEKLKKLPQSLEKTLSSMLSDDLPTFKRDGGFLRDGADASLDETRSLRDQSKRI  474 (920)
Q Consensus       395 ~~sl~~~~~i~~~l~~~~~~~~l~~~~~~l~~l~~~l~~~l~~~i~~~~~~~~~~~~~ik~g~d~eLD~lr~~~~~~~~~  474 (920)
                      .+.+.....+...+.......  ......+..+. .++..+.        ....+++.+++..+..|+.+|.........
T Consensus        91 ~~~l~~~~~lkr~~~~~e~~~--~~~~~~~~~~~-~l~~~i~--------~~id~~g~i~d~as~~l~~ir~~lr~~~~~  159 (753)
T COG1193          91 SDFLRGFRALKRAIKKLERIK--RTLALALIELS-DLELEIN--------IPIDDDGLIKDRASFELDAIRRQLRDLEEE  159 (753)
T ss_pred             HHHHHHHHHHHHHHHHHHHHH--HHHHHHHHCCH-HHHHHHH--------HHHCCCCCCCCCCCHHHHHHHHHHHHHHHH
T ss_conf             999877999999999865678--88987510300-7999976--------410554443332058999988536779999


Q ss_pred             HHHHHHHHHHHCCCCCC--CCCCCCCCEEEEEECCHHHHHCCCCCCCCCCEEEEEECCCCHHHHHH-HHHHHHHHHHHHH
Q ss_conf             99776877887388751--10255862237620411433344111687652798521200011134-5666433464377
Q gi|254780750|r  475 IASLQLKYAEETKIKNL--KIKHNNNLGYFIEVTSSSASVLKKDLESKDRFIHRQTMSNLTRFTTL-ELIDLENRITNAT  551 (920)
Q Consensus       475 l~~l~~~~~~~~~i~sL--ki~~n~~~gy~iEV~~~~~~~i~~~~~~~~~~i~~qt~~~~~Rf~t~-eL~~l~~~i~~~~  551 (920)
                      +.+....+......+.|  .+...+...|++.|.......++       ..++-++.++.+-|+.| ....+++++....
T Consensus       160 ir~~l~~~~~~~~~~~L~e~~v~~r~~r~vlpvk~~fk~~i~-------giv~d~sssg~tl~ieP~~vv~l~n~~~~l~  232 (753)
T COG1193         160 IRDKLESLIRSKEAKYLQDRIVTTRDGREVLPVKAEFKGAIK-------GIVHDTSSSGATLYIEPRSVVKLNNELRALL  232 (753)
T ss_pred             HHHHHHHHHHHHHHHHHHHCEEECCCCEEEEHHHHHHHHHCC-------CEEEECCCCCCEEEECCHHHHHHCCHHHHHH
T ss_conf             999999987331567634104861388588578887665158-------5585512465702225437776345766531


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEECCCCCCEEECCCCCHHHHHHHHHCCC
Q ss_conf             77764334478887654301125798888999867788778887752588512104787140000468058876310287
Q gi|254780750|r  552 NSALLIELESFEILSNAIIEQSESLDNASQVIAIIDISIALAILAKEQNYCRPIIDNSTNFIVKDGRHPIVEKTLKQQSS  631 (920)
Q Consensus       552 ~~~~~~e~~~~~~l~~~i~~~~~~l~~~~~~ia~lD~l~SlA~~a~~~~y~rP~i~~~~~l~i~~gRHPviE~~l~~~~~  631 (920)
                      .+....+..+...+...+.++.+.+..+...++++|++.+.+.++....+++|.+.+...+.+.++|||++..       
T Consensus       233 ~eE~~e~e~il~~lsa~v~~~~~~l~~~~~~~~~lD~i~Ak~~~~~~~~~v~P~~~~~~~l~l~~~~HPll~~-------  305 (753)
T COG1193         233 VEEDEEEERILRELSALVAPVIPELEILLEIIGELDFIEAKVRYAKALKGVKPDFSNDGVLELLDARHPLLKE-------  305 (753)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEECCCCCCCCCC-------
T ss_conf             4204759999998788875516789888988633488998999887650578866787038740244866765-------


Q ss_pred             CCEEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHC-CCCCCCEEEEEEECCCCCCCCC
Q ss_conf             704443456358777766439999677844078999999999999971985303532-0682210567652376611385
Q gi|254780750|r  632 KPFIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYA-HIGIVDKLFSRVGSADNLASGR  710 (920)
Q Consensus       632 ~~fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a-~i~~~D~IftRiGa~D~l~~g~  710 (920)
                        -||||+.++.     +-+.++|||||||||++.|+++|++++|||+|.|+||.+. ++++|++||+.||..++|.++.
T Consensus       306 --~v~~~i~~~~-----e~~~l~ITGpN~GGKtvtLKTlgl~~lm~q~gl~i~a~~gsei~~F~~i~aDIGDeQsIeqsL  378 (753)
T COG1193         306 --DVPNDLELGE-----ELDRLIITGPNTGGKTVTLKTLGLLRLMAQSGLPIPALEGSELPVFVKIFADIGDEQSIEQSL  378 (753)
T ss_pred             --CCCCCCCCCC-----CCCEEEEECCCCCCCEEHHHHHHHHHHHHHCCCCEECCCCCCCHHHHHHHHCCCCHHHHHHHH
T ss_conf             --5665422561-----212124764788760216998899999997689703267871042777652458388788887


Q ss_pred             CHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHCCCEEEEEE
Q ss_conf             32899999999999958998569993258898805679999999999997269849997487579766430688589999
Q gi|254780750|r  711 STFMVEMIETASILNQATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFHELTDLSKSLKRFHNATL  790 (920)
Q Consensus       711 STF~vEm~e~~~IL~~at~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~~l~~~~~~v~n~~~  790 (920)
                      |||..+|...+.||..++  |||++||+|.||++.+|.|+|.|+++|+.++ +|+++.+|||.+|..+..+.+++.|..|
T Consensus       379 STFSshm~~i~~il~~~d--sLvl~DElg~GTdp~EgaaLai~ile~l~~~-~~~~v~tTH~~elk~~~~~~~~v~nas~  455 (753)
T COG1193         379 STFSSHMTNIVEILEKAD--SLVLFDELGSGTDPDEGAALAIAILEDLLEK-PAKIVATTHYRELKALAAEREGVENASM  455 (753)
T ss_pred             HHHHHHHHHHHHHHHHCC--HHHHHHHHHCCCCCCHHHHHHHHHHHHHHHC-CCCEEHHHHHHHHHHHHHCCHHHHCHHH
T ss_conf             312889999999985311--5677787605788424377799889999862-4404257558999998721022211021


Q ss_pred             EEEEECCEEEEEEEEEECCCCCCHHHHHHHHCCCCHHHHHHHHHHH
Q ss_conf             9996099277877774478988778999998299989999999999
Q gi|254780750|r  791 QVSDSNEGIIFLHKVIPGIADHSYGIQVGKLAGLPNTVISRAYDIL  836 (920)
Q Consensus       791 ~~~~~~~~i~flykl~~G~~~~Sygi~vA~laG~p~~vi~~A~~~~  836 (920)
                      +++.+  .+..+|++..|++++||++++|...|+|..+|++|+...
T Consensus       456 ~fd~e--tL~ptY~l~~G~~g~S~Af~ia~rlGl~~~iie~a~~~~  499 (753)
T COG1193         456 EFDAE--TLRPTYRLLEGVPGRSNAFDIALRLGLPEPIIEEAKTEF  499 (753)
T ss_pred             HHHHH--HHHHHHHHHCCCCCCCHHHHHHHHCCCCHHHHHHHHHHC
T ss_conf             32387--766778876078661027999998399889999987750


No 23 
>pfam05192 MutS_III MutS domain III. This domain is found in proteins of the MutS family (DNA mismatch repair proteins) and is found associated with pfam00488, pfam05188, pfam01624 and pfam05190. The MutS family of proteins is named after the Salmonella typhimurium MutS protein involved in mismatch repair; other members of the family included the eukaryotic MSH 1,2,3, 4,5 and 6 proteins. These have various roles in DNA repair and recombination. Human MSH has been implicated in non-polyposis colorectal carcinoma (HNPCC) and is a mismatch binding protein. The aligned region corresponds with domain III, which is central to the structure of Thermus aquaticus MutS as characterized in.
Probab=100.00  E-value=0  Score=423.31  Aligned_cols=305  Identities=38%  Similarity=0.601  Sum_probs=275.1

Q ss_pred             CCEEEECCHHHCCEEEEECC-CCCCCCHHHHHHCCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCHHHHHHHH
Q ss_conf             54014251332015454127-87764127876301234337899998631002345678989999997402212588999
Q gi|254780750|r  287 QSTLFIDSAARSNLEILRTL-SGSREQSLLKTIDYSITGAGGRLFAERIASPLTDSTKINTRLDSINFFIQNPILINPIQ  365 (920)
Q Consensus       287 ~~~m~LD~~Tl~nLEI~~~~-~g~~~gSL~~~Ln~t~T~~G~RlLr~wL~~PL~d~~~I~~R~daVe~l~~~~~~~~~l~  365 (920)
                      ++||.||++|++||||++|. +|+++||||++||+|+|+||+|+||+||++|++|+++|++|||+|++|.+++.+++.++
T Consensus         1 ~~~m~lD~~tl~~Lei~~n~~~~~~~~SL~~~Ln~t~T~~G~RlLr~wl~~Pl~d~~~I~~R~d~Ve~l~~~~~~~~~l~   80 (306)
T pfam05192         1 EDYMLLDSATRRNLELVENLSGDGKNGSLFSVLDRTVTAMGSRLLRRWLLQPLRDREEINARLDAVEELLEDPELRQTLR   80 (306)
T ss_pred             CCCEECCHHHHHHHCCCCCCCCCCCCCCHHHHHCCCCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHCHHHHHHHH
T ss_conf             98453289999852688788899989839999656889088999999985816699999999999999985989999999


Q ss_pred             HHHHHHCCHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99752048344445677521000021206899999865567543025845778767657767899999999985431012
Q gi|254780750|r  366 KILKSSPDVPRSLSRLKIGRGEPKDIAVIRDGIRSGINILNLFLKNDLPEELRGAVEKLKKLPQSLEKTLSSMLSDDLPT  445 (920)
Q Consensus       366 ~~L~~i~DleRll~ri~~~~~~p~dl~~L~~sl~~~~~i~~~l~~~~~~~~l~~~~~~l~~l~~~l~~~l~~~i~~~~~~  445 (920)
                      ..|++++|+||+++|++.++++|+++..+++++..++.+...+.....+............ ...+.+.+...+..+.+.
T Consensus        81 ~~Lk~i~Dlerl~~ri~~~~~~~~~~~~l~~~l~~i~~i~~~l~~~~~~~~~~~~~~~~~~-~~~~~~~i~~~i~~~~~~  159 (306)
T pfam05192        81 ELLKRVPDLERLLSRLALGRANPRDLLRLRDSLERLPTIKELLEELDSPLLLKELRKSIDD-LSELLDLLETAINEDPPL  159 (306)
T ss_pred             HHHHCCCCHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHCCCC-HHHHHHHHHHHHHCCHHH
T ss_conf             9986489789999999828978899999999999999999999857884678888744234-899999999998246176


Q ss_pred             HHCCCCEECCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCEEEEEECCHHHHHCCCCCCCCCCEEE
Q ss_conf             21046010168541145579988638999997768778873887511025586223762041143334411168765279
Q gi|254780750|r  446 FKRDGGFLRDGADASLDETRSLRDQSKRIIASLQLKYAEETKIKNLKIKHNNNLGYFIEVTSSSASVLKKDLESKDRFIH  525 (920)
Q Consensus       446 ~~~~~~~ik~g~d~eLD~lr~~~~~~~~~l~~l~~~~~~~~~i~sLki~~n~~~gy~iEV~~~~~~~i~~~~~~~~~~i~  525 (920)
                      ...++++|++|++++||++|..+++..+.+.++..+++++++++++++.|++..||++++|+.....+|      ..|+.
T Consensus       160 ~~~~~~~i~~g~~~~LD~~~~~~~~~~~~l~~~~~~~~~~~~~~~l~~~~~~~~g~~i~~~~~~~~~~p------~~~~~  233 (306)
T pfam05192       160 LIREGGVIKSGYDAELDELRDLRDEAKEWIAELEAKEREETGIDSLKIGYNKVGGYYIEVTKSNADLLP------KHFIR  233 (306)
T ss_pred             HCCCCCEECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEECCCEEEEEEECCCHHCCCC------CCCEE
T ss_conf             556788548998878999999999789999999999999818986125665822799986031010286------40024


Q ss_pred             EEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             8521200011134566643346437777764334478887654301125798888999867788778887752
Q gi|254780750|r  526 RQTMSNLTRFTTLELIDLENRITNATNSALLIELESFEILSNAIIEQSESLDNASQVIAIIDISIALAILAKE  598 (920)
Q Consensus       526 ~qt~~~~~Rf~t~eL~~l~~~i~~~~~~~~~~e~~~~~~l~~~i~~~~~~l~~~~~~ia~lD~l~SlA~~a~~  598 (920)
                      .++.++.+||++|++.++..++.++.+++...+.+++.++.+.+.++.+.|..+++++|+|||++|||.+|.+
T Consensus       234 ~~~~k~~~~f~t~~l~~l~~~l~~~~~~i~~~~~~i~~~l~~~~~~~~~~l~~~~~~ia~LD~l~S~A~vA~e  306 (306)
T pfam05192       234 RQTLKNAERFTTPELKELEDKILNAEERILALEKELFEELRERVVEHAEPLQALAEALAELDVLVSFAELAAE  306 (306)
T ss_pred             EEECCCEEEEECHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             4301571588568899999999999999999999999999999999999999999999999999999999578


No 24 
>smart00533 MUTSd DNA-binding domain of DNA mismatch repair MUTS family.
Probab=100.00  E-value=0  Score=410.12  Aligned_cols=307  Identities=34%  Similarity=0.488  Sum_probs=269.8

Q ss_pred             CCHHHHHHCCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCHHHHHHHHHHHHHCHHH
Q ss_conf             41278763012343378999986310023456789899999974022125889999975204834444567752100002
Q gi|254780750|r  311 EQSLLKTIDYSITGAGGRLFAERIASPLTDSTKINTRLDSINFFIQNPILINPIQKILKSSPDVPRSLSRLKIGRGEPKD  390 (920)
Q Consensus       311 ~gSL~~~Ln~t~T~~G~RlLr~wL~~PL~d~~~I~~R~daVe~l~~~~~~~~~l~~~L~~i~DleRll~ri~~~~~~p~d  390 (920)
                      +||||++||+|+|+||+|+||+||++|++|+++|++|||+|++|.+++.+++.++..|++++|+||+++|+..++++|.+
T Consensus         1 kgSL~~~ln~t~T~~G~RlLr~wl~~Pl~d~~~I~~R~~~Ve~l~~~~~~~~~l~~~L~~i~Dlerl~~k~~~~~~~~~~   80 (308)
T smart00533        1 KGSLFELLNHTKTPMGKRLLRRWLLQPLLDLKEINERLDAVEELVENPELRQKLRQLLKRIPDLERLLSRIERGRASPRD   80 (308)
T ss_pred             CCCHHHHHCCCCCHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHCHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCHHH
T ss_conf             96668886678893899999999867179999999999999999819799999999987489889999999948998899


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEECCCCCCHHHHHHHHHHH
Q ss_conf             12068999998655675430258457787676577678999999999854310122104601016854114557998863
Q gi|254780750|r  391 IAVIRDGIRSGINILNLFLKNDLPEELRGAVEKLKKLPQSLEKTLSSMLSDDLPTFKRDGGFLRDGADASLDETRSLRDQ  470 (920)
Q Consensus       391 l~~L~~sl~~~~~i~~~l~~~~~~~~l~~~~~~l~~l~~~l~~~l~~~i~~~~~~~~~~~~~ik~g~d~eLD~lr~~~~~  470 (920)
                      +..+++++..+..+...+..... .........+..........+...+.+.......++++|++|++++||.+|..+++
T Consensus        81 ~~~l~~~l~~~~~i~~~l~~~~~-~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~i~~g~~~~Ld~l~~~~~~  159 (308)
T smart00533       81 LLRLYDSLEGLKEIRQLLESLDG-PLLGLLLKVILEPLLELLELLLELLNDDDPLEVNDGGLIKDGFDPELDELREKLEE  159 (308)
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCC-HHHHHHHHHHCCCHHHHHHHHHHHHHCCCHHHCCCCCEECCCCCHHHHHHHHHHHH
T ss_conf             99999999999999999985776-24899998753113999999999873457755667783389989899999999999


Q ss_pred             HHHHHHHHHHHHHHHCCCCCCCCCCCCCCEEEEEECCHHHHHCCCCCCCCCCEEEEEECCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             89999977687788738875110255862237620411433344111687652798521200011134566643346437
Q gi|254780750|r  471 SKRIIASLQLKYAEETKIKNLKIKHNNNLGYFIEVTSSSASVLKKDLESKDRFIHRQTMSNLTRFTTLELIDLENRITNA  550 (920)
Q Consensus       471 ~~~~l~~l~~~~~~~~~i~sLki~~n~~~gy~iEV~~~~~~~i~~~~~~~~~~i~~qt~~~~~Rf~t~eL~~l~~~i~~~  550 (920)
                      ..+.+.++...++++.+++++++.+++..||+|+||++....+|      ..|+..+++++..+|+++++.+++.++.++
T Consensus       160 ~~~~l~~~~~~~~~~~~~~~~~~~~~~~~g~~i~v~~~~~~~~~------~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~  233 (308)
T smart00533      160 LEEELEELLKKEREELGIDSLKLGYNKVHGYYIEVTKSEAKKVP------KDFIRRSSLKNTERFTTPELKELENELLEA  233 (308)
T ss_pred             HHHHHHHHHHHHHHHHCCCHHHCCCCCCCEEEEEEECHHHCCCC------CCCEEEEECCCCEEEEECHHHHHHHHHHHH
T ss_conf             99999999999999838851221636772289998630311597------301134404771799800388999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEECCCCCCEEECCCCCHHHHH
Q ss_conf             77776433447888765430112579888899986778877888775258851210478714000046805887
Q gi|254780750|r  551 TNSALLIELESFEILSNAIIEQSESLDNASQVIAIIDISIALAILAKEQNYCRPIIDNSTNFIVKDGRHPIVEK  624 (920)
Q Consensus       551 ~~~~~~~e~~~~~~l~~~i~~~~~~l~~~~~~ia~lD~l~SlA~~a~~~~y~rP~i~~~~~l~i~~gRHPviE~  624 (920)
                      .+++...+.+++.++.+.+.++.+.|..+++++|+|||++|||.+|..++||||+|++++.+.|++||||+||.
T Consensus       234 ~~~i~~~~~~i~~~l~~~~~~~~~~l~~~~~~ia~LD~l~S~A~~a~~~~~~rP~i~~~~~l~i~~~RHPllE~  307 (308)
T smart00533      234 KEEIERLEKEILRELLEKVLEYLEELRALAEALAELDVLLSLATLAAEGNYVRPEFVDSGELEIKNGRHPVLEL  307 (308)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEECCCCCEEEEECCCCEEEC
T ss_conf             99999999999999999999999999999999999999999999983787889577489868999786884618


No 25 
>pfam01624 MutS_I MutS domain I. This domain is found in proteins of the MutS family (DNA mismatch repair proteins) and is found associated with pfam00488, pfam05188, pfam05192 and pfam05190. The MutS family of proteins is named after the Salmonella typhimurium MutS protein involved in mismatch repair; other members of the family included the eukaryotic MSH 1,2,3, 4,5 and 6 proteins. These have various roles in DNA repair and recombination. Human MSH has been implicated in non-polyposis colorectal carcinoma (HNPCC) and is a mismatch binding protein. The aligned region corresponds with globular domain I, which is involved in DNA binding, in Thermus aquaticus MutS as characterized in.
Probab=100.00  E-value=5e-38  Score=302.52  Aligned_cols=113  Identities=58%  Similarity=1.004  Sum_probs=107.6

Q ss_pred             CHHHHHHHHHHHHCCCCEEEEEECCCHHHHHHHHHHHHHHHCCEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEE
Q ss_conf             91689999999877992999980882220079999999861818910788998887626561766999999999889859
Q gi|254780750|r   26 TPMMRQYIEIKSINPDSLVFYRMGDFYELFFDDALLASRCLGITLTKRGKHLGKDIPMCGVPVHTANHYIQKLIKIGHRI  105 (920)
Q Consensus        26 TP~~~Qy~~iK~~~~D~il~fr~G~FYE~f~~DA~~aa~~L~i~lt~r~~~~~~~~pmaGvP~~~l~~yl~~Lv~~GykV  105 (920)
                      ||||+|||+||++|||||||||||+|||+|++||+++|++|||++|.|++..++++||||||+|++++|+++|+++||||
T Consensus         1 tp~~~Qy~~iK~~~~d~vvl~qvG~FYE~y~~DA~~~a~~l~i~lt~~~~~~~~~~~m~GfP~~~l~~y~~~Lv~~G~~V   80 (113)
T pfam01624         1 TPMMRQYLELKSKYPDAVLFFRVGDFYELFGEDAEIAARELGITLTVRGGGSGKRIPMAGVPEHAFETYLRRLVNKGYKV   80 (113)
T ss_pred             CHHHHHHHHHHHHCCCEEEEEEECCCHHHHHHHHHHHHHHHCCEEEECCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCEE
T ss_conf             90899999999879886999984885787886299999861818851256788875344775005999999999879979


Q ss_pred             EEEEECCCHHHHHHCCCCCCEEEEEEEEECCCCEECCH
Q ss_conf             99950289788741289984554589997753030201
Q gi|254780750|r  106 AICEQIESPLEAKKRGNKSLVRRNVVRLVTPGTLTEDQ  143 (920)
Q Consensus       106 aiveQ~E~p~~~~~~~~~~~v~R~Vt~IiTpGT~~d~~  143 (920)
                      |||||+|+|..     ++++++|+||+||||||++|++
T Consensus        81 ~i~eQ~e~~~~-----~~~~~~R~vt~i~TpGT~~d~e  113 (113)
T pfam01624        81 AICEQTEDPAE-----AKGVVKREVVRVITPGTLTDEE  113 (113)
T ss_pred             EEEEECCCCCC-----CCCCCEEEEEEEECCCCCCCCC
T ss_conf             99996258423-----5896246588999997565889


No 26 
>cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport.  These families are characterised by the fact that the ABC subunit is made up of duplicated, fused ABC modules (ABC2).  No known transmembrane proteins or domains are associated with these proteins.
Probab=100.00  E-value=3.2e-34  Score=274.09  Aligned_cols=156  Identities=30%  Similarity=0.321  Sum_probs=132.4

Q ss_pred             ECCCCCHHHHHHHHHCCCCCEEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHCCCCCC
Q ss_conf             00046805887631028770444345635877776643999967784407899999999999997198530353206822
Q gi|254780750|r  614 VKDGRHPIVEKTLKQQSSKPFIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHIGIV  693 (920)
Q Consensus       614 i~~gRHPviE~~l~~~~~~~fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a~i~~~  693 (920)
                      +.-+|||.           .|||||+.++      ++++++|||||||||||+||++|++++|||.|+++||..+....+
T Consensus         2 ~~~~~~~~-----------~~vpndi~l~------~g~~~iItGpN~sGKSt~Lr~i~l~~~~a~~~~~~~~~~~~~~~~   64 (162)
T cd03227           2 IVLGRFPS-----------YFVPNDVTFG------EGSLTIITGPNGSGKSTILDAIGLALGGAQSATRRRSGVKAGCIV   64 (162)
T ss_pred             CCHHCCCC-----------CEECCCEECC------CCCEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHHCCCCC
T ss_conf             01310899-----------7507702608------986899989987757999999999999863267752555427764


Q ss_pred             CEEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHCC--CCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECC
Q ss_conf             10567652376611385328999999999999589--9856999325889880567999999999999726984999748
Q gi|254780750|r  694 DKLFSRVGSADNLASGRSTFMVEMIETASILNQAT--NQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATH  771 (920)
Q Consensus       694 D~IftRiGa~D~l~~g~STF~vEm~e~~~IL~~at--~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTH  771 (920)
                      ..+.....   ....+.|+|+.||.+++.+|..+.  ++||+|+||+|+||++.||.+||++|++++. . +|.++|+||
T Consensus        65 ~~~~~~~~---~~~~~lSgg~~~~~~l~~~l~~~~~~~~~lillDE~~~Gtd~~~~~~l~~~i~~~~~-~-~~~~i~tTH  139 (162)
T cd03227          65 AAVSAELI---FTRLQLSGGEKELSALALILALASLKPRPLYILDEIDRGLDPRDGQALAEAILEHLV-K-GAQVIVITH  139 (162)
T ss_pred             HHHEEEEE---ECCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCCCCHHHHHHHHHHHHHHHH-C-CCEEEEECC
T ss_conf             02305766---412000542999999999998542489848996365579998899999999999997-6-998999797


Q ss_pred             CHHHHHHHHHCCCEEEEEEE
Q ss_conf             75797664306885899999
Q gi|254780750|r  772 FHELTDLSKSLKRFHNATLQ  791 (920)
Q Consensus       772 y~eL~~l~~~~~~v~n~~~~  791 (920)
                      ||||+++++.+.+++|.|+.
T Consensus       140 ~~eL~~lad~~~~~~~~~~~  159 (162)
T cd03227         140 LPELAELADKLIHIKKVITG  159 (162)
T ss_pred             HHHHHHHHHHHCCEEEEEEE
T ss_conf             39999998750074787750


No 27 
>pfam05188 MutS_II MutS domain II. This domain is found in proteins of the MutS family (DNA mismatch repair proteins) and is found associated with pfam00488, pfam01624, pfam05192 and pfam05190. The MutS family of proteins is named after the Salmonella typhimurium MutS protein involved in mismatch repair; other members of the family included the eukaryotic MSH 1,2,3, 4,5 and 6 proteins. These have various roles in DNA repair and recombination. Human MSH has been implicated in non-polyposis colorectal carcinoma (HNPCC) and is a mismatch binding protein. This domain corresponds to domain II in Thermus aquaticus MutS as characterized in, and has similarity resembles RNAse-H-like domains (see pfam00075).
Probab=99.78  E-value=1e-17  Score=150.88  Aligned_cols=129  Identities=28%  Similarity=0.445  Sum_probs=109.1

Q ss_pred             CEEEEEEEC-CCEEEEEEEECCCCEEEEEECC-HHHHHHHHHHCCCCEEEEECCCCCHHH-HHHHHHHCCCCEECCCCCC
Q ss_conf             369999952-9849999999786559996058-789999985229857997077689678-9988742388157185211
Q gi|254780750|r  151 NYLMAVARI-RTEWAIAWIDISTGIFKISTSN-HDRLISDIMRIDPREIIFSEKELSHAE-YKSLFETLGNVAVAQPNVF  227 (920)
Q Consensus       151 nyL~aI~~~-~~~~Gia~iDisTG~~~~~~~~-~d~l~~~L~~l~P~EIii~~~~~~~~~-~~~l~~~~~~~~~~~~~~~  227 (920)
                      |||+||+.. +..||+||+|+|||+|.+++++ .+++.++|.|++|+|||++++..+... ............+..+.|.
T Consensus         1 NyL~ai~~~~~~~~glA~~DiSTGef~~~~~~~~~~l~~el~r~~P~Eiii~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   80 (133)
T pfam05188         1 NYLAAISRGDGNRYGLAFLDLSTGEFGVSEFEDFEELLAELSRLSPKELLLPESLSSSTVAESQKLLELRLRVGRRPTWL   80 (133)
T ss_pred             CEEEEEEECCCCEEEEEEEECCCCCEEEEECCCHHHHHHHHHHCCCCEEEECCCCCCCHHHHHHHHHHCCCCEEECCCCC
T ss_conf             97999998799859999999677967888528999999999825994899534422001566777640365317567532


Q ss_pred             CCHHHHHHHHHHHCCCCCCCCHHH-HHHHHHHHHHHHHHHHHHHHCCCCCCCC
Q ss_conf             471344788998708786421024-4434688877776436874112222221
Q gi|254780750|r  228 FDHSISESRIADYYNITTVDTFGS-FSQVEKTAAAAAISYIKKTQMVNKPTIG  279 (920)
Q Consensus       228 f~~~~~~~~l~~~~~~~~l~~~~~-~~~~~~~a~~all~Yl~~~~~~~~~~i~  279 (920)
                      |+...+.+.+.++|++.+++++|. ..+.+++|+|++|.|+++||+..++|++
T Consensus        81 f~~~~a~~~l~~~f~~~~l~~~g~~~~~~~i~A~galL~Yl~~Tqk~~L~hi~  133 (133)
T pfam05188        81 FELEHAYEDLNEDFGVEDLDGFGLEELPLALCAAGALISYLKETQKENLPHIQ  133 (133)
T ss_pred             CCHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCHHCC
T ss_conf             48899999999983858764468766668999999999999999671624219


No 28 
>pfam05190 MutS_IV MutS family domain IV. This domain is found in proteins of the MutS family (DNA mismatch repair proteins) and is found associated with pfam01624, pfam05188, pfam05192 and pfam00488. The mutS family of proteins is named after the Salmonella typhimurium MutS protein involved in mismatch repair; other members of the family included the eukaryotic MSH 1,2,3, 4,5 and 6 proteins. These have various roles in DNA repair and recombination. Human MSH has been implicated in non-polyposis colorectal carcinoma (HNPCC) and is a mismatch binding protein. The aligned region corresponds in part with globular domain IV, which is involved in DNA binding, in Thermus aquaticus MutS as characterized in.
Probab=99.61  E-value=2.8e-16  Score=140.03  Aligned_cols=91  Identities=41%  Similarity=0.544  Sum_probs=86.5

Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCEEEEEECCHHHHHCCCCCCCCCCEEEEEECCCCHHH
Q ss_conf             85411455799886389999977687788738875110255862237620411433344111687652798521200011
Q gi|254780750|r  456 GADASLDETRSLRDQSKRIIASLQLKYAEETKIKNLKIKHNNNLGYFIEVTSSSASVLKKDLESKDRFIHRQTMSNLTRF  535 (920)
Q Consensus       456 g~d~eLD~lr~~~~~~~~~l~~l~~~~~~~~~i~sLki~~n~~~gy~iEV~~~~~~~i~~~~~~~~~~i~~qt~~~~~Rf  535 (920)
                      |||++||++|.+.+++.++|.+++.++++++||++||++||+++|||||||+++...+|      +.|+++||++|++||
T Consensus         1 G~d~eLD~lr~~~~~~~~~l~~l~~~~~~~~gi~~LKi~~n~~~Gy~ieV~~~~~~~vp------~~~i~~qt~kn~~Rf   74 (92)
T pfam05190         1 GFDEELDELRDLLEELESELDELLAKERERLGIKSLKVGYNKVFGYYIEVTRSEAKKVP------KDYIRRQTLKNGVRF   74 (92)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEECCEEEEEEEECHHHHHCCC------HHHHHHHHHHCCEEE
T ss_conf             98879999999998589999999999999939973999774688999996044341296------779999846076355


Q ss_pred             HHHHHHHHHHHHHHHHH
Q ss_conf             13456664334643777
Q gi|254780750|r  536 TTLELIDLENRITNATN  552 (920)
Q Consensus       536 ~t~eL~~l~~~i~~~~~  552 (920)
                      +|++|.+++.++.++++
T Consensus        75 tt~eL~~le~~~~~a~e   91 (92)
T pfam05190        75 TTPELKKLEDELLEAEE   91 (92)
T ss_pred             CCHHHHHHHHHHHHHCC
T ss_conf             58899999999984035


No 29 
>KOG0219 consensus
Probab=99.47  E-value=1.5e-15  Score=134.60  Aligned_cols=222  Identities=7%  Similarity=-0.161  Sum_probs=180.0

Q ss_pred             ECCCCCHHHHHHHHHCCCCCEEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHH-CCCCC
Q ss_conf             00046805887631028770444345635877776643999967784407899999999999997198530353-20682
Q gi|254780750|r  614 VKDGRHPIVEKTLKQQSSKPFIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASY-AHIGI  692 (920)
Q Consensus       614 i~~gRHPviE~~l~~~~~~~fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~-a~i~~  692 (920)
                      -.+.+||+|+.    +..-.+.||+..+-++.+.    ....|+|||+|++|||+|+|-.|-++++||.||+.= ++.|.
T Consensus       626 E~Qd~~~fIpN----dv~le~~~~~~~IiTGpNM----GGKSTyir~~Gvi~lmAQIGcfVPce~A~i~IvD~Il~RVGA  697 (902)
T KOG0219         626 EGQDEIPFIPN----DVVLEKGKCRMLIITGPNM----GGKSTYIRQVGVIVLMAQIGCFVPCESATISIVDGILTRVGA  697 (902)
T ss_pred             HCCCCCCCCCC----CCCCCCCCCEEEEEECCCC----CCCCHHHHHHHHHHHHHHHCCCEEHHHCCCCHHHHHHHHHCC
T ss_conf             12456777777----5400157751899857886----763021213369999998188235655387601678764164


Q ss_pred             CCEEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCC
Q ss_conf             21056765237661138532899999999999958998569993258898805679999999999997269849997487
Q gi|254780750|r  693 VDKLFSRVGSADNLASGRSTFMVEMIETASILNQATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHF  772 (920)
Q Consensus       693 ~D~IftRiGa~D~l~~g~STF~vEm~e~~~IL~~at~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy  772 (920)
                      =|..+. -++.+-..++.++||.+|.+.+.++.-++..+....+|.|+++++.++.-++|+.+.+|.....|.+.+.+|+
T Consensus       698 ~D~q~k-G~STFM~Emleta~Ilr~at~~SliiiDELGRGTSt~DGfgiAwai~ehi~~ki~cf~lfATHfhElt~lae~  776 (902)
T KOG0219         698 GDSQLK-GISTFMAEMLETASILRRATKNSLIIIDELGRGTSTYDGFGIAWAIAEHIATKIGCFCLFATHFHELTKLAEQ  776 (902)
T ss_pred             CHHHHC-CHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCEECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             415432-3178999999999999856878289981367874300476178999999998875868778678888766531


Q ss_pred             HHHHHHHHHCCCEEEEEEEEEEECCEEEEEEEEEECCCCCCHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             579766430688589999999609927787777447898877899999829998999999999999987630001111
Q gi|254780750|r  773 HELTDLSKSLKRFHNATLQVSDSNEGIIFLHKVIPGIADHSYGIQVGKLAGLPNTVISRAYDILKTFEKLYHHNQKDM  850 (920)
Q Consensus       773 ~eL~~l~~~~~~v~n~~~~~~~~~~~i~flykl~~G~~~~Sygi~vA~laG~p~~vi~~A~~~~~~le~~~~~~~~~~  850 (920)
                      |+-+........+.|      ++-.-+.-.|.-+.|.+..+++.++|..+..|-+..+.+.+-+++++.....+.+..
T Consensus       777 ~~~vKn~h~~a~i~~------~~~~llY~V~~Gv~d~SFGi~VA~~a~fp~~vie~A~~~~~ele~~~~~~e~k~kKe  848 (902)
T KOG0219         777 LPTVKNLHVTAQIEN------DDITLLYKVFEGVCDQSFGIHVAELVGFPEHVIEMAKQKAEELEDELVIKESKEKKE  848 (902)
T ss_pred             HHHHHHHEEEEEECC------CCHHHHHHHHCCCCCCCCHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             035531000367647------630129988522225751146787718975779999999987778774431666787


No 30 
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide-binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=98.62  E-value=5.9e-07  Score=70.37  Aligned_cols=124  Identities=29%  Similarity=0.370  Sum_probs=77.2

Q ss_pred             EEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHCCCCCCCE---------EEEEEECCCC
Q ss_conf             4434563587777664399996778440789999999999999719853035320682210---------5676523766
Q gi|254780750|r  635 IANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHIGIVDK---------LFSRVGSADN  705 (920)
Q Consensus       635 VpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a~i~~~D~---------IftRiGa~D~  705 (920)
                      +-+|+++..    ..+.+..|.|||.+||||++|.++-+.        -| .+-++.+...         +--+||--..
T Consensus        14 ~l~~i~~~i----~~Ge~~~i~G~nGaGKSTLl~~l~gl~--------~~-~~G~i~~~g~~~~~~~~~~~~~~i~~v~Q   80 (157)
T cd00267          14 ALDNVSLTL----KAGEIVALVGPNGSGKSTLLRAIAGLL--------KP-TSGEILIDGKDIAKLPLEELRRRIGYVPQ   80 (157)
T ss_pred             EEEEEEEEE----CCCCEEEEECCCCCCHHHHHHHHHCCC--------CC-CCCEEEECCEECCCCCHHHHHHCCCCCCC
T ss_conf             782117898----799799998788999899999995884--------79-96289999999997999999940608766


Q ss_pred             CCCCCCHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHH
Q ss_conf             11385328999999999999589985699932588988056799999999999972698499974875797664
Q gi|254780750|r  706 LASGRSTFMVEMIETASILNQATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFHELTDLS  779 (920)
Q Consensus       706 l~~g~STF~vEm~e~~~IL~~at~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~~l~  779 (920)
                      |+.|    |.-...+|..|  +..-.++|+||...|.++.....+.. .+..+.+. +...+++||..+.....
T Consensus        81 LSgG----qkqrv~iA~al--~~~p~ililDEPtsgLD~~~~~~l~~-~i~~l~~~-g~tii~vtH~~~~~~~~  146 (157)
T cd00267          81 LSGG----QRQRVALARAL--LLNPDLLLLDEPTSGLDPASRERLLE-LLRELAEE-GRTVIIVTHDPELAELA  146 (157)
T ss_pred             CCHH----HHHHHHHHHHH--HCCCCEEEEECCCCCCCHHHHHHHHH-HHHHHHHC-CCEEEEEECCHHHHHHH
T ss_conf             8869----99999999999--70999999969876689999999999-99999968-99999990899999997


No 31 
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion.  Recognition and cleavage of the damaged DNA is a multistep ATP-dependent reaction that requires the UvrA, UvrB, and UvrC proteins.  Both UvrA and UvrB are ATPases, with UvrA having two ATP binding sites, which have the characteristic signature of the family of ABC proteins, and UvrB having one ATP binding site that is structurally related to that of helicases.
Probab=98.47  E-value=2.8e-06  Score=65.31  Aligned_cols=140  Identities=22%  Similarity=0.203  Sum_probs=74.5

Q ss_pred             EEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHC-CCCCCCEE--EEEEECCC-CCCC--
Q ss_conf             443456358777766439999677844078999999999999971985303532-06822105--67652376-6113--
Q gi|254780750|r  635 IANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYA-HIGIVDKL--FSRVGSAD-NLAS--  708 (920)
Q Consensus       635 VpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a-~i~~~D~I--ftRiGa~D-~l~~--  708 (920)
                      +=+|+++..    ..+.+..|.|||-+||||+++......--.....+.|.-.. .+-.+|.+  +.++|-.. .+-+  
T Consensus        10 aL~~isl~i----~~Ge~~~iiG~nGsGKSTLl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~l~~~~   85 (176)
T cd03238          10 NLQNLDVSI----PLNVLVVVTGVSGSGKSTLVNEGLYASGKARLISFLPKFSRNKLIFIDQLQFLIDVGLGYLTLGQKL   85 (176)
T ss_pred             CCCCEEEEE----CCCCEEEEECCCCCCHHHHHHHHHHHHHCCHHHCCHHHCCCCCEEEHHHHHHHHHCCCCCCCCCCCC
T ss_conf             467548788----8998999999999989999998887610311203210137553688577999997488667789916


Q ss_pred             -CCCHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHH
Q ss_conf             -853289999999999995899856999325889880567999999999999726984999748757976643
Q gi|254780750|r  709 -GRSTFMVEMIETASILNQATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFHELTDLSK  780 (920)
Q Consensus       709 -g~STF~vEm~e~~~IL~~at~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~~l~~  780 (920)
                       ..|--+---..+|..|-.-.+.+++|+||--.|-++..-..| +.++..|.+. +..++++||..++.++++
T Consensus        86 ~~LSGGqkQRvaiAraL~~~p~~~ililDEPtsgLD~~~~~~l-~~~l~~l~~~-g~TvI~vtHd~~~~~~aD  156 (176)
T cd03238          86 STLSGGELQRVKLASELFSEPPGTLFILDEPSTGLHQQDINQL-LEVIKGLIDL-GNTVILIEHNLDVLSSAD  156 (176)
T ss_pred             CCCCHHHHHHHHHHHHHHHCCCCCEEEECCCCCCCCHHHHHHH-HHHHHHHHHC-CCEEEEEECCHHHHHHCC
T ss_conf             8689999999999999986899868997177445898799999-9999999987-998999947879998399


No 32 
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity.  In bacteria and archaea, these transporters usually include an ATP-binding protein and one or two integral membrane proteins.  Eukaryote systems of the ABCA subfamily display ABC domains that are quite similar to this family.  The ATP-binding domain shows the highest similarity between all members of the ABC transporter family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=98.28  E-value=1.6e-05  Score=59.61  Aligned_cols=127  Identities=24%  Similarity=0.365  Sum_probs=72.7

Q ss_pred             EEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHCCCCCCC--------------------
Q ss_conf             443456358777766439999677844078999999999999971985303532068221--------------------
Q gi|254780750|r  635 IANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHIGIVD--------------------  694 (920)
Q Consensus       635 VpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a~i~~~D--------------------  694 (920)
                      |=+|++|..    ..+.+.-|-|||-+||||+||.++        |..-| ++-++.+..                    
T Consensus        15 ~L~~vsl~i----~~Gei~gl~G~NGaGKSTLl~~i~--------Gl~~p-~~G~i~i~g~~~~~~~~~~~~~ig~v~q~   81 (173)
T cd03230          15 ALDDISLTV----EKGEIYGLLGPNGAGKTTLIKIIL--------GLLKP-DSGEIKVLGKDIKKEPEEVKRRIGYLPEE   81 (173)
T ss_pred             EEECEEEEE----CCCCEEEEECCCCCCHHHHHHHHH--------CCCCC-CCCEEEECCEECCCCHHHHHCCEEEEECC
T ss_conf             982208788----799399998789979999999997--------68577-87889999999886848886578999568


Q ss_pred             -EEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCH
Q ss_conf             -0567652376611385328999999999999589985699932588988056799999999999972698499974875
Q gi|254780750|r  695 -KLFSRVGSADNLASGRSTFMVEMIETASILNQATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFH  773 (920)
Q Consensus       695 -~IftRiGa~D~l~~g~STF~vEm~e~~~IL~~at~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~  773 (920)
                       .+|..+-..|++.  .|.=|--....|..  -+..-.++|+||--.|=++.--..+ |.++..+.+. ++-++++||..
T Consensus        82 ~~l~~~ltv~e~l~--LSgG~kqrv~ia~a--l~~~p~lllLDEPt~gLD~~~~~~i-~~~i~~l~~~-g~tvi~~tH~l  155 (173)
T cd03230          82 PSLYENLTVRENLK--LSGGMKQRLALAQA--LLHDPELLILDEPTSGLDPESRREF-WELLRELKKE-GKTILLSSHIL  155 (173)
T ss_pred             CCCCCCCCHHHHHH--CCHHHHHHHHHHHH--HHCCCCEEEECCCCCCCCHHHHHHH-HHHHHHHHHC-CCEEEEECCCH
T ss_conf             76671267789863--39899999999999--9649999999088657999999999-9999999968-99999992838


Q ss_pred             HHH-HHHH
Q ss_conf             797-6643
Q gi|254780750|r  774 ELT-DLSK  780 (920)
Q Consensus       774 eL~-~l~~  780 (920)
                      +.. .+++
T Consensus       156 ~~~~~~~d  163 (173)
T cd03230         156 EEAERLCD  163 (173)
T ss_pred             HHHHHHCC
T ss_conf             99998699


No 33 
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional
Probab=98.27  E-value=3.6e-05  Score=57.05  Aligned_cols=52  Identities=23%  Similarity=0.177  Sum_probs=34.8

Q ss_pred             CCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHH
Q ss_conf             8998569993258898805679999999999997269849997487579766430
Q gi|254780750|r  727 ATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFHELTDLSKS  781 (920)
Q Consensus       727 at~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~~l~~~  781 (920)
                      +.+..++|+||--.|=++. +...-+..++.+.+. +..++++|| |+|..+++.
T Consensus       145 ~~~p~lllLDEPt~~LD~~-~~~~l~~~l~~~~~~-g~~vi~~tH-~dl~~~ad~  196 (204)
T PRK13538        145 LTRAPLWILDEPFTAIDKQ-GVARLEQLLAQHAEQ-GGMVILTTH-QDLPGASDK  196 (204)
T ss_pred             HCCCCEEEEECCCCCCCHH-HHHHHHHHHHHHHHC-CCEEEEEEC-HHHHHHCCE
T ss_conf             6099989997886578999-999999999999858-998999986-698987699


No 34 
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component.  Biosynthesis of iron-sulfur clusters (Fe-S) depends on multiprotein systems.  The SUF system of E. coli and Erwinia chrysanthemi is important for Fe-S biogenesis under stressful conditions.  The SUF system is made of six proteins: SufC is an atypical cytoplasmic ABC-ATPase, which forms a complex with SufB and SufD; SufA plays the role of a scaffold protein for assembly of iron-sulfur clusters and delivery to target proteins; SufS is a cysteine desulfurase which mobilizes the sulfur atom from cysteine and provides it to the cluster; SufE has no associated function yet.
Probab=98.24  E-value=4.4e-05  Score=56.44  Aligned_cols=137  Identities=27%  Similarity=0.289  Sum_probs=79.4

Q ss_pred             EEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHH-HHHHHCCCCC----------CHHHCCCCCC--C---EEE
Q ss_conf             4443456358777766439999677844078999999999-9999719853----------0353206822--1---056
Q gi|254780750|r  634 FIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALI-VIMAQMGSYV----------PASYAHIGIV--D---KLF  697 (920)
Q Consensus       634 fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~-vilAQiG~fV----------PA~~a~i~~~--D---~If  697 (920)
                      -|=+|++|..    ..+.+.-|-|||-+||||++|.++=. .+-..-|.-.          |.+.++.+++  -   ..|
T Consensus        14 ~vL~~vsl~v----~~Gei~~iiGpnGaGKSTLl~~i~G~~~~~~~~G~I~~~g~~i~~~~~~~~~~~gi~~~~q~~~~~   89 (200)
T cd03217          14 EILKGVNLTI----KKGEVHALMGPNGSGKSTLAKTIMGHPKYEVTEGEILFKGEDITDLPPEERARLGIFLAFQYPPEI   89 (200)
T ss_pred             EEEECCEEEE----CCCCEEEEECCCCCCHHHHHHHHCCCCCCCCCCCEEEECCEECCCCCHHHHHHCCEEEECCCHHHC
T ss_conf             9885505688----799899999689999999999970777778520079999999886999999976948963676870


Q ss_pred             EEEECCC---CCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHH
Q ss_conf             7652376---6113853289999999999995899856999325889880567999999999999726984999748757
Q gi|254780750|r  698 SRVGSAD---NLASGRSTFMVEMIETASILNQATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFHE  774 (920)
Q Consensus       698 tRiGa~D---~l~~g~STF~vEm~e~~~IL~~at~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~e  774 (920)
                      ..+...|   ++..+.|-=+.-...+|..|-  ..-.++|+||--.|=++. ....-|.++..+.+. ++-++++||+.+
T Consensus        90 ~~~~~~~~l~~~~~~LSGGekqrv~iaral~--~~P~lllLDEPtsgLD~~-~~~~i~~~i~~l~~~-g~tiiiitH~~~  165 (200)
T cd03217          90 PGVKNADFLRYVNEGFSGGEKKRNEILQLLL--LEPDLAILDEPDSGLDID-ALRLVAEVINKLREE-GKSVLIITHYQR  165 (200)
T ss_pred             CCCCHHHHHHHHCCCCCHHHHHHHHHHHHHH--HCCCEEEEECCCCCCCHH-HHHHHHHHHHHHHHC-CCEEEEEEECHH
T ss_conf             7984999997646367999999999999996--099999996962269999-999999999999857-999999996368


Q ss_pred             HHHH
Q ss_conf             9766
Q gi|254780750|r  775 LTDL  778 (920)
Q Consensus       775 L~~l  778 (920)
                      +...
T Consensus       166 ~~~~  169 (200)
T cd03217         166 LLDY  169 (200)
T ss_pred             HHHH
T ss_conf             7766


No 35 
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters.  PDR is a well-described phenomenon occurring in fungi and shares several similarities with processes in bacteria and higher eukaryotes.  This PDR subfamily represents domain I of its (ABC-IM)2 organization.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules.  The nucleotide-binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=98.24  E-value=2.8e-05  Score=57.91  Aligned_cols=130  Identities=20%  Similarity=0.237  Sum_probs=66.4

Q ss_pred             EEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHH-----------------------HHHHCCCCCCHHHCCC-
Q ss_conf             4434563587777664399996778440789999999999-----------------------9997198530353206-
Q gi|254780750|r  635 IANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIV-----------------------IMAQMGSYVPASYAHI-  690 (920)
Q Consensus       635 VpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~v-----------------------ilAQiG~fVPA~~a~i-  690 (920)
                      |=+|+++..    ..+.+..|.|||-+||||+||.++=..                       ...+++ |||.+...+ 
T Consensus        22 vL~~is~~i----~~Gei~~llG~nGsGKSTLl~~l~G~~~~~~~~~G~i~~~g~~~~~~~~~~~~~~~-~v~q~~~~~~   96 (202)
T cd03233          22 ILKDFSGVV----KPGEMVLVLGRPGSGCSTLLKALANRTEGNVSVEGDIHYNGIPYKEFAEKYPGEII-YVSEEDVHFP   96 (202)
T ss_pred             EEECEEEEE----CCCEEEEEECCCCCCHHHHHHHHHCCCCCCCCEEEEEEECCEECCHHHHHHHCCEE-EECCCCCCCC
T ss_conf             997708898----09849999989999889999998378789875137999999994051486420199-9867322376


Q ss_pred             --CCCCEE-EE-EEECCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEE
Q ss_conf             --822105-67-65237661138532899999999999958998569993258898805679999999999997269849
Q gi|254780750|r  691 --GIVDKL-FS-RVGSADNLASGRSTFMVEMIETASILNQATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRG  766 (920)
Q Consensus       691 --~~~D~I-ft-RiGa~D~l~~g~STF~vEm~e~~~IL~~at~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~  766 (920)
                        ++.+.+ |. +. ..|...++.|.=+--...+|..  -+..-+++|+||--.|-++.....| |..+..+.+..+..+
T Consensus        97 ~ltv~e~l~~~~~~-~~~~~~~~LSgGqkqRv~iA~a--L~~~P~illlDEPt~gLD~~~~~~i-~~~l~~l~~~~~~t~  172 (202)
T cd03233          97 TLTVRETLDFALRC-KGNEFVRGISGGERKRVSIAEA--LVSRASVLCWDNSTRGLDSSTALEI-LKCIRTMADVLKTTT  172 (202)
T ss_pred             CCCHHHHHHHHHHH-CCCCCCCCCCHHHHHHHHHHHH--HHHCCCEEEEECCCCCCCHHHHHHH-HHHHHHHHHHCCCEE
T ss_conf             88099999999984-6587444589999999999999--9529988998387656899999999-999999998779989


Q ss_pred             EEECCCH
Q ss_conf             9974875
Q gi|254780750|r  767 LLATHFH  773 (920)
Q Consensus       767 lfaTHy~  773 (920)
                      +++||.+
T Consensus       173 ii~~~~~  179 (202)
T cd03233         173 FVSLYQA  179 (202)
T ss_pred             EEEEECC
T ss_conf             9999069


No 36 
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos).  The Carb_Monos family is involved in the uptake of monosaccharides, such as pentoses (such as xylose, arabinose, and ribose) and hexoses (such as xylose, arabinose, and ribose), that cannot be broken down to simple sugars by hydrolysis.  Pentoses include xylose, arabinose, and ribose.  Important hexoses include glucose, galactose, and fructose.  In members of the Carb_monos family, the single hydrophobic gene product forms a homodimer while the ABC protein represents a fusion of two nucleotide-binding domains.  However, it is assumed that two copies of the ABC domains are present in the assembled transporter.
Probab=98.23  E-value=4e-05  Score=56.73  Aligned_cols=130  Identities=25%  Similarity=0.284  Sum_probs=78.0

Q ss_pred             EEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHCCCCCCCEEEEEEECCCCCCCC----
Q ss_conf             4443456358777766439999677844078999999999999971985303532068221056765237661138----
Q gi|254780750|r  634 FIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHIGIVDKLFSRVGSADNLASG----  709 (920)
Q Consensus       634 fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a~i~~~D~IftRiGa~D~l~~g----  709 (920)
                      .|=+|++|..    ..+.+.-|.|||-+||||++|.++        |..-| ++-++.+..+-.+.....|....|    
T Consensus        14 ~aL~~vsl~i----~~Gei~~lvG~nGaGKSTl~~~i~--------Gl~~p-~~G~i~i~G~~i~~~~~~~~~~~gi~~v   80 (163)
T cd03216          14 KALDGVSLSV----RRGEVHALLGENGAGKSTLMKILS--------GLYKP-DSGEILVDGKEVSFASPRDARRAGIAMV   80 (163)
T ss_pred             EEECCEEEEE----CCCCEEEEECCCCCCHHHHHHHHH--------CCCCC-CCCEEEECCEECCCCCHHHHHHCCCCEE
T ss_conf             9885548898----799899999889989999999995--------77689-8578999999999999999998799489


Q ss_pred             --CCHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHH-HHHHH
Q ss_conf             --532899999999999958998569993258898805679999999999997269849997487579-76643
Q gi|254780750|r  710 --RSTFMVEMIETASILNQATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFHEL-TDLSK  780 (920)
Q Consensus       710 --~STF~vEm~e~~~IL~~at~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~eL-~~l~~  780 (920)
                        .|-=|--....+..|  +.+-.++|+||--.|=++..-..+ |.++..+.+. ++-.+|+||.-+. .++++
T Consensus        81 ~qLSgG~~Qrv~iaral--~~~p~llilDEPt~gLD~~~~~~i-~~~l~~l~~~-G~til~vtH~l~~~~~~~D  150 (163)
T cd03216          81 YQLSVGERQMVEIARAL--ARNARLLILDEPTAALTPAEVERL-FKVIRRLRAQ-GVAVIFISHRLDEVFEIAD  150 (163)
T ss_pred             CCCCHHHHHHHHHHHHH--HHCCCEEEEECCCCCCCHHHHHHH-HHHHHHHHHC-CCEEEEEECCHHHHHHHCC
T ss_conf             46998999999999999--729999999097557999999999-9999999878-9899999384999998699


No 37 
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional
Probab=98.23  E-value=0.00023  Score=50.98  Aligned_cols=153  Identities=18%  Similarity=0.196  Sum_probs=73.1

Q ss_pred             CEECCCCCCEEECCCCCHHHHHHHHHCCCCCEEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCC
Q ss_conf             12104787140000468058876310287704443456358777766439999677844078999999999999971985
Q gi|254780750|r  603 RPIIDNSTNFIVKDGRHPIVEKTLKQQSSKPFIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSY  682 (920)
Q Consensus       603 rP~i~~~~~l~i~~gRHPviE~~l~~~~~~~fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~f  682 (920)
                      -|.=+..+.|.+++...-         -+..-|=+++++..    +.+.+..|.|||-+||||+||.++=+. -.+-|.-
T Consensus         3 ~p~~~~~P~L~~~~ls~~---------~~~~~vl~~isf~v----~~Ge~~~l~GpNGaGKTTLlr~l~Gl~-~p~~G~I   68 (214)
T PRK13543          3 EPLHTAPPLLAAHALAFS---------RNEEPVFGPLDFHV----DAGEALLVQGDNGAGKTTLLRVLAGLL-HVESGQI   68 (214)
T ss_pred             CCCCCCCCEEEEEEEEEE---------ECCEEEEECEEEEE----CCCCEEEEECCCCCCHHHHHHHHHCCC-CCCCEEE
T ss_conf             988999975999827999---------79999982638898----189899999999987999999997697-7884199


Q ss_pred             C----CHHHCCCCCCCEEEEEEECCCCCCCCCCHH-----------------------------------------HHHH
Q ss_conf             3----035320682210567652376611385328-----------------------------------------9999
Q gi|254780750|r  683 V----PASYAHIGIVDKLFSRVGSADNLASGRSTF-----------------------------------------MVEM  717 (920)
Q Consensus       683 V----PA~~a~i~~~D~IftRiGa~D~l~~g~STF-----------------------------------------~vEm  717 (920)
                      .    |....   -..+...-++-...+....+++                                         +---
T Consensus        69 ~~~g~~~~~~---~~~~~~~~~~~~~~l~~~lt~~enl~~~~~l~~~~~~~~~~~~l~~~gl~~~~~~~~~~LSgGqkqR  145 (214)
T PRK13543         69 QIDGKTATRG---DRSRFMAYLGHLPGLKADLSTLENLHFLCGLHGRRAKQMPGSALAIVGLAGYEDALVRQLSAGQRKR  145 (214)
T ss_pred             EECCEECCCH---HHCCEEEEECCCCCCCCCCCHHHHHHHHHHHCCCCHHHHHHHHHHHCCCCCHHCCCHHHCCHHHHHH
T ss_conf             9999999754---0213589980145446887699999999862587799999999998699440007823489999999


Q ss_pred             HHHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHH
Q ss_conf             99999999589985699932588988056799999999999972698499974875797
Q gi|254780750|r  718 IETASILNQATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFHELT  776 (920)
Q Consensus       718 ~e~~~IL~~at~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~  776 (920)
                      ...+..  -+.+..++|+||--.|=++ ++..+-+.++..+.+. +..+|++||..+..
T Consensus       146 v~lA~a--l~~~p~illLDEPt~~LD~-~~~~~l~~~l~~~~~~-g~tvl~~tHd~~~~  200 (214)
T PRK13543        146 LALARL--WLSPAPLWLLDEPYANLDL-EGITLVNRMISAHLRG-GGAALVTTHGAYAA  200 (214)
T ss_pred             HHHHHH--HHCCCCEEEEECCCCCCCH-HHHHHHHHHHHHHHHC-CCEEEEECCCHHHH
T ss_conf             999999--8579999998099888999-9999999999999867-99999991998999


No 38 
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional
Probab=98.22  E-value=7.9e-05  Score=54.51  Aligned_cols=128  Identities=20%  Similarity=0.211  Sum_probs=69.8

Q ss_pred             EEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHCC-C-----C-CCCEEEEEEECCCCCCC
Q ss_conf             434563587777664399996778440789999999999999719853035320-6-----8-22105676523766113
Q gi|254780750|r  636 ANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAH-I-----G-IVDKLFSRVGSADNLAS  708 (920)
Q Consensus       636 pNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a~-i-----~-~~D~IftRiGa~D~l~~  708 (920)
                      -+|++++.    ..+.+..|+|||-+||||++|.++        |..-|.+-.. +     . .-....+.+|-...+.-
T Consensus        16 l~disl~i----~~G~i~~i~G~NGsGKSTLlk~i~--------Gl~~p~~G~I~~~~~~~~~~~~~~~~~i~~~~~l~~   83 (195)
T PRK13541         16 LFDLSITF----LPSAITYIKGANGCGKSSLLRMIA--------GIMQPSSGNIYYKNCNINNIAKPYCTYIGHNLGLKL   83 (195)
T ss_pred             EEEEEEEE----CCCCEEEEECCCCCCHHHHHHHHH--------CCCCCCCEEEEECCEEHHHHCHHHCEEECCCCCCCC
T ss_conf             99777787----799799999999981999999996--------798898408999999920324635366355346787


Q ss_pred             CC---------------------------------------CHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHHHH
Q ss_conf             85---------------------------------------328999999999999589985699932588988056799
Q gi|254780750|r  709 GR---------------------------------------STFMVEMIETASILNQATNQSFVILDEIGRGTATLDGLS  749 (920)
Q Consensus       709 g~---------------------------------------STF~vEm~e~~~IL~~at~~SLVllDElGrGTst~DG~a  749 (920)
                      ..                                       |.=|--....|..  -+.+..++|+||--.|=+. ++..
T Consensus        84 ~ltv~enl~~~~~~~~~~~~~~~~l~~~~l~~~~~~~~~~LS~G~kqrv~iAra--l~~~p~llllDEPt~~LD~-~~~~  160 (195)
T PRK13541         84 EMTVFENLKFWSEIYNSVETLYAAIHYFKLHDLLDEKCYSLSSGMQKVVALARL--IACQSDLWLLDEVETNLSK-ENRD  160 (195)
T ss_pred             CCCHHHHHHHHHHHCCHHHHHHHHHHHCCCHHHHHCCHHHCCHHHHHHHHHHHH--HHHCCCEEEEECCCCCCCH-HHHH
T ss_conf             776999999999862839999999998498756648664599999999999999--9709999999787655999-9999


Q ss_pred             HHHHHHHHHHHHCCCEEEEECCCHHHHHHH
Q ss_conf             999999999972698499974875797664
Q gi|254780750|r  750 IAWATIEYLHETNRCRGLLATHFHELTDLS  779 (920)
Q Consensus       750 iA~aile~l~~~~~~~~lfaTHy~eL~~l~  779 (920)
                      ..+-++..+.+ .+..++++||..+..+-+
T Consensus       161 ~i~~li~~~~~-~g~~ili~sH~~~~i~~a  189 (195)
T PRK13541        161 LLNNLIVMKAN-SGGIVLLSSHLESSIKSA  189 (195)
T ss_pred             HHHHHHHHHHH-CCCEEEEECCCHHHHHHC
T ss_conf             99999999983-999999983798999419


No 39 
>cd03221 ABCF_EF-3 ABCF_EF-3  Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth.  EF-3 stimulates the binding of the EF-1: GTP: aa-tRNA ternary complex to the ribosomal A site by facilitated release of the deacylated tRNA from the E site.  The reaction requires ATP hydrolysis.  EF-3 contains two ATP nucleotide binding sequence (NBS) motifs.  NBSI is sufficient for the intrinsic ATPase activity. NBSII is essential for the ribosome-stimulated functions.
Probab=98.21  E-value=3.6e-05  Score=57.08  Aligned_cols=118  Identities=27%  Similarity=0.281  Sum_probs=68.8

Q ss_pred             EEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHCCCCCCCEEEEEEECCCCCCCCCCHH
Q ss_conf             44434563587777664399996778440789999999999999719853035320682210567652376611385328
Q gi|254780750|r  634 FIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHIGIVDKLFSRVGSADNLASGRSTF  713 (920)
Q Consensus       634 fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a~i~~~D~IftRiGa~D~l~~g~STF  713 (920)
                      .|=|++++..    ..+.+..|.|||-+||||++|.+        +|..-| .+-++.+-+++  +|+--+-++.|    
T Consensus        14 ~vl~~is~~i----~~ge~~~l~G~NGsGKTTl~~~l--------~G~~~~-~~G~i~~~~~~--~i~y~~QLSgG----   74 (144)
T cd03221          14 LLLKDISLTI----NPGDRIGLVGRNGAGKSTLLKLI--------AGELEP-DEGIVTWGSTV--KIGYFEQLSGG----   74 (144)
T ss_pred             EEEEEEEEEE----CCCCEEEEECCCCCCHHHHHHHH--------HCCCCC-CCEEEEECCCC--EEEEEHHCCHH----
T ss_conf             9996348998----79999999989998499999998--------489889-85099999960--89987007999----


Q ss_pred             HHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHH
Q ss_conf             9999999999995899856999325889880567999999999999726984999748757976
Q gi|254780750|r  714 MVEMIETASILNQATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFHELTD  777 (920)
Q Consensus       714 ~vEm~e~~~IL~~at~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~~  777 (920)
                        |...++-..--+.+..++|+||--.|=++   .+. ..+.+.|.+. +.-.+|+||..+...
T Consensus        75 --qkqr~~la~al~~~p~iliLDEPt~~LD~---~~~-~~i~~~l~~~-~~tii~vsHd~~~~~  131 (144)
T cd03221          75 --EKMRLALAKLLLENPNLLLLDEPTNHLDL---ESI-EALEEALKEY-PGTVILVSHDRYFLD  131 (144)
T ss_pred             --HHHHHHHHHHHCCCCCEEEEECCCCCCCH---HHH-HHHHHHHHHC-CCEEEEEECCHHHHH
T ss_conf             --99999999997259989999577555899---999-9999999970-999999967989999


No 40 
>PRK11144 modC molybdate transporter ATP-binding protein; Provisional
Probab=98.21  E-value=8.3e-06  Score=61.84  Aligned_cols=143  Identities=18%  Similarity=0.245  Sum_probs=84.8

Q ss_pred             CEEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHH--------------HHHHCCCCCCHHHCCCCCC---CE
Q ss_conf             044434563587777664399996778440789999999999--------------9997198530353206822---10
Q gi|254780750|r  633 PFIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIV--------------IMAQMGSYVPASYAHIGIV---DK  695 (920)
Q Consensus       633 ~fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~v--------------ilAQiG~fVPA~~a~i~~~---D~  695 (920)
                      .|.- |+++..    ..+.+.-|-|||-+||||+||.++=+.              ....-|-++|...-.++.+   .+
T Consensus        12 ~f~l-dv~l~i----~~g~i~~l~GpsGaGKTTLl~~iaGl~~p~~G~I~~~g~~~~~~~~~~~l~~~~r~ig~vfQ~~~   86 (352)
T PRK11144         12 QLCL-TVNLTL----PAQGITAIFGRSGAGKTSLINLISGLTRPQKGRIVLNGRVLFDAEKGICLPPEKRRIGYVFQDAR   86 (352)
T ss_pred             CEEE-EEEEEE----CCCCEEEEECCCCCHHHHHHHHHHCCCCCCCEEEEECCEECCCCCCCCCCCHHHCCEEEEECCCC
T ss_conf             9999-999998----89989999999996299999999768999965999999998555410137676688689935763


Q ss_pred             EEEEEECCCCCCCCCCHHH-------HHHHHHHHHHH-------------------HCCCCCEEEEECCCCCCCHHHHHH
Q ss_conf             5676523766113853289-------99999999999-------------------589985699932588988056799
Q gi|254780750|r  696 LFSRVGSADNLASGRSTFM-------VEMIETASILN-------------------QATNQSFVILDEIGRGTATLDGLS  749 (920)
Q Consensus       696 IftRiGa~D~l~~g~STF~-------vEm~e~~~IL~-------------------~at~~SLVllDElGrGTst~DG~a  749 (920)
                      +|-.+-..+|+.-|...-+       +|+.+....++                   -+++-.|+|+||--.|=+..--..
T Consensus        87 LfphltV~~Nl~~g~~~~~~~~~~~~~~~l~l~~l~~r~p~~LSGGq~QRvaiARAL~~~P~lLllDEP~s~LD~~~~~~  166 (352)
T PRK11144         87 LFPHYKVRGNLRYGMAKSMPAQFDKIVSLLGIEPLLDRYPGSLSGGEKQRVAIGRALLTAPELLLMDEPLASLDLPRKRE  166 (352)
T ss_pred             CCCCCCHHHHHHHHCHHHHHHHHHHHHHHCCCHHHHHCCHHHCCCCHHHHHHHHHHHHCCCCEEEECCCCCCCCHHHHHH
T ss_conf             37776889966510005659999999977599567627864659245234999998724999999878400279779999


Q ss_pred             HHHHHHHHHHHHCCCEEEEECCCHH-HHHHHHH
Q ss_conf             9999999999726984999748757-9766430
Q gi|254780750|r  750 IAWATIEYLHETNRCRGLLATHFHE-LTDLSKS  781 (920)
Q Consensus       750 iA~aile~l~~~~~~~~lfaTHy~e-L~~l~~~  781 (920)
                      | +..++.|.+..+.-++++||..+ ...+++.
T Consensus       167 i-~~~l~~l~~~~~~til~VTHd~~e~~~laD~  198 (352)
T PRK11144        167 L-LPYLERLAQEINIPILYVSHSLDEILRLADH  198 (352)
T ss_pred             H-HHHHHHHHHHHCCEEEEEECCHHHHHHHCCE
T ss_conf             9-9999999997398899993999999986999


No 41 
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters. PDR is a well-described phenomenon occurring in fungi and shares several similarities with processes in bacteria and higher eukaryotes.  This PDR subfamily represents domain I of its (ABC-IM)2 organization.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=98.15  E-value=0.00013  Score=53.02  Aligned_cols=136  Identities=19%  Similarity=0.178  Sum_probs=66.8

Q ss_pred             EEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHC----------CCCCCHHH-CCCCCCCE---EEEE
Q ss_conf             4443456358777766439999677844078999999999999971----------98530353-20682210---5676
Q gi|254780750|r  634 FIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQM----------GSYVPASY-AHIGIVDK---LFSR  699 (920)
Q Consensus       634 fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQi----------G~fVPA~~-a~i~~~D~---IftR  699 (920)
                      -|=+|+++..    ..+.+..|-|||-+||||+||.++-.   -..          |-.++... ..++.+.+   .|-.
T Consensus        21 ~vL~~is~~i----~~Ge~~~llGpnGaGKSTLl~~l~g~---~~~~~~~G~i~~~g~~~~~~~~~~igyv~q~~~~~~~   93 (192)
T cd03232          21 QLLNNISGYV----KPGTLTALMGESGAGKTTLLDVLAGR---KTAGVITGEILINGRPLDKNFQRSTGYVEQQDVHSPN   93 (192)
T ss_pred             EEEECCEEEE----ECCEEEEEECCCCCCHHHHHHHHHCC---CCCCCEEEEEEECCEECCHHHHHHEEEEECCHHCCCC
T ss_conf             9998838899----28839999999999889999998379---8788317899987827667756227999411330734


Q ss_pred             EECCCCC-----CCCCCHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCH-
Q ss_conf             5237661-----1385328999999999999589985699932588988056799999999999972698499974875-
Q gi|254780750|r  700 VGSADNL-----ASGRSTFMVEMIETASILNQATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFH-  773 (920)
Q Consensus       700 iGa~D~l-----~~g~STF~vEm~e~~~IL~~at~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~-  773 (920)
                      +-..+++     .++.|.=+.....+|.  --+.+-.++|+||--.|=++.--..| |..++.+.+. +..++++||.. 
T Consensus        94 ~tv~e~l~~~~~l~~LS~gqrqrv~iA~--aL~~~P~lllLDEPt~gLD~~~~~~i-~~~l~~l~~~-g~tiii~th~~~  169 (192)
T cd03232          94 LTVREALRFSALLRGLSVEQRKRLTIGV--ELAAKPSILFLDEPTSGLDSQAAYNI-VRFLKKLADS-GQAILCTIHQPS  169 (192)
T ss_pred             CHHHHHHHHHHHHHCCCHHHHHHHHHHH--HHHCCCCEEEEECCCCCCCHHHHHHH-HHHHHHHHHC-CCEEEEEECCCH
T ss_conf             5499999866777337976765899999--98449988998488768898999999-9999999969-999999983637


Q ss_pred             -HHHHHHH
Q ss_conf             -7976643
Q gi|254780750|r  774 -ELTDLSK  780 (920)
Q Consensus       774 -eL~~l~~  780 (920)
                       ++.++++
T Consensus       170 ~~i~~~~D  177 (192)
T cd03232         170 ASIFEKFD  177 (192)
T ss_pred             HHHHHHCC
T ss_conf             99998799


No 42 
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE).  They are clustered together phylogenetically.  MacAB is an exporter that confers resistance to macrolides, while the LolCDE system is not a transporter at all.  An FtsE null mutants showed filamentous growth and appeared viable on high salt medium only, indicating a role for FtsE in cell division and/or salt transport.  The LolCDE complex catalyses the release of lipoproteins from the cytoplasmic membrane prior to their targeting to the outer membrane.
Probab=98.15  E-value=3.8e-05  Score=56.88  Aligned_cols=135  Identities=19%  Similarity=0.243  Sum_probs=73.2

Q ss_pred             EEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHH--------------------HH-----HHCCCCCCHHHC-
Q ss_conf             4434563587777664399996778440789999999999--------------------99-----971985303532-
Q gi|254780750|r  635 IANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIV--------------------IM-----AQMGSYVPASYA-  688 (920)
Q Consensus       635 VpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~v--------------------il-----AQiG~fVPA~~a-  688 (920)
                      +=+|++|..    ..+.+..|.|||-+||||+||.++-+.                    -+     .+|| |||-+.+ 
T Consensus        19 al~~isl~i----~~Ge~~~iiG~sGsGKTTll~~i~Gl~~p~~G~I~~~g~~i~~~~~~~~~~~rr~~Ig-~v~Q~~~L   93 (218)
T cd03255          19 ALKGVSLSI----EKGEFVAIVGPSGSGKSTLLNILGGLDRPTSGEVRVDGTDISKLSEKELAAFRRRHIG-FVFQSFNL   93 (218)
T ss_pred             EEECEEEEE----CCCCEEEEECCCCCHHHHHHHHHHCCCCCCCEEEEECCEECCCCCHHHHHHHHHCCEE-EECCCCCC
T ss_conf             985628998----6998999999999869999999966999996499999999887998999998650478-98667521


Q ss_pred             --CCCCCCEEEEEEECCCCCCCCCCHHH--------HHHHHHH------------------HHH-HHCCCCCEEEEECCC
Q ss_conf             --06822105676523766113853289--------9999999------------------999-958998569993258
Q gi|254780750|r  689 --HIGIVDKLFSRVGSADNLASGRSTFM--------VEMIETA------------------SIL-NQATNQSFVILDEIG  739 (920)
Q Consensus       689 --~i~~~D~IftRiGa~D~l~~g~STF~--------vEm~e~~------------------~IL-~~at~~SLVllDElG  739 (920)
                        .++++|.|.-  |..   ..|.+..-        .|+.+..                  .|- --+..-.++|+||--
T Consensus        94 ~~~ltV~eni~~--~~~---~~~~~~~~~~~~v~~~l~~l~l~~~~~~~~~~LSGG~kQRv~iAraL~~~P~llllDEPT  168 (218)
T cd03255          94 LPDLTALENVEL--PLL---LAGVPKKERRERAEELLERVGLGDRLNHYPSELSGGQQQRVAIARALANDPKIILADEPT  168 (218)
T ss_pred             CCCCCHHHHHHH--HHH---HCCCCHHHHHHHHHHHHHHCCCHHHHHCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCC
T ss_conf             556439999999--999---849998999999998767679378873887638999999999999985599999981888


Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHH
Q ss_conf             89880567999999999999726984999748757976643
Q gi|254780750|r  740 RGTATLDGLSIAWATIEYLHETNRCRGLLATHFHELTDLSK  780 (920)
Q Consensus       740 rGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~~l~~  780 (920)
                      .|=++.-..- -|..+..|.+..+-.++++||..++.++++
T Consensus       169 s~LD~~~~~~-i~~~l~~l~~~~~~tii~itHd~~~~~~aD  208 (218)
T cd03255         169 GNLDSETGKE-VMELLRELNKEAGTTIVVVTHDPELAEYAD  208 (218)
T ss_pred             CCCCHHHHHH-HHHHHHHHHHHCCCEEEEECCCHHHHHHCC
T ss_conf             7689999999-999999999962989999896889998699


No 43 
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids.  The genes yhbG and yhbN are located in a single operon and may function together in cell envelope during biogenesis.  YhbG is the putative ATP-binding cassette component and YhbN is the putative periplasmic-binding protein.  Depletion of each gene product leads to growth arrest, irreversible cell damage and loss of viability in E. coli.  The YhbG homolog (NtrA) is essential in Rhizobium meliloti, a symbiotic nitrogen-fixing bacterium.
Probab=98.14  E-value=4.1e-05  Score=56.67  Aligned_cols=131  Identities=28%  Similarity=0.361  Sum_probs=77.5

Q ss_pred             EEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHH--------------------HHHHCC-CCCCHHHCCCCCC
Q ss_conf             4434563587777664399996778440789999999999--------------------999719-8530353206822
Q gi|254780750|r  635 IANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIV--------------------IMAQMG-SYVPASYAHIGIV  693 (920)
Q Consensus       635 VpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~v--------------------ilAQiG-~fVPA~~a~i~~~  693 (920)
                      |=+|+++..    ..+.+.-|-|||-+||||+||.++=+.                    --+..| +|||=+.      
T Consensus        15 ~l~~vs~~v----~~Gei~~llGpNGAGKSTll~~i~Gl~~p~~G~I~~~g~di~~~~~~~r~r~gig~~pQ~~------   84 (232)
T cd03218          15 VVNGVSLSV----KQGEIVGLLGPNGAGKTTTFYMIVGLVKPDSGKILLDGQDITKLPMHKRARLGIGYLPQEA------   84 (232)
T ss_pred             EECCEEEEE----CCCCEEEEECCCCCCHHHHHHHHHCCCCCCCEEEEECCEECCCCCHHHHHHCCEEECCCCC------
T ss_conf             882606798----9995999999999619999999977999986299999999999999999971979877777------


Q ss_pred             CEEEEEEECCCCCC----------------------------------CCCCHHHHHHHHHHHHHHHCCCCCEEEEECCC
Q ss_conf             10567652376611----------------------------------38532899999999999958998569993258
Q gi|254780750|r  694 DKLFSRVGSADNLA----------------------------------SGRSTFMVEMIETASILNQATNQSFVILDEIG  739 (920)
Q Consensus       694 D~IftRiGa~D~l~----------------------------------~g~STF~vEm~e~~~IL~~at~~SLVllDElG  739 (920)
                       .+|..+-..|||.                                  ...|-=|--+.++|..|  ++.-.++|+||--
T Consensus        85 -~l~~~ltV~enl~~~~~~~~~~~~~~~~~~~~~l~~~~L~~~~~~~~~~LSgG~~qrv~iAraL--~~~P~illlDEPt  161 (232)
T cd03218          85 -SIFRKLTVEENILAVLEIRGLSKKEREEKLEELLEEFHITHLRKSKASSLSGGERRRVEIARAL--ATNPKFLLLDEPF  161 (232)
T ss_pred             -CCCCCCCHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCHHHCCCHHHCCHHHHHHHHHHHHH--HCCCCEEEECCCC
T ss_conf             -6788888999999999972999999999999999876982465394255999999999999999--6699999988985


Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHH-HHHH
Q ss_conf             8988056799999999999972698499974875797-6643
Q gi|254780750|r  740 RGTATLDGLSIAWATIEYLHETNRCRGLLATHFHELT-DLSK  780 (920)
Q Consensus       740 rGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~-~l~~  780 (920)
                      .|=++..-..| |.++..|.+. ++-.+++||+-+.. .+++
T Consensus       162 ~GLDp~~~~~i-~~~i~~l~~~-g~tili~tH~l~~~~~~~d  201 (232)
T cd03218         162 AGVDPIAVQDI-QKIIKILKDR-GIGVLITDHNVRETLSITD  201 (232)
T ss_pred             CCCCHHHHHHH-HHHHHHHHHC-CCEEEEEECCHHHHHHHCC
T ss_conf             68899999999-9999999958-9999999283999998699


No 44 
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin.  In addition to DrrA, the complex includes an integral membrane protein called DrrB.  DrrA belongs to the ABC family of transporters and shares sequence and functional similarities with a protein found in cancer cells called  P-glycoprotein.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region in addition to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=98.13  E-value=3.3e-05  Score=57.38  Aligned_cols=134  Identities=22%  Similarity=0.291  Sum_probs=72.3

Q ss_pred             EEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHH--------------------HHHHHCCCCCCHHH---CCC
Q ss_conf             4443456358777766439999677844078999999999--------------------99997198530353---206
Q gi|254780750|r  634 FIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALI--------------------VIMAQMGSYVPASY---AHI  690 (920)
Q Consensus       634 fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~--------------------vilAQiG~fVPA~~---a~i  690 (920)
                      .+=+|+++..    ..+.+.-+-|||-+||||++|.++=+                    .+-.++| |||=..   ..+
T Consensus        14 ~al~~is~~v----~~Gei~gllGpNGAGKSTll~~i~Gl~~p~~G~i~i~G~~~~~~~~~~r~~ig-~~pq~~~l~~~l   88 (220)
T cd03265          14 EAVRGVSFRV----RRGEIFGLLGPNGAGKTTTIKMLTTLLKPTSGRATVAGHDVVREPREVRRRIG-IVFQDLSVDDEL   88 (220)
T ss_pred             EEECCCEEEE----CCCCEEEEECCCCCHHHHHHHHHHCCCCCCCCEEEECCEECCCCHHHHHHCCE-EEECCCCCCCCC
T ss_conf             9985826798----89839999999987199999999769788962899999998839899982838-990787679889


Q ss_pred             CCCCEE--EEEEECCCCCCCCCCHH--------HHH------------------HHH-HHHHHHHCCCCCEEEEECCCCC
Q ss_conf             822105--67652376611385328--------999------------------999-9999995899856999325889
Q gi|254780750|r  691 GIVDKL--FSRVGSADNLASGRSTF--------MVE------------------MIE-TASILNQATNQSFVILDEIGRG  741 (920)
Q Consensus       691 ~~~D~I--ftRiGa~D~l~~g~STF--------~vE------------------m~e-~~~IL~~at~~SLVllDElGrG  741 (920)
                      ++.+.+  |.|+       .|.+.-        ..|                  |.. ++-+.--+..-.++|+||---|
T Consensus        89 Tv~e~l~~~~~l-------~g~~~~~~~~~~~~ll~~~~L~~~~~~~~~~LS~G~kqrv~ia~Al~~~P~lliLDEPt~g  161 (220)
T cd03265          89 TGWENLYIHARL-------YGVPGAERRERIDELLDFVGLLEAADRLVKTYSGGMRRRLEIARSLVHRPEVLFLDEPTIG  161 (220)
T ss_pred             CHHHHHHHHHHH-------CCCCHHHHHHHHHHHHHHCCCHHHHCCHHHHCCHHHHHHHHHHHHHHCCCCEEEECCCCCC
T ss_conf             999999999998-------1999999999999999977996797370434799999999999998569998998088668


Q ss_pred             CCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHH-HHHH
Q ss_conf             88056799999999999972698499974875797-6643
Q gi|254780750|r  742 TATLDGLSIAWATIEYLHETNRCRGLLATHFHELT-DLSK  780 (920)
Q Consensus       742 Tst~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~-~l~~  780 (920)
                      -++.--.. -|.++..+.+..+.-++++||+-+-. .+.+
T Consensus       162 LDp~~~~~-i~~~i~~l~~~~g~tiilssH~l~eve~l~d  200 (220)
T cd03265         162 LDPQTRAH-VWEYIEKLKEEFGMTILLTTHYMEEAEQLCD  200 (220)
T ss_pred             CCHHHHHH-HHHHHHHHHHHCCCEEEEECCCHHHHHHHCC
T ss_conf             89999999-9999999998389799998888899998699


No 45 
>cd03271 ABC_UvrA_II The excision repair protein UvrA domain II; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion.  Recognition and cleavage of the damaged DNA is a multistep ATP-dependent reaction that requires the UvrA, UvrB, and UvrC proteins.  Both UvrA and UvrB are ATPases, with UvrA having two ATP binding sites, which have the characteristic signature of the family of ABC proteins and UvrB having one ATP binding site that is structurally related to that of helicases.
Probab=98.12  E-value=1e-04  Score=53.76  Aligned_cols=54  Identities=17%  Similarity=0.195  Sum_probs=36.3

Q ss_pred             HHHCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHH
Q ss_conf             99589985699932588988056799999999999972698499974875797664
Q gi|254780750|r  724 LNQATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFHELTDLS  779 (920)
Q Consensus       724 L~~at~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~~l~  779 (920)
                      ++.++..+++|+||--.|=++.+-..+ +.+++.|.+. +..++++||.-++...+
T Consensus       185 ~~~~~~P~lllLDEPTs~LD~~~~~~l-~~~l~~l~~~-G~Tvi~itH~l~~~~~a  238 (261)
T cd03271         185 SKRSTGKTLYILDEPTTGLHFHDVKKL-LEVLQRLVDK-GNTVVVIEHNLDVIKCA  238 (261)
T ss_pred             HHCCCCCCEEEECCCCCCCCHHHHHHH-HHHHHHHHHC-CCEEEEEEECHHHHHHC
T ss_conf             725888967995486345998999999-9999999978-99999984778899738


No 46 
>cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains.  The conserved ATP-binding motifs common to Rad50 and the ABC transporter family include the Walker A and Walker B motifs, the Q loop, a histidine residue in the switch region, a D-loop, and a conserved LSGG sequence.  This conserved sequence, LSGG, is the most specific and characteristic motif of this family and is thus known as the ABC signature sequence.
Probab=98.12  E-value=7.7e-05  Score=54.58  Aligned_cols=51  Identities=29%  Similarity=0.299  Sum_probs=34.7

Q ss_pred             CCCCCEEEEECCCCCCCHHHHHHH---HHHHHHHHHHHCCCEEEEECCCHHHHHHHH
Q ss_conf             899856999325889880567999---999999999726984999748757976643
Q gi|254780750|r  727 ATNQSFVILDEIGRGTATLDGLSI---AWATIEYLHETNRCRGLLATHFHELTDLSK  780 (920)
Q Consensus       727 at~~SLVllDElGrGTst~DG~ai---A~aile~l~~~~~~~~lfaTHy~eL~~l~~  780 (920)
                      +....++|+||-   |+..|-...   -+.+++.+.+..+..++++||..++...++
T Consensus       137 ~~~p~lllLDEP---Ts~LD~~~~~~~l~~ll~~~~~~~~~tiIivtHd~e~~~~aD  190 (204)
T cd03240         137 GSNCGILALDEP---TTNLDEENIEESLAEIIEERKSQKNFQLIVITHDEELVDAAD  190 (204)
T ss_pred             HCCCCEEEEECC---CCCCCHHHHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHHCC
T ss_conf             459998998187---666997899999999999998569989999944989998499


No 47 
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional
Probab=98.12  E-value=4.6e-05  Score=56.27  Aligned_cols=183  Identities=17%  Similarity=0.167  Sum_probs=88.0

Q ss_pred             CCEECCCCCCEEECCCCCHHHHHHHHHCCCCCEEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCC
Q ss_conf             51210478714000046805887631028770444345635877776643999967784407899999999999997198
Q gi|254780750|r  602 CRPIIDNSTNFIVKDGRHPIVEKTLKQQSSKPFIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGS  681 (920)
Q Consensus       602 ~rP~i~~~~~l~i~~gRHPviE~~l~~~~~~~fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~  681 (920)
                      .-|..+.+..|.+++...=         -+..-|=+||++..    ..+.+..|.|||-+||||++|.++=+. -..-|.
T Consensus         3 ~~~~~~~g~~l~v~nlsk~---------yg~~~~L~dIs~~I----~~GEiv~LiG~nGaGKSTLlr~i~Gl~-~p~~G~   68 (257)
T PRK11247          3 NTARLNQGTPLLLNAVSKH---------YGERTVLNQLDLHI----PAGQFVAVVGRSGCGKSTLLRLLAGLE-TPTAGD   68 (257)
T ss_pred             CCCCCCCCCCEEEEEEEEE---------ECCEEEECCEEEEE----CCCCEEEEECCCCCHHHHHHHHHHCCC-CCCCCE
T ss_conf             8677899985899768999---------89988982407588----799899999899888999999996589-888870


Q ss_pred             C----CCHHH--CCCCCCC---EEEEEEECCCCCCCCCCHH----HHHHH---------------------HHHHHHH-H
Q ss_conf             5----30353--2068221---0567652376611385328----99999---------------------9999999-5
Q gi|254780750|r  682 Y----VPASY--AHIGIVD---KLFSRVGSADNLASGRSTF----MVEMI---------------------ETASILN-Q  726 (920)
Q Consensus       682 f----VPA~~--a~i~~~D---~IftRiGa~D~l~~g~STF----~vEm~---------------------e~~~IL~-~  726 (920)
                      -    .|-..  ..++.+-   .+|...-..||+.-|...-    ..|+.                     +--.|.+ -
T Consensus        69 I~~~~~~i~~~~~~i~~vfQ~~~l~~~~tV~eni~~gl~~~~~~~~~e~l~~vgL~~~~~~~p~~LSGGqkQRvaiAraL  148 (257)
T PRK11247         69 LLAGTAPLAEAQEDTRLMFQDARLLPWKKVIDNVGLGLKGQWRDAALQALAAVGLADRANEWPAALSGGQKQRVALARAL  148 (257)
T ss_pred             EEECCEEHHHHHHCEEEEECCCCCCCCCCHHHHHHHHCCCCHHHHHHHHHHHCCCCHHHHCCHHHCCHHHHHHHHHHHHH
T ss_conf             89898755443110079932564476778999986321410699999999985991355369444899999999999998


Q ss_pred             CCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHH-HHHHHCCCEEEEEEEEEEECCEEEEEEEE
Q ss_conf             89985699932588988056799999999999972698499974875797-66430688589999999609927787777
Q gi|254780750|r  727 ATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFHELT-DLSKSLKRFHNATLQVSDSNEGIIFLHKV  805 (920)
Q Consensus       727 at~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~-~l~~~~~~v~n~~~~~~~~~~~i~flykl  805 (920)
                      +..-.++|+||--.|-++.-...+ +..+..|.+..+...+|+||+.+.. .+++.   +.  -    -.+++|++.-.+
T Consensus       149 ~~~P~lLlLDEPtsgLD~~~~~~i-~~ll~~L~~e~g~TIi~vTHdl~ea~~laDR---I~--v----m~~G~Iv~d~~~  218 (257)
T PRK11247        149 IHRPRLLLLDEPLGALDALTRIEM-QDLIESLWQQHGFTVLLVTHDVSEAVAMADR---VL--L----IEEGKIGLDLTV  218 (257)
T ss_pred             HCCCCEEEEECCCCCCCHHHHHHH-HHHHHHHHHHHCCEEEEECCCHHHHHHHCCE---EE--E----EECCEEEEEEEC
T ss_conf             459999998098765799999999-9999999996098999988799999996999---99--9----989999997118


Q ss_pred             EEC
Q ss_conf             447
Q gi|254780750|r  806 IPG  808 (920)
Q Consensus       806 ~~G  808 (920)
                      -..
T Consensus       219 d~~  221 (257)
T PRK11247        219 DLP  221 (257)
T ss_pred             CCC
T ss_conf             999


No 48 
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake.  NatB possess six putative membrane spanning regions at its C-terminus.  In B. subtilis, NatAB is inducible by agents such as ethanol and protonophores, which lower the protonmotive force across the membrane.  The closest sequence similarity to NatA is exhibited by DrrA of the two-component daunomycin- and doxorubicin-efflux system.  Hence, the functional NatAB is presumably assembled with two copies of the single ATP-binding protein and the single intergral membrane protein.
Probab=98.10  E-value=4.3e-05  Score=56.49  Aligned_cols=140  Identities=16%  Similarity=0.248  Sum_probs=72.6

Q ss_pred             CCCEEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHH--------------------HHHHCCCCCCHHH---
Q ss_conf             77044434563587777664399996778440789999999999--------------------9997198530353---
Q gi|254780750|r  631 SKPFIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIV--------------------IMAQMGSYVPASY---  687 (920)
Q Consensus       631 ~~~fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~v--------------------ilAQiG~fVPA~~---  687 (920)
                      +..-+=+|+++..    ..+.+.-|-|||-+||||+||.++=+.                    +.+++|..+|-..   
T Consensus        32 g~~~al~~vsf~i----~~Gei~gLlGpNGaGKSTllk~l~Gl~~p~~G~I~v~G~~~~~~~~~~~~~ig~v~~q~~~l~  107 (236)
T cd03267          32 REVEALKGISFTI----EKGEIVGFIGPNGAGKTTTLKILSGLLQPTSGEVRVAGLVPWKRRKKFLRRIGVVFGQKTQLW  107 (236)
T ss_pred             CCEEEECCCEEEE----CCCCEEEEECCCCCHHHHHHHHHHCCCCCCCEEEEECCEECCCCHHHHHHHEEEEECCCCCCC
T ss_conf             9989866805788----489599999999830999999996494887159999999851040988843799957754246


Q ss_pred             CCCCCCCEEEEEEECCCCCCCCCCH--H------HHHHHHHHH-------------------HHHHCCCCCEEEEECCCC
Q ss_conf             2068221056765237661138532--8------999999999-------------------999589985699932588
Q gi|254780750|r  688 AHIGIVDKLFSRVGSADNLASGRST--F------MVEMIETAS-------------------ILNQATNQSFVILDEIGR  740 (920)
Q Consensus       688 a~i~~~D~IftRiGa~D~l~~g~ST--F------~vEm~e~~~-------------------IL~~at~~SLVllDElGr  740 (920)
                      ..+++.+.+.  +++.   ..|.+.  .      +.|+.++..                   ..--+..-.++|+||--.
T Consensus       108 ~~ltv~e~l~--~~~~---~~~~~~~~~~~~~~~~l~~~~l~~~~~~~~~~LSgG~rqrv~ia~aL~~~P~lllLDEPt~  182 (236)
T cd03267         108 WDLPVIDSFY--LLAA---IYDLPPARFKKRLDELSELLDLEELLDTPVRQLSLGQRMRAEIAAALLHEPEILFLDEPTI  182 (236)
T ss_pred             CCCCHHHHHH--HHHH---HHCCCHHHHHHHHHHHHHHCCCHHHHCCCHHHCCHHHHHHHHHHHHHHCCCCEEEEECCCC
T ss_conf             7993999999--9999---8573899999999999997486877549345699999999999999967999999979876


Q ss_pred             CCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHH-HHHH
Q ss_conf             988056799999999999972698499974875797-6643
Q gi|254780750|r  741 GTATLDGLSIAWATIEYLHETNRCRGLLATHFHELT-DLSK  780 (920)
Q Consensus       741 GTst~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~-~l~~  780 (920)
                      |=++.--..+ |..+..+....+.-++++||.-+.. .+.+
T Consensus       183 gLD~~~~~~i-~~~l~~l~~~~g~till~tH~l~ev~~~~D  222 (236)
T cd03267         183 GLDVVAQENI-RNFLKEYNRERGTTVLLTSHYMKDIEALAR  222 (236)
T ss_pred             CCCHHHHHHH-HHHHHHHHHHCCCEEEEECCCHHHHHHHCC
T ss_conf             8899999999-999999997389899998887899999799


No 49 
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional
Probab=98.10  E-value=6.3e-05  Score=55.25  Aligned_cols=133  Identities=28%  Similarity=0.330  Sum_probs=75.6

Q ss_pred             EEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHH---------------------HHHHHCCCCCCHHHCCCCCC
Q ss_conf             443456358777766439999677844078999999999---------------------99997198530353206822
Q gi|254780750|r  635 IANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALI---------------------VIMAQMGSYVPASYAHIGIV  693 (920)
Q Consensus       635 VpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~---------------------vilAQiG~fVPA~~a~i~~~  693 (920)
                      |=+||+|..    ..+.+.-|-|||-+||||++|.++=.                     -++.+..+|||-.       
T Consensus        20 ~L~~isl~i----~~Gei~~liG~NGaGKSTLl~~i~G~~~~~~G~I~~~G~~i~~~~~~~~~r~~i~~vpq~-------   88 (237)
T PRK11614         20 ALHEVSLHI----NQGEIVTLIGANGAGKTTLLGTLCGDPRATSGRIVFDGKDITDWQTAKIMREAVAIVPEG-------   88 (237)
T ss_pred             EEEEEEEEE----CCCCEEEEECCCCCCHHHHHHHHHCCCCCCCEEEEECCEECCCCCHHHHHHHCEEEECCC-------
T ss_conf             881127898----699799998799975999999996799889628999999888799899987064783556-------


Q ss_pred             CEEEEEEECCCCCCCC-----CCHHHHHHHHHHH-------------------------H-HHHCCCCCEEEEECCCCCC
Q ss_conf             1056765237661138-----5328999999999-------------------------9-9958998569993258898
Q gi|254780750|r  694 DKLFSRVGSADNLASG-----RSTFMVEMIETAS-------------------------I-LNQATNQSFVILDEIGRGT  742 (920)
Q Consensus       694 D~IftRiGa~D~l~~g-----~STF~vEm~e~~~-------------------------I-L~~at~~SLVllDElGrGT  742 (920)
                      ..+|.++-..+|+.-|     ...+...+.+...                         | .--+..-.++|+||--.|=
T Consensus        89 ~~~~~~ltv~enl~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~LSgG~~Qrv~iAraL~~~P~lLlLDEPt~gL  168 (237)
T PRK11614         89 RRVFSRMTVEENLAMGGFFAERDQFQERIKWVYELFPRLHERRIQRAGTMSGGEQQMLAIGRALMSQPRLLLLDEPSLGL  168 (237)
T ss_pred             CCCCCCCCHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCC
T ss_conf             64577788999987510137867899999999986555567654422348998859999999985699999995975579


Q ss_pred             CHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHH-HHHHH
Q ss_conf             805679999999999997269849997487579-76643
Q gi|254780750|r  743 ATLDGLSIAWATIEYLHETNRCRGLLATHFHEL-TDLSK  780 (920)
Q Consensus       743 st~DG~aiA~aile~l~~~~~~~~lfaTHy~eL-~~l~~  780 (920)
                      ++..-..| |.+++.|.+. ++-++++||.-+. ..+++
T Consensus       169 D~~~~~~i-~~~l~~l~~~-g~tii~vsH~l~~~~~~aD  205 (237)
T PRK11614        169 APIIIQQI-FDTIEQLREQ-GMTIFLVEQNANQALKLAD  205 (237)
T ss_pred             CHHHHHHH-HHHHHHHHHC-CCEEEEEECCHHHHHHHCC
T ss_conf             99999999-9999999967-9999999475899999699


No 50 
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR).  DR is a well-described phenomenon occurring in fungi and shares several similarities with processes in bacteria and higher eukaryotes.  Compared to other members of the ABC transporter subfamilies, the ABCG transporter family is composed of proteins that have an ATP-binding cassette domain at the N-terminus and a TM (transmembrane) domain at the C-terminus.
Probab=98.08  E-value=0.00011  Score=53.57  Aligned_cols=132  Identities=22%  Similarity=0.289  Sum_probs=70.4

Q ss_pred             EEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCC-HHHCCCCCCC------EEEEEEE--CCCC
Q ss_conf             44345635877776643999967784407899999999999997198530-3532068221------0567652--3766
Q gi|254780750|r  635 IANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVP-ASYAHIGIVD------KLFSRVG--SADN  705 (920)
Q Consensus       635 VpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVP-A~~a~i~~~D------~IftRiG--a~D~  705 (920)
                      |=+|+++..    ..+.+..|.|||-+||||+||.++        |.-.| +.+-++.+-.      .+-.+||  .+|+
T Consensus        24 iL~~vs~~v----~~Gei~~ilGpnGaGKSTLl~~l~--------Gl~~~~~~~G~i~~~g~~~~~~~~~~~ig~v~Q~~   91 (194)
T cd03213          24 LLKNVSGKA----KPGELTAIMGPSGAGKSTLLNALA--------GRRTGLGVSGEVLINGRPLDKRSFRKIIGYVPQDD   91 (194)
T ss_pred             EEECCEEEE----ECCEEEEEECCCCCHHHHHHHHHH--------CCCCCCCCEEEEEECCEECCHHHHHHEEEEECCCC
T ss_conf             788838899----088199999899951999999985--------77778996289999999997578431289984665


Q ss_pred             -CCCCCCH-----HHHH--------HHHHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECC
Q ss_conf             -1138532-----8999--------9999999995899856999325889880567999999999999726984999748
Q gi|254780750|r  706 -LASGRST-----FMVE--------MIETASILNQATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATH  771 (920)
Q Consensus       706 -l~~g~ST-----F~vE--------m~e~~~IL~~at~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTH  771 (920)
                       +....+-     |..+        ...++-..--+..-+++|+||--.|-++..-..| |..+..+.+. +..++++||
T Consensus        92 ~l~~~ltv~e~l~~~a~l~~LSgGqrqRv~iA~aL~~~P~illlDEPTsgLD~~~~~~i-~~~l~~l~~~-g~tvi~~tH  169 (194)
T cd03213          92 ILHPTLTVRETLMFAAKLRGLSGGERKRVSIALELVSNPSLLFLDEPTSGLDSSSALQV-MSLLRRLADT-GRTIICSIH  169 (194)
T ss_pred             CCCCCCCHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCHHHHHHH-HHHHHHHHHC-CCEEEEEEC
T ss_conf             23776849999999987269888999999999999639988999489878898999999-9999999968-989999958


Q ss_pred             CH--HHHHHHH
Q ss_conf             75--7976643
Q gi|254780750|r  772 FH--ELTDLSK  780 (920)
Q Consensus       772 y~--eL~~l~~  780 (920)
                      ..  ++.++++
T Consensus       170 ~~~~~~~~~~D  180 (194)
T cd03213         170 QPSSEIFELFD  180 (194)
T ss_pred             CCHHHHHHHCC
T ss_conf             88599999799


No 51 
>cd03299 ABC_ModC_like Archeal protein closely related to ModC.  ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=98.07  E-value=9.9e-05  Score=53.76  Aligned_cols=133  Identities=24%  Similarity=0.306  Sum_probs=73.3

Q ss_pred             EEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHCCCCCCCE------------------
Q ss_conf             44434563587777664399996778440789999999999999719853035320682210------------------
Q gi|254780750|r  634 FIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHIGIVDK------------------  695 (920)
Q Consensus       634 fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a~i~~~D~------------------  695 (920)
                      ++=+|++|..    +.+.+..|-|||-+||||+||.++        |..=| ++-++.+-++                  
T Consensus        13 ~~L~~vs~~v----~~Ge~~~iiGpSGsGKSTLlr~i~--------Gl~~p-~~G~I~~~G~di~~~~~~~r~ig~vfQ~   79 (235)
T cd03299          13 FKLKNVSLEV----ERGDYFVILGPTGSGKSVLLETIA--------GFIKP-DSGKILLNGKDITNLPPEKRDISYVPQN   79 (235)
T ss_pred             CEECCCEEEE----CCCCEEEEECCCCCHHHHHHHHHH--------CCCCC-CCEEEEECCEECCCCCHHHCCEEEECCC
T ss_conf             4990148798----899899999999635999999997--------49999-9659999999999999767897894579


Q ss_pred             --EEEEEECCCCCCCC-----CCHH--------HHHHHHHHHHHH-------------------HCCCCCEEEEECCCCC
Q ss_conf             --56765237661138-----5328--------999999999999-------------------5899856999325889
Q gi|254780750|r  696 --LFSRVGSADNLASG-----RSTF--------MVEMIETASILN-------------------QATNQSFVILDEIGRG  741 (920)
Q Consensus       696 --IftRiGa~D~l~~g-----~STF--------~vEm~e~~~IL~-------------------~at~~SLVllDElGrG  741 (920)
                        +|-.+-..|||.-|     .+.-        ..||..+...++                   -+.+-.++|+||--.|
T Consensus        80 ~~Lfp~~tV~eNi~~~l~~~~~~~~e~~~rv~e~l~~~gl~~~~~~~p~~LSGGq~QRVaiARAl~~~P~llllDEP~s~  159 (235)
T cd03299          80 YALFPHMTVYKNIAYGLKKRKVDKKEIERKVLEIAEMLGIDHLLNRKPETLSGGEQQRVAIARALVVNPKILLLDEPFSA  159 (235)
T ss_pred             CCCCCCCCHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHHCCHHHCCHHHHHHHHHHHHHHCCCCEEEEECCCCC
T ss_conf             86689990999999999876999999999999999877997787489445899999999999999738998999288764


Q ss_pred             CCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHH-HHH
Q ss_conf             880567999999999999726984999748757976-643
Q gi|254780750|r  742 TATLDGLSIAWATIEYLHETNRCRGLLATHFHELTD-LSK  780 (920)
Q Consensus       742 Tst~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~~-l~~  780 (920)
                      =++.-...| +..+..|.+..+..++|+||..+.+. +++
T Consensus       160 LD~~~~~~i-~~~l~~l~~~~~~T~i~vTHd~~~a~~~aD  198 (235)
T cd03299         160 LDVRTKEKL-REELKKIRKEFGVTVLHVTHDFEEAWALAD  198 (235)
T ss_pred             CCHHHHHHH-HHHHHHHHHHHCCEEEEECCCHHHHHHHCC
T ss_conf             699999999-999999999829999998789999999699


No 52 
>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional
Probab=98.07  E-value=0.00015  Score=52.48  Aligned_cols=139  Identities=22%  Similarity=0.238  Sum_probs=77.2

Q ss_pred             EEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHH-H---------------------------HHHHHCCCCCCH
Q ss_conf             444345635877776643999967784407899999999-9---------------------------999971985303
Q gi|254780750|r  634 FIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNAL-I---------------------------VIMAQMGSYVPA  685 (920)
Q Consensus       634 fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval-~---------------------------vilAQiG~fVPA  685 (920)
                      -|=||++|..    ..+.+.-|-|||-+||||++|.++= +                           .-+++.+.++|-
T Consensus        15 ~vL~~vsl~i----~~Ge~~aliG~nGaGKSTLl~~i~G~l~~~~~~~g~~~~G~i~~~g~~i~~~~~~~~~~~~~~~~q   90 (273)
T PRK13547         15 AILRDLSLRI----EPGRVTALLGRNGAGKSTLLKVLAGELTGGGAPRGVRVTGDVALNGEPLAAIDAPRLARLRAVLPQ   90 (273)
T ss_pred             EEEECEEEEE----CCCCEEEEECCCCCHHHHHHHHHHCCCCCCCCCCCCEEEEEEEECCEECCCCCHHHHHHHHEEECC
T ss_conf             9997608899----899899999999976999999995678876566775247799999998553999999774258643


Q ss_pred             HH---CCCCCCCEEE-------------------------EEEECCCCC---CCCCCHHHHHHHHHHHHHHH--------
Q ss_conf             53---2068221056-------------------------765237661---13853289999999999995--------
Q gi|254780750|r  686 SY---AHIGIVDKLF-------------------------SRVGSADNL---ASGRSTFMVEMIETASILNQ--------  726 (920)
Q Consensus       686 ~~---a~i~~~D~If-------------------------tRiGa~D~l---~~g~STF~vEm~e~~~IL~~--------  726 (920)
                      ..   ..+++.+.++                         .+.|..+-.   ....|-=+.-....|..|-+        
T Consensus        91 ~~~~~~~~~v~~~v~~g~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~r~~~~LSGGq~qRv~iAraL~~l~~~~~al  170 (273)
T PRK13547         91 AAQPAFPFSVDEIVLLGRYPHARRAGALTHRDREIAWQALARAGATALVGRDVTTLSGGELARVQFARVLAQLWPPDPGA  170 (273)
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHCCCCHHCCHHHHHHHHHHHHHHHHCCCCCCC
T ss_conf             24555677599999851223322024114899999999998649754527871126999999999999998510111013


Q ss_pred             CCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHH
Q ss_conf             899856999325889880567999999999999726984999748757976
Q gi|254780750|r  727 ATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFHELTD  777 (920)
Q Consensus       727 at~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~~  777 (920)
                      +++-.++|+||--.|=++..-.-| +..+..|.+..+.-++|+||..++..
T Consensus       171 ~~~P~lLlLDEPts~LD~~~~~~i-~~~l~~l~~e~g~tvl~vtHdl~~~~  220 (273)
T PRK13547        171 AQPPRYLLLDEPTAALDLAHQHRL-LDTVRRLAREWNLGVLAIVHDPNLAA  220 (273)
T ss_pred             CCCCCEEEECCCCCCCCHHHHHHH-HHHHHHHHHHCCCEEEEEECCHHHHH
T ss_conf             689868997287444899999999-99999999837989999988999999


No 53 
>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones]
Probab=98.05  E-value=2.2e-05  Score=58.61  Aligned_cols=133  Identities=31%  Similarity=0.400  Sum_probs=83.9

Q ss_pred             EEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCC----------------CHHHCCCCCCCE---
Q ss_conf             4434563587777664399996778440789999999999999719853----------------035320682210---
Q gi|254780750|r  635 IANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYV----------------PASYAHIGIVDK---  695 (920)
Q Consensus       635 VpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fV----------------PA~~a~i~~~D~---  695 (920)
                      |=.+++|..    +.+.++.|-|||-+||||+...+     |-+-+.=|                |.+.|+.|+|=.   
T Consensus        19 ILkgvnL~v----~~GEvhaiMGPNGsGKSTLa~~i-----~G~p~Y~Vt~G~I~~~GedI~~l~~~ERAr~GifLafQ~   89 (251)
T COG0396          19 ILKGVNLTV----KEGEVHAIMGPNGSGKSTLAYTI-----MGHPKYEVTEGEILFDGEDILELSPDERARAGIFLAFQY   89 (251)
T ss_pred             HHCCCCEEE----CCCCEEEEECCCCCCHHHHHHHH-----HCCCCCEEECCEEEECCCCCCCCCHHHHHHCCCEEEECC
T ss_conf             003741467----59828999889987889999997-----289974675556998785425599868886187765117


Q ss_pred             ----------EEEEEECCCCCCCC----CCHHHHHHHHHHHHHH--------------------------H-CCCCCEEE
Q ss_conf             ----------56765237661138----5328999999999999--------------------------5-89985699
Q gi|254780750|r  696 ----------LFSRVGSADNLASG----RSTFMVEMIETASILN--------------------------Q-ATNQSFVI  734 (920)
Q Consensus       696 ----------IftRiGa~D~l~~g----~STF~vEm~e~~~IL~--------------------------~-at~~SLVl  734 (920)
                                -|-|.+.+.  ..+    ..-|.-++.|.+..|.                          - +=+-.|+|
T Consensus        90 P~ei~GV~~~~fLr~a~n~--~~~~~~~~~~~~~~~~e~~~~l~~~~~~l~R~vN~GFSGGEkKR~EilQ~~~lePkl~I  167 (251)
T COG0396          90 PVEIPGVTNSDFLRAAMNA--RRGARGILPEFIKELKEKAELLGLDEEFLERYVNEGFSGGEKKRNEILQLLLLEPKLAI  167 (251)
T ss_pred             CCCCCCEEHHHHHHHHHHH--HHCCCCCCHHHHHHHHHHHHHCCCCHHHHHCCCCCCCCCCHHHHHHHHHHHHCCCCEEE
T ss_conf             7547780099999999975--40356433889999999998839998996165677747315779999999845998899


Q ss_pred             EECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHH
Q ss_conf             9325889880567999999999999726984999748757976643
Q gi|254780750|r  735 LDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFHELTDLSK  780 (920)
Q Consensus       735 lDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~~l~~  780 (920)
                      |||.-.|-+ -|++.+..-.++.|.+. +.-+|..|||.+|.++-.
T Consensus       168 LDE~DSGLD-Idalk~V~~~i~~lr~~-~~~~liITHy~rll~~i~  211 (251)
T COG0396         168 LDEPDSGLD-IDALKIVAEGINALREE-GRGVLIITHYQRLLDYIK  211 (251)
T ss_pred             ECCCCCCCC-HHHHHHHHHHHHHHHCC-CCEEEEEECHHHHHHHCC
T ss_conf             558876755-89999999999998658-972999955799984268


No 54 
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids.  RLI's are not transport proteins, and thus cluster with a group of soluble proteins that lack the transmembrane components commonly found in other members of the family.  Structurally, RLI's have an N-terminal Fe-S domain and two nucleotide-binding domains, which are arranged to form two composite active sites in their interface cleft.  RLI is one of the most conserved enzymes between archaea and eukaryotes with a sequence identity more than 48%.  The high degree of evolutionary conservation suggests that RLI performs a central role in archaeal and eukaryotic physiology.
Probab=98.04  E-value=0.00012  Score=53.05  Aligned_cols=111  Identities=23%  Similarity=0.270  Sum_probs=66.6

Q ss_pred             CCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHCCCCCCCEEEEEEECC-C--CCCCCCCHHHHHHHHHHHHH
Q ss_conf             66439999677844078999999999999971985303532068221056765237-6--61138532899999999999
Q gi|254780750|r  648 NSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHIGIVDKLFSRVGSA-D--NLASGRSTFMVEMIETASIL  724 (920)
Q Consensus       648 ~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a~i~~~D~IftRiGa~-D--~l~~g~STF~vEm~e~~~IL  724 (920)
                      ..+.+.-|-|||-+||||++|.++        |..-|-+.- +. +|.+  ++.-. .  +|+.|+      ...++-..
T Consensus        23 ~~GEiv~ilGpNGaGKSTllk~i~--------G~l~p~~G~-i~-~~g~--~~~~~pq~~~LSGGq------rQRv~iAr   84 (177)
T cd03222          23 KEGEVIGIVGPNGTGKTTAVKILA--------GQLIPNGDN-DE-WDGI--TPVYKPQYIDLSGGE------LQRVAIAA   84 (177)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHH--------CCCCCCCCC-EE-ECCC--CEECCCCCCCCCHHH------HHHHHHHH
T ss_conf             899899998999999999999996--------886788994-66-6686--122155515079899------99999999


Q ss_pred             HHCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHH
Q ss_conf             95899856999325889880567999999999999726984999748757976
Q gi|254780750|r  725 NQATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFHELTD  777 (920)
Q Consensus       725 ~~at~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~~  777 (920)
                      --+..-.++|+||--.|-++.--.. .+.+++.+.+..+..++++||.-+...
T Consensus        85 al~~~p~lllLDEPts~LD~~~r~~-i~~~ik~l~~~~~~Tvl~vsHdl~~a~  136 (177)
T cd03222          85 ALLRNATFYLFDEPSAYLDIEQRLN-AARAIRRLSEEGKKTALVVEHDLAVLD  136 (177)
T ss_pred             HHHCCCCEEEECCCCCCCCHHHHHH-HHHHHHHHHHHCCCEEEEECCCHHHHH
T ss_conf             9823999999748865389999999-999999999965977999858899999


No 55 
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional
Probab=98.03  E-value=9.3e-05  Score=53.99  Aligned_cols=141  Identities=22%  Similarity=0.259  Sum_probs=69.2

Q ss_pred             CEEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHH--------------------HHHHCCCCCCHHHCCC--
Q ss_conf             044434563587777664399996778440789999999999--------------------9997198530353206--
Q gi|254780750|r  633 PFIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIV--------------------IMAQMGSYVPASYAHI--  690 (920)
Q Consensus       633 ~fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~v--------------------ilAQiG~fVPA~~a~i--  690 (920)
                      .-|=+|+++..    ..+.+..|.|||-+||||++|.++=+.                    .+.|--+|||-...-+  
T Consensus        20 ~~iL~~is~~i----~~Ge~~~i~G~sGsGKSTLlk~i~gl~~p~~G~I~~~g~~i~~~~~~~~r~~i~~v~Q~~~l~~~   95 (225)
T PRK10247         20 TKILNNINFSL----RAGEFKLITGPSGCGKSTLLKIVASLISPTSGTLLFEGEDISTLKPEIYRQQVSYCAQTPTLFGD   95 (225)
T ss_pred             EEEEECEEEEE----CCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCEEEECCEECCCCCHHHHHHHCCEEECCCCCCHH
T ss_conf             89994517998----59969999999999999999999646688876599999997749999998527457045543415


Q ss_pred             CCCCEEE-------------------EEEECCCCC-CCCCCHHHHHHHHHHHHHH-HCCCCCEEEEECCCCCCCHHHHHH
Q ss_conf             8221056-------------------765237661-1385328999999999999-589985699932588988056799
Q gi|254780750|r  691 GIVDKLF-------------------SRVGSADNL-ASGRSTFMVEMIETASILN-QATNQSFVILDEIGRGTATLDGLS  749 (920)
Q Consensus       691 ~~~D~If-------------------tRiGa~D~l-~~g~STF~vEm~e~~~IL~-~at~~SLVllDElGrGTst~DG~a  749 (920)
                      ++.|.|.                   .++|-.+++ .+.-+++.--+.+--.|.+ -+..-.++|+||.-.|=++..-..
T Consensus        96 tv~eni~~~~~~~~~~~~~~~~~~~l~~~~l~~~~~~~~~~~LSGGqkQRv~iARaL~~~p~iLllDEPts~LD~~~~~~  175 (225)
T PRK10247         96 TVYDNLIFPWQIRNQQPDPAIFLDDLERFALPDTILTKNIAELSGGEKQRISLIRNLQFMPKVLLLDEITSALDESNKHN  175 (225)
T ss_pred             HHHHHHHHHHHHCCCCHHHHHHHHHHHHCCCCHHHHHCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCHHHHHH
T ss_conf             39999985787667667899999999875995667618811189999999999999860999999959766689999999


Q ss_pred             HHHHHHHHHHHHCCCEEEEECCCHHHHHH
Q ss_conf             99999999997269849997487579766
Q gi|254780750|r  750 IAWATIEYLHETNRCRGLLATHFHELTDL  778 (920)
Q Consensus       750 iA~aile~l~~~~~~~~lfaTHy~eL~~l  778 (920)
                      | +..+..+.+..+.-++|+||..+....
T Consensus       176 i-~~~i~~l~~~~~~tvi~vtHd~~~~~~  203 (225)
T PRK10247        176 V-NEIIHRYVREQNIAVLWVTHDKDEINH  203 (225)
T ss_pred             H-HHHHHHHHHHCCCEEEEEECCHHHHHC
T ss_conf             9-999999998389899999039999970


No 56 
>PRK13544 consensus
Probab=98.02  E-value=6e-05  Score=55.38  Aligned_cols=133  Identities=15%  Similarity=0.202  Sum_probs=68.9

Q ss_pred             EEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHH-------------------HHHCCCCCCHHHC---CCC
Q ss_conf             444345635877776643999967784407899999999999-------------------9971985303532---068
Q gi|254780750|r  634 FIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVI-------------------MAQMGSYVPASYA---HIG  691 (920)
Q Consensus       634 fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vi-------------------lAQiG~fVPA~~a---~i~  691 (920)
                      -|=+|+++..    ..+.+..|.|||-+||||+||.++=+.-                   +.+++ |||-+.+   .++
T Consensus        15 ~il~~vs~~i----~~Gei~~l~G~NGsGKSTLl~~i~Gl~~p~~G~I~~~G~~i~~~~~~~~~i~-~~~q~~~~~~~lt   89 (208)
T PRK13544         15 VLFSNLSFTA----KQNSLTLVIGNNGSGKTSLLRLLAGLIPITHGNIKYNGENIHDSDTYITSIT-YIGHKNACNDNLT   89 (208)
T ss_pred             EEEECCEEEE----CCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCEEEECCEECCCCHHHHCCEE-EECCCCCCCCCCC
T ss_conf             9994415898----2994999999999989999999958806897489999999987837660727-8766444576778


Q ss_pred             CCCEE--EEEEECCCCCC-----------------CCCCHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHH
Q ss_conf             22105--67652376611-----------------385328999999999999589985699932588988056799999
Q gi|254780750|r  692 IVDKL--FSRVGSADNLA-----------------SGRSTFMVEMIETASILNQATNQSFVILDEIGRGTATLDGLSIAW  752 (920)
Q Consensus       692 ~~D~I--ftRiGa~D~l~-----------------~g~STF~vEm~e~~~IL~~at~~SLVllDElGrGTst~DG~aiA~  752 (920)
                      +.+.+  +.++-..+++.                 ...|.=+.-....+..  -+....++|+||--.|=++.- ..+.+
T Consensus        90 v~e~l~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~LSgG~kqrv~la~a--L~~~~~illLDEPt~gLD~~s-~~~i~  166 (208)
T PRK13544         90 VLENIEFWANIRNTHELIAAAICFFELQPVLDIKYKELSSGWKRRVALSRL--LIYNTNVWIIDEPFANLDSAT-KELIL  166 (208)
T ss_pred             HHHHHHHHHHHCCCHHHHHHHHHHCCCHHHHHCCHHHCCHHHHHHHHHHHH--HHCCCCEEEEECCCCCCCHHH-HHHHH
T ss_conf             999999998617838999999998499788727153579999999999999--856999999979866689999-99999


Q ss_pred             HHHHHHHHHCCCEEEEECCCHHH
Q ss_conf             99999997269849997487579
Q gi|254780750|r  753 ATIEYLHETNRCRGLLATHFHEL  775 (920)
Q Consensus       753 aile~l~~~~~~~~lfaTHy~eL  775 (920)
                      .++..+.+. +..++++||.-+-
T Consensus       167 ~~i~~~~~~-g~~vIi~sHd~~e  188 (208)
T PRK13544        167 ELILTRLEQ-NGIVIISDHSKTE  188 (208)
T ss_pred             HHHHHHHHC-CCEEEEECCCHHH
T ss_conf             999999868-9999998699999


No 57 
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos).  The Carb_Monos family is involved in the uptake of monosaccharides, such as pentoses (such as xylose, arabinose, and ribose) and hexoses (such as xylose, arabinose, and ribose), that cannot be broken down to simple sugars by hydrolysis.  In members of Carb_Monos family the single hydrophobic gene product forms a homodimer, while the ABC protein represents a fusion of two nucleotide-binding domains.  However, it is assumed that two copies of the ABC domains are present in the assembled transporter.
Probab=98.02  E-value=7.1e-05  Score=54.86  Aligned_cols=135  Identities=19%  Similarity=0.172  Sum_probs=70.6

Q ss_pred             EEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHH--------------------HHHCC-CCCCHHHCCCCC
Q ss_conf             444345635877776643999967784407899999999999--------------------99719-853035320682
Q gi|254780750|r  634 FIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVI--------------------MAQMG-SYVPASYAHIGI  692 (920)
Q Consensus       634 fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vi--------------------lAQiG-~fVPA~~a~i~~  692 (920)
                      .+=+||+|..    ..+.+.-|-|||-+||||++|.++=+.-                    +.+.| .|||.+...   
T Consensus        14 ~aL~~vsl~v----~~GEi~~liG~nGaGKSTll~~l~G~~~p~~G~I~~~G~~~~~~~~~~~~~~~i~~vp~~r~~---   86 (182)
T cd03215          14 GAVRDVSFEV----RAGEIVGIAGLVGNGQTELAEALFGLRPPASGEITLDGKPVTRRSPRDAIRAGIAYVPEDRKR---   86 (182)
T ss_pred             CCEECEEEEE----CCCCEEEEECCCCCCCCHHHHHHCCCCCCCCCEEEECCEECCCCCHHHHHHCCEEEEEHHHHH---
T ss_conf             8762317898----599699998889999263778766986788775999999988649999997896996020766---


Q ss_pred             CCEEEEEEECCCCCCCC--CCHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEEC
Q ss_conf             21056765237661138--5328999999999999589985699932588988056799999999999972698499974
Q gi|254780750|r  693 VDKLFSRVGSADNLASG--RSTFMVEMIETASILNQATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLAT  770 (920)
Q Consensus       693 ~D~IftRiGa~D~l~~g--~STF~vEm~e~~~IL~~at~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaT  770 (920)
                       ..+|..+...+|+.-.  .|-=+.-....|..  -+..-.++|+||--.|=++.-- .--|..+..+.+. ++-++|+|
T Consensus        87 -~~l~~~~~v~en~~~~~~LSGG~~Qrv~lAra--l~~~p~llllDEPT~gLD~~~~-~~i~~~i~~l~~~-g~tvi~is  161 (182)
T cd03215          87 -EGLVLDLSVAENIALSSLLSGGNQQKVVLARW--LARDPRVLILDEPTRGVDVGAK-AEIYRLIRELADA-GKAVLLIS  161 (182)
T ss_pred             -CCCCCCCCHHHHHHCCCCCCHHHHHHHHHHHH--HHCCCCEEEECCCCCCCCHHHH-HHHHHHHHHHHHC-CCEEEEEE
T ss_conf             -25678990999951855799899999999999--9719999998687545899999-9999999999978-99999996


Q ss_pred             CCHHH-HHHHH
Q ss_conf             87579-76643
Q gi|254780750|r  771 HFHEL-TDLSK  780 (920)
Q Consensus       771 Hy~eL-~~l~~  780 (920)
                      |+-+. ..+.+
T Consensus       162 Hdl~~~~~~~D  172 (182)
T cd03215         162 SELDELLGLCD  172 (182)
T ss_pred             CCHHHHHHHCC
T ss_conf             87999999799


No 58 
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea.  Only very few species lack representatives of the siderophore family transporters.  The E. coli BtuCD protein is an ABC transporter mediating vitamin B12 uptake.  The two ATP-binding cassettes (BtuD) are in close contact with each other, as are the two membrane-spanning subunits (BtuC); this arrangement is distinct from that observed for the E. coli lipid flippase MsbA.  The BtuC subunits provide 20 transmembrane helices grouped around a translocation pathway that is closed to the cytoplasm by a gate region, whereas the dimer arrangement of the BtuD subunits resembles the ATP-bound form of the Rad50 DNA repair enzyme.  A prominent cytoplasmic loop of BtuC forms the contact region with the ATP-binding cassette and represent a conserved motif among the ABC transporters.
Probab=98.01  E-value=0.0001  Score=53.63  Aligned_cols=127  Identities=21%  Similarity=0.254  Sum_probs=69.1

Q ss_pred             EEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHCCCCCCCEEEEEEECCCCCCCCCCHHH
Q ss_conf             44345635877776643999967784407899999999999997198530353206822105676523766113853289
Q gi|254780750|r  635 IANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHIGIVDKLFSRVGSADNLASGRSTFM  714 (920)
Q Consensus       635 VpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a~i~~~D~IftRiGa~D~l~~g~STF~  714 (920)
                      |=+|+++..    ..+.+.-|.|||-+||||++|.++        |.+-|. +-++-+.++-.+.+.. ..+.+..+ |.
T Consensus        14 il~~is~~i----~~Ge~~~liG~nGsGKTTLl~~i~--------G~~~~~-~G~I~~~g~~i~~~~~-~~~~~~i~-~v   78 (180)
T cd03214          14 VLDDLSLSI----EAGEIVGILGPNGAGKSTLLKTLA--------GLLKPS-SGEILLDGKDLASLSP-KELARKIA-YV   78 (180)
T ss_pred             EEECEEEEE----CCCCEEEEECCCCCCHHHHHHHHH--------CCCCCC-CCEEEECCEECCCCCH-HHHHCCCC-HH
T ss_conf             880437788----699799999899988999999995--------798998-7289999999896999-99955464-99


Q ss_pred             ---HH-------------------HHHHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCC
Q ss_conf             ---99-------------------99999999958998569993258898805679999999999997269849997487
Q gi|254780750|r  715 ---VE-------------------MIETASILNQATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHF  772 (920)
Q Consensus       715 ---vE-------------------m~e~~~IL~~at~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy  772 (920)
                         .|                   ...++-..--+.+-.++|+||--.|=++.--.. -+.++..+.+..+..++++||+
T Consensus        79 ~Q~l~~~~l~~~~~~~~~~LSGGqkQrv~iA~aL~~~P~ililDEPts~LD~~~~~~-i~~~i~~l~~~~~~tii~itHd  157 (180)
T cd03214          79 PQALELLGLAHLADRPFNELSGGERQRVLLARALAQEPPILLLDEPTSHLDIAHQIE-LLELLRRLARERGKTVVMVLHD  157 (180)
T ss_pred             HHHHHHCCCHHHHCCCHHHCCHHHHHHHHHHHHHHHCCCEEEECCCCCCCCHHHHHH-HHHHHHHHHHHCCCEEEEEECC
T ss_conf             999998599778649910379999999999999986896478858754479999999-9999999998469899999079


Q ss_pred             HHHHH
Q ss_conf             57976
Q gi|254780750|r  773 HELTD  777 (920)
Q Consensus       773 ~eL~~  777 (920)
                      -++..
T Consensus       158 l~~~~  162 (180)
T cd03214         158 LNLAA  162 (180)
T ss_pred             HHHHH
T ss_conf             89999


No 59 
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome.  The peroxisomal membrane forms a permeability barrier for a wide variety of metabolites required for and formed during fatty acid beta-oxidation.  To communicate with the cytoplasm and mitochondria, peroxisomes need dedicated proteins to transport such hydrophilic molecules across their membranes.  X-linked adrenoleukodystrophy (X-ALD) is caused by mutations in the ALD gene, which encodes ALDP (adrenoleukodystrophy protein ), a peroxisomal integral membrane protein that is a member of the ATP-binding cassette (ABC) transporter protein family.  The disease is characterized by a striking and unpredictable variation in phenotypic expression.  Phenotypes include the rapidly progressive childhood cerebral form (CCALD), the milder adult form, adrenomyeloneuropathy (AMN), and variants without neurologic involvement (i.e. asympt
Probab=97.99  E-value=0.00025  Score=50.80  Aligned_cols=120  Identities=28%  Similarity=0.306  Sum_probs=67.6

Q ss_pred             EEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHH-CCCCCCCEEEEEE--------E----
Q ss_conf             44345635877776643999967784407899999999999997198530353-2068221056765--------2----
Q gi|254780750|r  635 IANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASY-AHIGIVDKLFSRV--------G----  701 (920)
Q Consensus       635 VpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~-a~i~~~D~IftRi--------G----  701 (920)
                      +=+|+++..    ..+....|+|||-+||||++|.+        +|.+-|-+- -.++.-.+|.- +        |    
T Consensus        16 il~~isl~i----~~Ge~v~i~G~sGsGKSTLl~~l--------~Gl~~~~~G~i~~~~~~~i~~-v~Q~~~l~~~tl~e   82 (166)
T cd03223          16 LLKDLSFEI----KPGDRLLITGPSGTGKSSLFRAL--------AGLWPWGSGRIGMPEGEDLLF-LPQRPYLPLGTLRE   82 (166)
T ss_pred             EEEEEEEEE----CCCCEEEEECCCCCCHHHHHHHH--------CCCCCCCCCEEEECCCCCEEE-ECCCCCCCCCCHHH
T ss_conf             894458898----89999999958999889999998--------698769986799769987999-85646658875999


Q ss_pred             -----CCCCCCCCCCHHHHHHHHH--HHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHH
Q ss_conf             -----3766113853289999999--999995899856999325889880567999999999999726984999748757
Q gi|254780750|r  702 -----SADNLASGRSTFMVEMIET--ASILNQATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFHE  774 (920)
Q Consensus       702 -----a~D~l~~g~STF~vEm~e~--~~IL~~at~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~e  774 (920)
                           -.+.|+.|      |...+  |..|  +.+-.++|+||-   ||.-|-.+. ..+++.|.+. +..+++.||-.+
T Consensus        83 ~l~~p~~~~LSGG------qkQRvalARal--~~~p~iliLDEp---Ts~LD~~~~-~~l~~~l~~~-~~Tvi~VtH~~~  149 (166)
T cd03223          83 QLIYPWDDVLSGG------EQQRLAFARLL--LHKPKFVFLDEA---TSALDEESE-DRLYQLLKEL-GITVISVGHRPS  149 (166)
T ss_pred             HHHCCCCCCCCHH------HHHHHHHHHHH--HCCCCEEEECCC---CCCCCHHHH-HHHHHHHHHC-CCEEEEEECCHH
T ss_conf             9636154678999------99999999999--649999997585---332899999-9999999977-998999943469


Q ss_pred             HHHHHH
Q ss_conf             976643
Q gi|254780750|r  775 LTDLSK  780 (920)
Q Consensus       775 L~~l~~  780 (920)
                      +..+++
T Consensus       150 ~~~~aD  155 (166)
T cd03223         150 LWKFHD  155 (166)
T ss_pred             HHHCCC
T ss_conf             997299


No 60 
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=97.99  E-value=0.00018  Score=51.91  Aligned_cols=130  Identities=26%  Similarity=0.288  Sum_probs=78.8

Q ss_pred             EEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHCCCCCC--------------------
Q ss_conf             444345635877776643999967784407899999999999997198530353206822--------------------
Q gi|254780750|r  634 FIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHIGIV--------------------  693 (920)
Q Consensus       634 fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a~i~~~--------------------  693 (920)
                      -|=+|+++..    ..+.+..|.||+-+||||+||.++        |..-|- +-++-+-                    
T Consensus        14 ~~l~~vs~~i----~~Ge~~~ivGpSG~GKSTllr~i~--------Gl~~p~-~G~I~~~g~~i~~~~~~~~~~rr~ig~   80 (178)
T cd03229          14 TVLNDVSLNI----EAGEIVALLGPSGSGKSTLLRCIA--------GLEEPD-SGSILIDGEDLTDLEDELPPLRRRIGM   80 (178)
T ss_pred             EEECCCEEEE----CCCCEEEEECCCCCHHHHHHHHHH--------CCCCCC-CEEEEECCEECCCCCCHHHHHCCCEEE
T ss_conf             9983707698----899899999999983999999998--------599999-639999999998886102454177599


Q ss_pred             ----CEEEEEEECCCCCCCCCCHHHHHHHHHHHHHH-HCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEE
Q ss_conf             ----10567652376611385328999999999999-5899856999325889880567999999999999726984999
Q gi|254780750|r  694 ----DKLFSRVGSADNLASGRSTFMVEMIETASILN-QATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLL  768 (920)
Q Consensus       694 ----D~IftRiGa~D~l~~g~STF~vEm~e~~~IL~-~at~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lf  768 (920)
                          -.+|.++-..||+.-+.|-=|   .+=..|-| -+++-.++|+||--.+-++.-...| +..+..+.+..+..+++
T Consensus        81 vFQ~~~L~p~~tv~eNv~~~LSGGq---~QRvaIARAL~~~P~ill~DEPts~LD~~~~~~i-~~~l~~l~~~~~~t~i~  156 (178)
T cd03229          81 VFQDFALFPHLTVLENIALGLSGGQ---QQRVALARALAMDPDVLLLDEPTSALDPITRREV-RALLKSLQAQLGITVVL  156 (178)
T ss_pred             EECCCCCCCCCCHHHHHCEECCCHH---HHHHHHHHHHHCCCCEEEEECCCCCCCHHHHHHH-HHHHHHHHHHHCCEEEE
T ss_conf             9269988998928996008177268---8999999998529999997089764799999999-99999999964999999


Q ss_pred             ECCCHHHH-HHHH
Q ss_conf             74875797-6643
Q gi|254780750|r  769 ATHFHELT-DLSK  780 (920)
Q Consensus       769 aTHy~eL~-~l~~  780 (920)
                      +||..+.+ .+++
T Consensus       157 vTHd~~~a~~~aD  169 (178)
T cd03229         157 VTHDLDEAARLAD  169 (178)
T ss_pred             ECCCHHHHHHHCC
T ss_conf             9899999998699


No 61 
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional
Probab=97.98  E-value=0.0002  Score=51.48  Aligned_cols=136  Identities=18%  Similarity=0.165  Sum_probs=64.8

Q ss_pred             EEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHH--------------------HHHHHCCCCCCHHHC---CCC
Q ss_conf             443456358777766439999677844078999999999--------------------999971985303532---068
Q gi|254780750|r  635 IANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALI--------------------VIMAQMGSYVPASYA---HIG  691 (920)
Q Consensus       635 VpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~--------------------vilAQiG~fVPA~~a---~i~  691 (920)
                      |=.||++..    ..+.+..|+|||-+||||++|.++=+                    ..-.|++ |||-...   .++
T Consensus        16 vl~~is~~i----~~G~i~~l~G~NGaGKSTLlkli~Gl~~p~~G~I~~~~~~i~~~~~~~~~~~~-~~~~~~~i~~~lt   90 (200)
T PRK13540         16 LLQQISFHL----PAGGLLHLKGSNGAGKTTLLKLIAGLLNPEKGEILFERQSIKKDLCTYQKQLC-FVGHRSGINPYLT   90 (200)
T ss_pred             EEECEEEEE----CCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCEEEECCEECCCCHHHHHHHEE-EECCCCCCCCCCC
T ss_conf             881227898----79979999889998799999999778588985699999864634477763378-7444346786776


Q ss_pred             CCCEEEEEEECC---------------CCC----CCCCCHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHH
Q ss_conf             221056765237---------------661----1385328999999999999589985699932588988056799999
Q gi|254780750|r  692 IVDKLFSRVGSA---------------DNL----ASGRSTFMVEMIETASILNQATNQSFVILDEIGRGTATLDGLSIAW  752 (920)
Q Consensus       692 ~~D~IftRiGa~---------------D~l----~~g~STF~vEm~e~~~IL~~at~~SLVllDElGrGTst~DG~aiA~  752 (920)
                      +.+.+.-.+...               +.+    ....|.=+.-...++..+  +.+..++|+||--.|=+...-..| +
T Consensus        91 v~e~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~~~LSgGqkqrv~lar~l--~~~p~illLDEPt~gLD~~~~~~i-~  167 (200)
T PRK13540         91 LRENCLYDIHFSPGAVGITELCRLFSLEHLIDYPCGLLSSGQKRQVALLRLW--MSKAKLWLLDEPLVALDELSLLTI-I  167 (200)
T ss_pred             HHHHHHHHHHCCCHHHHHHHHHHHCCCHHHHCCCHHHCCHHHHHHHHHHHHH--HHCCCEEEEECCCCCCCHHHHHHH-H
T ss_conf             9999875543383166799999972975564497124999999999999999--839998999177643899999999-9


Q ss_pred             HHHHHHHHHCCCEEEEECCCHHHHHHH
Q ss_conf             999999972698499974875797664
Q gi|254780750|r  753 ATIEYLHETNRCRGLLATHFHELTDLS  779 (920)
Q Consensus       753 aile~l~~~~~~~~lfaTHy~eL~~l~  779 (920)
                      ..+..+... ++.++++||-.+.-..+
T Consensus       168 ~~l~~~~~~-g~tiii~sH~~~~l~~a  193 (200)
T PRK13540        168 TKIQEHRAK-GGAVLLTSHQDLPLNKA  193 (200)
T ss_pred             HHHHHHHHC-CCEEEEEECCHHHHHHC
T ss_conf             999999868-99999994264777768


No 62 
>cd03270 ABC_UvrA_I The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion.  Recognition and cleavage of the damaged DNA is a multistep ATP-dependent reaction that requires the UvrA, UvrB, and UvrC proteins.  Both UvrA and UvrB are ATPases, with UvrA having two ATP binding sites, which have the characteristic signature of the family of ABC proteins, and UvrB having one ATP binding site that is structurally related to that of helicases.
Probab=97.98  E-value=0.00051  Score=48.49  Aligned_cols=55  Identities=16%  Similarity=0.190  Sum_probs=36.4

Q ss_pred             HHHCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHH
Q ss_conf             995899856999325889880567999999999999726984999748757976643
Q gi|254780750|r  724 LNQATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFHELTDLSK  780 (920)
Q Consensus       724 L~~at~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~~l~~  780 (920)
                      |-...+..|+|+||--.|=++.....|. .+++.|.+. +..++++||-.++...++
T Consensus       152 L~~~~~~~lliLDEPTsgLD~~~~~~i~-~~i~~l~~~-G~Tvi~VsHd~~~~~~aD  206 (226)
T cd03270         152 IGSGLTGVLYVLDEPSIGLHPRDNDRLI-ETLKRLRDL-GNTVLVVEHDEDTIRAAD  206 (226)
T ss_pred             HHHCCCCCEEEECCCCCCCCHHHHHHHH-HHHHHHHHC-CCEEEEEEECHHHHHHCC
T ss_conf             9738987168832873337989999999-999999976-998999972578998489


No 63 
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group. A gene pair with a fairly wide distribution consists of a polypeptide related to the lactococcin 972 (see TIGR01653) and multiple-membrane-spanning putative immunity protein (see TIGR01654). This model represents a small clade within the ABC transporters that regularly are found adjacent to these bacteriocin system gene pairs and are likely serve as export proteins.
Probab=97.98  E-value=0.00017  Score=51.98  Aligned_cols=130  Identities=19%  Similarity=0.251  Sum_probs=70.9

Q ss_pred             EEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHCCCCCCCEEEE-------------EE
Q ss_conf             44434563587777664399996778440789999999999999719853035320682210567-------------65
Q gi|254780750|r  634 FIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHIGIVDKLFS-------------RV  700 (920)
Q Consensus       634 fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a~i~~~D~Ift-------------Ri  700 (920)
                      .|=+|++|..    ..+.+..|.||+-+||||+||.+|.+         -+.++-++.+.++-..             +|
T Consensus        12 ~vL~~vsl~i----~~Ge~~~i~GpSGsGKSTLL~~i~gl---------~~p~sG~i~~~g~~~~~~~~~~~~~~rr~~i   78 (206)
T TIGR03608        12 TILDDLNLTI----EKGKMVAIVGESGSGKSTLLNIIGLL---------EKPDSGQVYLNGQETPPINSKKASKFRREKL   78 (206)
T ss_pred             EEECCEEEEE----CCCCEEEEECCCCCCHHHHHHHHHCC---------CCCCCEEEEECCEECCCCCHHHHHHHHHCCE
T ss_conf             9975807798----69989999879997099999999759---------9989759999999999899889999986588


Q ss_pred             EC--CC-CCCCCCCHH--------------------HHHHHHH---------------------HHHHH-HCCCCCEEEE
Q ss_conf             23--76-611385328--------------------9999999---------------------99999-5899856999
Q gi|254780750|r  701 GS--AD-NLASGRSTF--------------------MVEMIET---------------------ASILN-QATNQSFVIL  735 (920)
Q Consensus       701 Ga--~D-~l~~g~STF--------------------~vEm~e~---------------------~~IL~-~at~~SLVll  735 (920)
                      |-  +| +|....+-+                    ..|+.+.                     ..|-| -++.-+++|.
T Consensus        79 G~VfQ~~~L~~~ltV~eNi~l~l~~~~~~~~~~~~~~~~~L~~vgl~~~~~~~p~~LSGGe~QRVAIARAL~~~P~illa  158 (206)
T TIGR03608        79 GYLFQNFALIENETVEENLDLALKYSKLSKKEKREKKKEALEKVGLNLKLKQKIYELSGGEQQRVALARAILKPSELILA  158 (206)
T ss_pred             EEECCCCCCCCCCCHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCHHHHCCCHHCCHHHHHHHHHHHHHHCCCCEEEE
T ss_conf             99857987679891999999999865999999999999999986990565299244486999999999998249999996


Q ss_pred             ECCCCCCCHHHHH--HHHHHHHHHHHHHCCCEEEEECCCHHHHHHHH
Q ss_conf             3258898805679--99999999999726984999748757976643
Q gi|254780750|r  736 DEIGRGTATLDGL--SIAWATIEYLHETNRCRGLLATHFHELTDLSK  780 (920)
Q Consensus       736 DElGrGTst~DG~--aiA~aile~l~~~~~~~~lfaTHy~eL~~l~~  780 (920)
                      ||-   |+..|-.  ..-+..+..+.+. +...+++||..++...++
T Consensus       159 DEP---T~~LD~~~~~~i~~ll~~l~~~-g~tii~vTHd~~~a~~~D  201 (206)
T TIGR03608       159 DEP---TGSLDPKNRDEVLDLLLELNDE-GKTIIIVTHDPEVAEQAD  201 (206)
T ss_pred             CCC---CCCCCHHHHHHHHHHHHHHHHC-CCEEEEECCCHHHHHHCC
T ss_conf             399---8778999999999999999867-999999898789998699


No 64 
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional
Probab=97.98  E-value=3.8e-05  Score=56.89  Aligned_cols=46  Identities=17%  Similarity=0.085  Sum_probs=32.4

Q ss_pred             CCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHH
Q ss_conf             899856999325889880567999999999999726984999748757
Q gi|254780750|r  727 ATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFHE  774 (920)
Q Consensus       727 at~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~e  774 (920)
                      +.+..++|+||--.|=++ ++...-+.+++.+.+. +..++++||-+.
T Consensus       142 ~~~p~vllLDEPtsgLD~-~~~~~v~~~i~~~~~~-g~tiIi~tH~p~  187 (206)
T PRK13539        142 VSNRPIWLLDEPTAALDS-ASQALFAELIRAHLAQ-GGIVIAATHIPL  187 (206)
T ss_pred             HHCCCEEEEECCCCCCCH-HHHHHHHHHHHHHHHC-CCEEEEEECCCC
T ss_conf             869898999799777899-9999999999999958-999999938988


No 65 
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C.  This family is also known as MRP (mulrtidrug resisitance-associated protein).  Some of the MRP members have five additional transmembrane segments in their N-terminas, but the function of these additional membrane-spanning domains is not clear.  The MRP was found in the multidrug-resisting lung cancer cell in which p-glycoprotein was not overexpressed. MRP exports glutathione by drug stimulation, as well as, certain substrates in conjugated forms with anions, such as glutathione, glucuronate, and sulfate.
Probab=97.98  E-value=0.00038  Score=49.41  Aligned_cols=35  Identities=31%  Similarity=0.479  Sum_probs=28.5

Q ss_pred             CEEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHH
Q ss_conf             044434563587777664399996778440789999999
Q gi|254780750|r  633 PFIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNA  671 (920)
Q Consensus       633 ~fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqva  671 (920)
                      .||=+|+++..    ..+.+.-|.|||-+||||++|.++
T Consensus        18 ~~vL~~isl~i----~~Ge~~~IvG~sGsGKSTLl~~i~   52 (204)
T cd03250          18 SFTLKDINLEV----PKGELVAIVGPVGSGKSSLLSALL   52 (204)
T ss_pred             CCEEEEEEEEE----CCCCEEEEECCCCCCHHHHHHHHC
T ss_conf             76252148997----699899999999985899999981


No 66 
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity.  In eubacteria and archaea, the typical organization consists of one ABC and one or two IMs.  Eukaryote systems of the ABCA subfamily display ABC domains strongly similar to this family.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region in addition to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=97.97  E-value=0.00027  Score=50.53  Aligned_cols=133  Identities=23%  Similarity=0.337  Sum_probs=71.4

Q ss_pred             EEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHH-----------------HHHCCCCCCHHHC---CCCCC
Q ss_conf             444345635877776643999967784407899999999999-----------------9971985303532---06822
Q gi|254780750|r  634 FIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVI-----------------MAQMGSYVPASYA---HIGIV  693 (920)
Q Consensus       634 fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vi-----------------lAQiG~fVPA~~a---~i~~~  693 (920)
                      .|=+|++++.    ..+.+.=|-|||-+||||++|.++=+.-                 -..+| |||-+..   .+++.
T Consensus        14 ~al~~vs~~v----~~Gei~gllG~NGaGKTTll~~i~Gl~~p~~G~i~i~G~~~~~~~~~~ig-~~pq~~~l~~~ltv~   88 (210)
T cd03269          14 TALDDISFSV----EKGEIFGLLGPNGAGKTTTIRMILGIILPDSGEVLFDGKPLDIAARNRIG-YLPEERGLYPKMKVI   88 (210)
T ss_pred             EEECCEEEEE----CCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCEEEECCEECCHHHHCCEE-EECCCCCCCCCCCHH
T ss_conf             9975426788----79959999989998499999999600266899899999868844360199-964766679999999


Q ss_pred             CEE--EEEE-------------------ECCC---CCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHHHH
Q ss_conf             105--6765-------------------2376---611385328999999999999589985699932588988056799
Q gi|254780750|r  694 DKL--FSRV-------------------GSAD---NLASGRSTFMVEMIETASILNQATNQSFVILDEIGRGTATLDGLS  749 (920)
Q Consensus       694 D~I--ftRi-------------------Ga~D---~l~~g~STF~vEm~e~~~IL~~at~~SLVllDElGrGTst~DG~a  749 (920)
                      +.+  |.++                   |-.+   ......|-=|.-....+  .--+..-.++|+||--.|=++.- ..
T Consensus        89 e~l~~~~~l~g~~~~~~~~~~~~~l~~~~L~~~~~~~~~~LSgG~kqrv~la--~al~~~p~lllLDEPt~gLDp~~-~~  165 (210)
T cd03269          89 DQLVYLAQLKGLKKEEARRRIDEWLERLELSEYANKRVEELSKGNQQKVQFI--AAVIHDPELLILDEPFSGLDPVN-VE  165 (210)
T ss_pred             HHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCHHHCCHHHHCCHHHHHHHHHH--HHHHCCCCEEEEECCCCCCCHHH-HH
T ss_conf             9999999974999999999999999986997054880577899899999999--99957998999928866799999-99


Q ss_pred             HHHHHHHHHHHHCCCEEEEECCCHHH
Q ss_conf             99999999997269849997487579
Q gi|254780750|r  750 IAWATIEYLHETNRCRGLLATHFHEL  775 (920)
Q Consensus       750 iA~aile~l~~~~~~~~lfaTHy~eL  775 (920)
                      .-|.++..+.+. +..++++||.-+-
T Consensus       166 ~i~~~i~~~~~~-g~til~ssH~l~e  190 (210)
T cd03269         166 LLKDVIRELARA-GKTVILSTHQMEL  190 (210)
T ss_pred             HHHHHHHHHHHC-CCEEEEECCCHHH
T ss_conf             999999999968-9899998884899


No 67 
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional
Probab=97.97  E-value=0.00022  Score=51.14  Aligned_cols=136  Identities=21%  Similarity=0.207  Sum_probs=68.6

Q ss_pred             EEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHH--------------------HHHHCCCCCCHHH---CCC
Q ss_conf             44434563587777664399996778440789999999999--------------------9997198530353---206
Q gi|254780750|r  634 FIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIV--------------------IMAQMGSYVPASY---AHI  690 (920)
Q Consensus       634 fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~v--------------------ilAQiG~fVPA~~---a~i  690 (920)
                      -|=+|++|..    ..+.+.-|-|||-+||||++|.++-..                    -+++--+|||-+.   ..+
T Consensus        25 ~vL~~vsl~i----~~Ge~~~liG~NGaGKSTLl~~l~gl~~p~~G~I~~~g~~i~~~~~~~~~~~i~~v~Q~~~~~~~~  100 (265)
T PRK10575         25 TLLHPLSLTF----PAGKVTGLIGHNGSGKSTLLKMLGRHQPPSEGEILLDAQPLASWSSKAFARKVAYLPQQLPPAEGM  100 (265)
T ss_pred             EEEECEEEEE----CCCCEEEEECCCCCHHHHHHHHHHCCCCCCCCEEEECCEECCCCCHHHHHHHEEEECCCCCCCCCC
T ss_conf             9881508898----799899999999980999999995688998738999976567589899874466631124546688


Q ss_pred             CCCCEEE----------EEEECCC------------------CCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEECCCCCC
Q ss_conf             8221056----------7652376------------------61138532899999999999958998569993258898
Q gi|254780750|r  691 GIVDKLF----------SRVGSAD------------------NLASGRSTFMVEMIETASILNQATNQSFVILDEIGRGT  742 (920)
Q Consensus       691 ~~~D~If----------tRiGa~D------------------~l~~g~STF~vEm~e~~~IL~~at~~SLVllDElGrGT  742 (920)
                      ++.+.+.          .+.++.|                  ......|-=+--....|..  -+.+-.++|+||--.|=
T Consensus       101 tv~e~i~~g~~~~~~~~~~~~~~~~~~v~~~l~~~gl~~~~~~~~~~LSGGq~QRv~iAra--L~~~P~lLlLDEPts~L  178 (265)
T PRK10575        101 TVRELVAIGRYPWHGALGRFGAADREKVEEAISLVGLKPLAHRLVDSLSGGERQRAWIAML--VAQDSRCLLLDEPTSAL  178 (265)
T ss_pred             CHHHHHHHCCCHHHHHHCCCCHHHHHHHHHHHHHCCCCHHHHCCHHHCCHHHHHHHHHHHH--HHCCCCEEEEECCCCCC
T ss_conf             0988887165301123324777799999999998599136516833389999999999998--75699989981776558


Q ss_pred             CHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHH
Q ss_conf             8056799999999999972698499974875797
Q gi|254780750|r  743 ATLDGLSIAWATIEYLHETNRCRGLLATHFHELT  776 (920)
Q Consensus       743 st~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~  776 (920)
                      ++.--.. .+.++..|.+..+.-++++||.-++.
T Consensus       179 D~~~~~~-i~~~l~~l~~~~g~tvi~vtHdl~~~  211 (265)
T PRK10575        179 DIAHQVD-VLALVHRLSQERGLTVIAVLHDINMA  211 (265)
T ss_pred             CHHHHHH-HHHHHHHHHHCCCCEEEEEECCHHHH
T ss_conf             9999999-99999999862898999993888999


No 68 
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt   The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export.  Among the variety of membrane-linked or extracellular polysaccharides excreted by bacteria, only capsular polysaccharides, lipopolysaccharides, and teichoic acids have been shown to be exported by ABC transporters.  A typical system is made of a conserved integral membrane and an ABC.  In addition to these proteins, capsular polysaccharide exporter systems require two 'accessory' proteins to perform their function: a periplasmic (E.coli) or a lipid-anchored outer membrane protein called OMA (Neisseria meningitidis and Haemophilus influenzae) and a cytoplasmic membrane protein MPA2.
Probab=97.96  E-value=0.00025  Score=50.83  Aligned_cols=132  Identities=22%  Similarity=0.259  Sum_probs=67.5

Q ss_pred             EEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHCCCCCCCEEEEEEE----------CC
Q ss_conf             44434563587777664399996778440789999999999999719853035320682210567652----------37
Q gi|254780750|r  634 FIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHIGIVDKLFSRVG----------SA  703 (920)
Q Consensus       634 fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a~i~~~D~IftRiG----------a~  703 (920)
                      .+=+||+|..    ..+.+.-|-|||-+||||++|.++        |..-| ++-++-+.-++-..++          ..
T Consensus        36 ~AL~~isf~i----~~GeivgilG~NGaGKSTLl~~i~--------Gl~~p-~~G~I~i~G~~~~~~~~~~~~~p~ltv~  102 (224)
T cd03220          36 WALKDVSFEV----PRGERIGLIGRNGAGKSTLLRLLA--------GIYPP-DSGTVTVRGRVSSLLGLGGGFNPELTGR  102 (224)
T ss_pred             EEECCEEEEE----CCCCEEEEECCCCCHHHHHHHHHH--------CCCCC-CCCEEEECCEECCCCCCCEECCCCCCHH
T ss_conf             9876707898----389899999799981999999997--------58777-8776999989843015742039988299


Q ss_pred             CCCC-----CCCCH--------HHHHHHHHHHH-------------------HHHCCCCCEEEEECCCCCCCHHHHHHHH
Q ss_conf             6611-----38532--------89999999999-------------------9958998569993258898805679999
Q gi|254780750|r  704 DNLA-----SGRST--------FMVEMIETASI-------------------LNQATNQSFVILDEIGRGTATLDGLSIA  751 (920)
Q Consensus       704 D~l~-----~g~ST--------F~vEm~e~~~I-------------------L~~at~~SLVllDElGrGTst~DG~aiA  751 (920)
                      ||+.     .|.+.        ...|+.+....                   .--+.+-.++|+||.-.|-++. ...-.
T Consensus       103 enl~~~~~~~g~~~~~~~~~~~~~l~~~~L~~~~~~~~~~LSgG~kqRl~iA~al~~~P~illLDEPt~gLD~~-~~~~i  181 (224)
T cd03220         103 ENIYLNGRLLGLSRKEIDEKIDEIIEFSELGDFIDLPVKTYSSGMKARLAFAIATALEPDILLIDEVLAVGDAA-FQEKC  181 (224)
T ss_pred             HHHHHHHHHCCCCHHHHHHHHHHHHHHHCCHHHHHCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCHH-HHHHH
T ss_conf             99999999829658999999999998636755653866546999999999999996699999991886656999-99999


Q ss_pred             HHHHHHHHHHCCCEEEEECCCHHHH-HHHH
Q ss_conf             9999999972698499974875797-6643
Q gi|254780750|r  752 WATIEYLHETNRCRGLLATHFHELT-DLSK  780 (920)
Q Consensus       752 ~aile~l~~~~~~~~lfaTHy~eL~-~l~~  780 (920)
                      |..+..+.+. +.-++++||.-+.. .+.+
T Consensus       182 ~~~i~~l~~~-g~tiii~sH~l~~v~~lcd  210 (224)
T cd03220         182 QRRLRELLKQ-GKTVILVSHDPSSIKRLCD  210 (224)
T ss_pred             HHHHHHHHHC-CCEEEEECCCHHHHHHHCC
T ss_conf             9999999858-9999998898899999699


No 69 
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional
Probab=97.95  E-value=0.00095  Score=46.45  Aligned_cols=133  Identities=21%  Similarity=0.266  Sum_probs=68.9

Q ss_pred             EEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHH----------------CCCCCC---CE
Q ss_conf             44345635877776643999967784407899999999999997198530353----------------206822---10
Q gi|254780750|r  635 IANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASY----------------AHIGIV---DK  695 (920)
Q Consensus       635 VpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~----------------a~i~~~---D~  695 (920)
                      +|.+++|..    ..+.+.-|.|||-+||||++|.++        |..-|.+-                -.++.+   ..
T Consensus        14 ~~~~isl~i----~~GE~v~iiG~nGaGKSTLl~~i~--------Gll~p~sG~I~i~G~~~~~~~~~~r~i~~v~Q~~~   81 (233)
T PRK10771         14 LPMRFTLTV----ERGEQVAILGPSGAGKSTLLNLIA--------GFLTPASGSLLINGVDHTTTPPSRRPVSMLFQENN   81 (233)
T ss_pred             EEEEEEEEE----CCCCEEEEECCCCCHHHHHHHHHH--------CCCCCCCEEEEECCEECCCCCHHHCCEEEEECCCC
T ss_conf             876278898----899899999999981999999996--------59999855999999998879988888799905776


Q ss_pred             EEEEEECCCCCCCCCC---HHHHHHH-HHHHHHH----------------------------HCCCCCEEEEECCCCCCC
Q ss_conf             5676523766113853---2899999-9999999----------------------------589985699932588988
Q gi|254780750|r  696 LFSRVGSADNLASGRS---TFMVEMI-ETASILN----------------------------QATNQSFVILDEIGRGTA  743 (920)
Q Consensus       696 IftRiGa~D~l~~g~S---TF~vEm~-e~~~IL~----------------------------~at~~SLVllDElGrGTs  743 (920)
                      +|..+-..|||.-|..   ..-.+.. ....+++                            -+.+-.++|+||--.|=+
T Consensus        82 l~~~ltv~eni~~~~~~~~~~~~~~~~~~~~~l~~~~l~~~~~~~~~~LSGGq~QRv~iAraL~~~P~vLllDEPts~LD  161 (233)
T PRK10771         82 LFSHLTVAQNIGLGLNPGLKLNAAQREKLHAIARQMGIENLLARLPGELSGGQRQRVALARCLVREQPILLLDEPFSALD  161 (233)
T ss_pred             CCCCCCHHHHHHHHHHCCCCCCHHHHHHHHHHHHHCCCHHHHCCCHHHCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCC
T ss_conf             68899099999878622678768899999999987799668608945599999999999999855999999928775579


Q ss_pred             HHHHHHHHHHHHHHHHHHCCCEEEEECCCHH-HHHHHH
Q ss_conf             0567999999999999726984999748757-976643
Q gi|254780750|r  744 TLDGLSIAWATIEYLHETNRCRGLLATHFHE-LTDLSK  780 (920)
Q Consensus       744 t~DG~aiA~aile~l~~~~~~~~lfaTHy~e-L~~l~~  780 (920)
                      +.--.. -+..+..|.+..++-++++||.-+ ...+++
T Consensus       162 ~~~~~~-i~~ll~~l~~~~~~til~vtHdl~~~~~~ad  198 (233)
T PRK10771        162 PALRQE-MLTLVSQVCQQRQLTLLMVSHSVEDAARIAP  198 (233)
T ss_pred             HHHHHH-HHHHHHHHHHHCCCEEEEEECCHHHHHHHCC
T ss_conf             999999-9999999998369899999248999999699


No 70 
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only]
Probab=97.95  E-value=0.0015  Score=44.96  Aligned_cols=134  Identities=25%  Similarity=0.222  Sum_probs=75.7

Q ss_pred             EEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHCCCCCCCEEEEEEECC----CCCCCC
Q ss_conf             4443456358777766439999677844078999999999999971985303532068221056765237----661138
Q gi|254780750|r  634 FIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHIGIVDKLFSRVGSA----DNLASG  709 (920)
Q Consensus       634 fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a~i~~~D~IftRiGa~----D~l~~g  709 (920)
                      .|=.++++...    .+.-+-|.|||.+||||+||.++=.. =...|........+++-||+-.......    |.+..+
T Consensus       336 ~l~~~~s~~i~----~gdrIaiiG~NG~GKSTLlk~l~g~~-~~~~G~v~~g~~v~igyf~Q~~~~l~~~~t~~d~l~~~  410 (530)
T COG0488         336 LLLKDLSFRID----RGDRIAIVGPNGAGKSTLLKLLAGEL-GPLSGTVKVGETVKIGYFDQHRDELDPDKTVLEELSEG  410 (530)
T ss_pred             EEECCCEEEEC----CCCEEEEECCCCCCHHHHHHHHHCCC-CCCCCEEEECCCEEEEEEEEEHHHCCCCCCHHHHHHHH
T ss_conf             46637267765----89889998999877899999985213-56772599579678999870031027667799999864


Q ss_pred             CCH--------------HHHHHH-------------HHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             532--------------899999-------------99999995899856999325889880567999999999999726
Q gi|254780750|r  710 RST--------------FMVEMI-------------ETASILNQATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETN  762 (920)
Q Consensus       710 ~ST--------------F~vEm~-------------e~~~IL~~at~~SLVllDElGrGTst~DG~aiA~aile~l~~~~  762 (920)
                      ...              |--|+.             .+.-..--..+.-+.||||-   |+-.|=-++ .|.-+.|.+-.
T Consensus       411 ~~~~~e~~~r~~L~~f~F~~~~~~~~v~~LSGGEk~Rl~La~ll~~~pNvLlLDEP---TNhLDi~s~-eaLe~aL~~f~  486 (530)
T COG0488         411 FPDGDEQEVRAYLGRFGFTGEDQEKPVGVLSGGEKARLLLAKLLLQPPNLLLLDEP---TNHLDIESL-EALEEALLDFE  486 (530)
T ss_pred             CCCCCHHHHHHHHHHCCCCHHHHCCCHHHCCHHHHHHHHHHHHHCCCCCEEEECCC---CCCCCHHHH-HHHHHHHHHCC
T ss_conf             65432899999999849986796395222587799999999985669978997289---876798899-99999998589


Q ss_pred             CCEEEEECCCHHHHH
Q ss_conf             984999748757976
Q gi|254780750|r  763 RCRGLLATHFHELTD  777 (920)
Q Consensus       763 ~~~~lfaTHy~eL~~  777 (920)
                      |+ +||++|.+.+.+
T Consensus       487 Gt-vl~VSHDr~Fl~  500 (530)
T COG0488         487 GT-VLLVSHDRYFLD  500 (530)
T ss_pred             CE-EEEEECCHHHHH
T ss_conf             86-999948999998


No 71 
>TIGR01978 sufC FeS assembly ATPase SufC; InterPro: IPR010230   Iron-sulphur (FeS) clusters are important cofactors for numerous proteins involved in electron transfer, in redox and non-redox catalysis, in gene regulation, and as sensors of oxygen and iron. These functions depend on the various FeS cluster prosthetic groups, the most common being [2Fe-2S] and [4Fe-4S] . FeS cluster assembly is a complex process involving the mobilisation of Fe and S atoms from storage sources, their assembly into [Fe-S] form, their transport to specific cellular locations, and their transfer to recipient apoproteins. So far, three FeS assembly machineries have been identified, which are capable of synthesising all types of [Fe-S] clusters: ISC (iron-sulphur cluster), SUF (sulphur assimilation), and NIF (nitrogen fixation) systems.   The ISC system is conserved in eubacteria and eukaryotes (mitochondria), and has broad specificity, targeting general FeS proteins , . It is encoded by the isc operon (iscRSUA-hscBA-fdx-iscX). IscS is a cysteine desulphurase, which obtains S from cysteine (converting it to alanine) and serves as a S donor for FeS cluster assembly. IscU and IscA act as scaffolds to accept S and Fe atoms, assembling clusters and transfering them to recipient apoproteins. HscA is a molecular chaperone and HscB is a co-chaperone. Fdx is a [2Fe-2S]-type ferredoxin. IscR is a transcription factor that regulates expression of the isc operon. IscX (also known as YfhJ) appears to interact with IscS and may function as an Fe donor during cluster assembly .   The SUF system is an alternative pathway to the ISC system that operates under iron starvation and oxidative stress. It is found in eubacteria, archaea and eukaryotes (plastids). The SUF system is encoded by the suf operon (sufABCDSE), and the six encoded proteins are arranged into two complexes (SufSE and SufBCD) and one protein (SufA). SufS is a pyridoxal-phosphate (PLP) protein displaying cysteine desulphurase activity. SufE acts as a scaffold protein that accepts S from SufS and donates it to SufA . SufC is an ATPase with an unorthodox ATP-binding cassette (ABC)-like component. No specific functions have been assigned to SufB and SufD. SufA is homologous to IscA , acting as a scaffold protein in which Fe and S atoms are assembled into [FeS] cluster forms, which can then easily be transferred to apoproteins targets.   In the NIF system, NifS and NifU are required for the formation of metalloclusters of nitrogenase in Azotobacter vinelandii, and other organisms, as well as in the maturation of other FeS proteins. Nitrogenase catalyses the fixation of nitrogen. It contains a complex cluster, the FeMo cofactor, which contains molybdenum, Fe and S. NifS is a cysteine desulphurase. NifU binds one Fe atom at its N-terminal, assembling an FeS cluster that is transferred to nitrogenase apoproteins . Nif proteins involved in the formation of FeS clusters can also be found in organisms that do not fix nitrogen .   This entry represents SufC, which acts as an ATPase in the SUF system. SufC belongs to the ATP-binding cassette transporter family (IPR003439 from INTERPRO) but is no longer thought to be part of a transporter. The complex is reported as cytosolic or associated with the membrane.; GO: 0005524 ATP binding, 0006810 transport.
Probab=97.95  E-value=4.3e-05  Score=56.46  Aligned_cols=132  Identities=31%  Similarity=0.434  Sum_probs=84.8

Q ss_pred             EEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCC----------------CHHHCCCCCC-----
Q ss_conf             4434563587777664399996778440789999999999999719853----------------0353206822-----
Q gi|254780750|r  635 IANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYV----------------PASYAHIGIV-----  693 (920)
Q Consensus       635 VpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fV----------------PA~~a~i~~~-----  693 (920)
                      |=.+++|..    ..+-++.|=|||-+||||+.+++     |-+=.|=|                |=+.|+.|+|     
T Consensus        15 IL~gvnL~v----~~GE~HAiMGPNGsGKSTL~~~i-----aGhp~y~vt~G~I~f~G~Dll~l~~~ERAR~GlFLaFQ~   85 (248)
T TIGR01978        15 ILKGVNLTV----KKGEIHAIMGPNGSGKSTLSKTI-----AGHPKYEVTSGTILFKGQDLLELEPDERARAGLFLAFQY   85 (248)
T ss_pred             CCCCCCCCC----CCCEEEEEECCCCCCHHHHHHHH-----HCCCCEEEEEEEEEECCEECCCCCHHHHHCCCCEECCCC
T ss_conf             167867621----68517998688998478887776-----179933784208987765200189655640565101588


Q ss_pred             --------CEEEEEEECCCCC---CCC-----CCHHHHHHHHHHHHHH------HCCCCC--------------------
Q ss_conf             --------1056765237661---138-----5328999999999999------589985--------------------
Q gi|254780750|r  694 --------DKLFSRVGSADNL---ASG-----RSTFMVEMIETASILN------QATNQS--------------------  731 (920)
Q Consensus       694 --------D~IftRiGa~D~l---~~g-----~STF~vEm~e~~~IL~------~at~~S--------------------  731 (920)
                              -..|-|--  =|-   .+|     ..-|.-+|.+.-..|+      .--.||                    
T Consensus        86 P~EIPGV~~~~FlR~A--~NA~R~~~G~~~l~~~~F~~~l~~~~~~l~m~~~~d~~l~R~lNeGFSGGEKKrnEILQm~~  163 (248)
T TIGR01978        86 PEEIPGVSNLEFLRSA--LNARREARGEEPLDLLDFEKLLKEKLALLDMDELSDEFLNRSLNEGFSGGEKKRNEILQMAL  163 (248)
T ss_pred             CCCCCCCCHHHHHHHH--HHHHHHHCCCCCCCHHHHHHHHHHHHHHHCCCHHHHHHHCCCCCCCCCCCCCHHHHHHHHHH
T ss_conf             8556885778899999--99999863899879889999999999985688313887117787454387115768998875


Q ss_pred             ----EEEEECCCCCCCHHHHHHHHHHHHHHHHHH--CCCEEEEECCCHHHHHHH
Q ss_conf             ----699932588988056799999999999972--698499974875797664
Q gi|254780750|r  732 ----FVILDEIGRGTATLDGLSIAWATIEYLHET--NRCRGLLATHFHELTDLS  779 (920)
Q Consensus       732 ----LVllDElGrGTst~DG~aiA~aile~l~~~--~~~~~lfaTHy~eL~~l~  779 (920)
                          |+||||+=.|=+ -|++=+....+..|-+.  .++ +|..|||..|-++-
T Consensus       164 L~P~laiLDE~DSGLD-iDALk~V~~~in~lr~~~P~~~-~liiTHY~rlL~~I  215 (248)
T TIGR01978       164 LEPKLAILDEIDSGLD-IDALKIVAEGINRLREEHPDRA-FLIITHYQRLLNYI  215 (248)
T ss_pred             CCCCEEEEECCCCCCC-HHHHHHHHHHHHHHHCCCCCCE-EEEEECHHHHHHHC
T ss_conf             1995798606888763-7888999999998730689800-89987517884131


No 72 
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance.  Bacitracin is a dodecapeptide antibiotic produced by B. licheniformis and B. subtilis.  The synthesis of bacitracin is non-ribosomally catalyzed by a multienzyme complex BcrABC.  Bacitracin has potent antibiotic activity against gram-positive bacteria.  The inhibition of peptidoglycan biosynthesis is the best characterized bacterial effect of bacitracin.  The bacitracin resistance of B. licheniformis is mediated by the ABC transporter Bcr which is composed of two identical BcrA ATP-binding subunits and one each of the integral membrane proteins, BcrB and BcrC.  B. subtilis cells carrying bcr genes on high-copy number plasmids develop collateral detergent sensitivity, a similar phenomenon in human cells with overexpressed multi-drug resistance P-glycoprotein.
Probab=97.93  E-value=0.00043  Score=48.99  Aligned_cols=141  Identities=19%  Similarity=0.282  Sum_probs=72.3

Q ss_pred             EEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHH-------------------HHHHCCCCCCHHH--CCCCC
Q ss_conf             44434563587777664399996778440789999999999-------------------9997198530353--20682
Q gi|254780750|r  634 FIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIV-------------------IMAQMGSYVPASY--AHIGI  692 (920)
Q Consensus       634 fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~v-------------------ilAQiG~fVPA~~--a~i~~  692 (920)
                      .|=+|+++..    ..+.+.-|-|||-+||||+||.++=..                   ...++|.......  ..+++
T Consensus        14 ~al~~vs~~v----~~Gei~gllG~NGaGKSTLl~~i~Gl~~p~~G~i~i~G~~~~~~~~~~~~ig~~~~~~~l~~~ltv   89 (208)
T cd03268          14 RVLDDISLHV----KKGEIYGFLGPNGAGKTTTMKIILGLIKPDSGEITFDGKSYQKNIEALRRIGALIEAPGFYPNLTA   89 (208)
T ss_pred             EEECCEEEEE----CCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCEEEECCEECCCCHHHHHHEEEEECCCCCCCCCCH
T ss_conf             9871516688----698199999999999999999995783789899999999999796857108999477767898899


Q ss_pred             CCE-----------------EEEEEECCCCCCCCCCHHHHHHHH-HHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHH
Q ss_conf             210-----------------567652376611385328999999-99999958998569993258898805679999999
Q gi|254780750|r  693 VDK-----------------LFSRVGSADNLASGRSTFMVEMIE-TASILNQATNQSFVILDEIGRGTATLDGLSIAWAT  754 (920)
Q Consensus       693 ~D~-----------------IftRiGa~D~l~~g~STF~vEm~e-~~~IL~~at~~SLVllDElGrGTst~DG~aiA~ai  754 (920)
                      .+.                 ++.++|-.+..-+--+++.-=|.+ ++-..--+.+-.++|+||--.|=++..-.. -|.+
T Consensus        90 ~e~l~~~~~~~~~~~~~~~~~l~~~~l~~~~~~~~~~LS~G~kqrl~la~al~~~p~lliLDEPt~GLD~~~~~~-i~~~  168 (208)
T cd03268          90 RENLRLLARLLGIRKKRIDEVLDVVGLKDSAKKKVKGFSLGMKQRLGIALALLGNPDLLILDEPTNGLDPDGIKE-LREL  168 (208)
T ss_pred             HHHHHHHHHHCCCCHHHHHHHHHHCCCCHHHCCCHHHCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCHHHHHH-HHHH
T ss_conf             999999998749988999999998099503369035699999999999999856999999938876899999999-9999


Q ss_pred             HHHHHHHCCCEEEEECCCHH-HHHHHH
Q ss_conf             99999726984999748757-976643
Q gi|254780750|r  755 IEYLHETNRCRGLLATHFHE-LTDLSK  780 (920)
Q Consensus       755 le~l~~~~~~~~lfaTHy~e-L~~l~~  780 (920)
                      +..+.+. +.-.+++||..+ +..+.+
T Consensus       169 l~~l~~~-g~til~~sH~l~e~~~~~d  194 (208)
T cd03268         169 ILSLRDQ-GITVLISSHLLSEIQKVAD  194 (208)
T ss_pred             HHHHHHC-CCEEEEECCCHHHHHHHCC
T ss_conf             9999958-9999998986899999699


No 73 
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter.  The CCM family is involved in bacterial cytochrome c biogenesis.  Cytochrome c maturation in E. coli requires the ccm operon, which encodes eight membrane proteins (CcmABCDEFGH).  CcmE is a periplasmic heme chaperone that binds heme covalently and transfers it onto apocytochrome c in the presence of CcmF, CcmG, and CcmH.  The CcmAB proteins represent an ABC transporter and the CcmCD proteins participate in heme transfer to CcmE.
Probab=97.93  E-value=0.00041  Score=49.16  Aligned_cols=131  Identities=18%  Similarity=0.131  Sum_probs=64.3

Q ss_pred             EEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHCCCCC---------------------C
Q ss_conf             4434563587777664399996778440789999999999999719853035320682---------------------2
Q gi|254780750|r  635 IANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHIGI---------------------V  693 (920)
Q Consensus       635 VpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a~i~~---------------------~  693 (920)
                      |=+|+++..    ..+.+..|+|||-+||||++|.++=+         +|..+-++.+                     .
T Consensus        15 il~~vs~~i----~~Ge~~~l~G~NGsGKSTLlk~i~Gl---------~~p~sG~i~~~g~~~~~~~~~~~~~i~~~~~~   81 (201)
T cd03231          15 LFSGLSFTL----AAGEALQVTGPNGSGKTTLLRILAGL---------SPPLAGRVLLNGGPLDFQRDSIARGLLYLGHA   81 (201)
T ss_pred             EEECCEEEE----CCCCEEEEECCCCCCHHHHHHHHHCC---------CCCCCEEEEECCEECCCCCHHHHHHEEEECCC
T ss_conf             995307888----79959999999999999999999667---------78885299999998331487767117997876


Q ss_pred             CEEEEEEECCCCCCCCCCHHHH--------------------------HHHHHHHHHHHCCCCCEEEEECCCCCCCHHHH
Q ss_conf             1056765237661138532899--------------------------99999999995899856999325889880567
Q gi|254780750|r  694 DKLFSRVGSADNLASGRSTFMV--------------------------EMIETASILNQATNQSFVILDEIGRGTATLDG  747 (920)
Q Consensus       694 D~IftRiGa~D~l~~g~STF~v--------------------------Em~e~~~IL~~at~~SLVllDElGrGTst~DG  747 (920)
                      +.++..+.+.+++.-..+....                          |...++-..--+..-.+.|+||--.|=+...-
T Consensus        82 ~~~~~~ltv~en~~~~~~~~~~~~~~~~L~~~~l~~~~~~~~~~LSgGqkqRv~lA~al~~~p~llllDEPt~gLD~~s~  161 (201)
T cd03231          82 PGIKTTLSVLENLRFWHADHSDEQVEEALARVGLNGFEDRPVAQLSAGQQRRVALARLLLSGRPLWILDEPTTALDKAGV  161 (201)
T ss_pred             CCCCCCCCHHHHHHHHHHHCCHHHHHHHHHHCCCCHHHCCCHHHCCHHHHHHHHHHHHHHCCCCEEEECCCCCCCCHHHH
T ss_conf             54557878999998753223699999999985991032588234799999999999999749999998088655799999


Q ss_pred             HHHHHHHHHHHHHHCCCEEEEECC-CHHHHHHHH
Q ss_conf             999999999999726984999748-757976643
Q gi|254780750|r  748 LSIAWATIEYLHETNRCRGLLATH-FHELTDLSK  780 (920)
Q Consensus       748 ~aiA~aile~l~~~~~~~~lfaTH-y~eL~~l~~  780 (920)
                      ..+ +.++..+.+. ++.++++|| ..++.+...
T Consensus       162 ~~~-~~~l~~~~~~-g~~ii~~sH~~~~~~~~~~  193 (201)
T cd03231         162 ARF-AEAMAGHCAR-GGMVVLTTHQDLGLSEAGA  193 (201)
T ss_pred             HHH-HHHHHHHHHC-CCEEEEEECCHHHHHHHCC
T ss_conf             999-9999999868-9999999867146787229


No 74 
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional
Probab=97.93  E-value=0.00016  Score=52.17  Aligned_cols=49  Identities=12%  Similarity=0.069  Sum_probs=34.7

Q ss_pred             CCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHH
Q ss_conf             89985699932588988056799999999999972698499974875797
Q gi|254780750|r  727 ATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFHELT  776 (920)
Q Consensus       727 at~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~  776 (920)
                      |.+-.++|+||--.|=++.-...+ +.++..|.+..+..++++||.-++.
T Consensus       159 ~~~P~illLDEPts~LD~~~~~~i-~~~i~~l~~~~g~tvi~vtHdl~~a  207 (265)
T PRK10253        159 AQETAIMLLDEPTTWLDISHQIDL-LELLSELNREKGYTLAAVLHDLNQA  207 (265)
T ss_pred             HCCCCEEEECCCCCCCCHHHHHHH-HHHHHHHHHHHCCEEEEEECCHHHH
T ss_conf             569998998188766899999999-9999999985098999993599999


No 75 
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds.  Mutations of members of ABCA subfamily are associated with human genetic diseases, such as, familial high-density lipoprotein (HDL) deficiency, neonatal surfactant deficiency, degenerative retinopathies, and congenital keratinization disorders.  The ABCA1 protein is involved in disorders of cholesterol transport and high-density lipoprotein (HDL) biosynthesis.  The ABCA4 (ABCR) protein transports vitamin A derivatives in the outer segments of photoreceptor cells, and therefore, performs a crucial step in the visual cycle.  The ABCA genes are not present in yeast.  However, evolutionary studies of ABCA genes indicate that they arose as transporters that subsequently duplicated and that certain sets of ABCA genes were lost in different eukaryotic lineages.
Probab=97.92  E-value=0.00013  Score=52.95  Aligned_cols=130  Identities=23%  Similarity=0.292  Sum_probs=68.5

Q ss_pred             EEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHH--------------------HHHHCCCCCCHHHCCCCCCC
Q ss_conf             4434563587777664399996778440789999999999--------------------99971985303532068221
Q gi|254780750|r  635 IANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIV--------------------IMAQMGSYVPASYAHIGIVD  694 (920)
Q Consensus       635 VpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~v--------------------ilAQiG~fVPA~~a~i~~~D  694 (920)
                      |=+|+++..    ..+.+.-|-|||-+||||+||.++=+.                    +-.++| |||-+.       
T Consensus        17 aL~~is~~i----~~Gei~~llG~NGaGKSTLl~~i~Gl~~p~~G~I~i~G~~i~~~~~~~~~~ig-~v~q~~-------   84 (220)
T cd03263          17 AVDDLSLNV----YKGEIFGLLGHNGAGKTTTLKMLTGELRPTSGTAYINGYSIRTDRKAARQSLG-YCPQFD-------   84 (220)
T ss_pred             EEECCEEEE----CCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCCEEECCEECCCCHHHHHCCEE-EEECCC-------
T ss_conf             984408898----49959999989997399999999669878899779999977658898860569-992356-------


Q ss_pred             EEEEEEECCCCCC-----CCCCH-----------------------------HHHHHHHHHHHHHHCCCCCEEEEECCCC
Q ss_conf             0567652376611-----38532-----------------------------8999999999999589985699932588
Q gi|254780750|r  695 KLFSRVGSADNLA-----SGRST-----------------------------FMVEMIETASILNQATNQSFVILDEIGR  740 (920)
Q Consensus       695 ~IftRiGa~D~l~-----~g~ST-----------------------------F~vEm~e~~~IL~~at~~SLVllDElGr  740 (920)
                      .+|..+-..|++.     .|.+.                             =|--....+  .--+..-.++|+||--.
T Consensus        85 ~l~~~ltv~e~l~~~~~~~g~~~~~~~~~~~~~l~~~~l~~~~~~~~~~LSgG~kqrv~ia--~al~~~P~lliLDEPt~  162 (220)
T cd03263          85 ALFDELTVREHLRFYARLKGLPKSEIKEEVELLLRVLGLTDKANKRARTLSGGMKRKLSLA--IALIGGPSVLLLDEPTS  162 (220)
T ss_pred             CCCCCCCHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHCCCHHHCCHHHHHHHHHH--HHHHCCCCEEEEECCCC
T ss_conf             5687887999999989756999899999999999876967775075767899999999999--99956999999958876


Q ss_pred             CCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHH-HHHHH
Q ss_conf             988056799999999999972698499974875797-66430
Q gi|254780750|r  741 GTATLDGLSIAWATIEYLHETNRCRGLLATHFHELT-DLSKS  781 (920)
Q Consensus       741 GTst~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~-~l~~~  781 (920)
                      |=++.--. .-|..+..+. . +.-++++||.-+.. .+++.
T Consensus       163 gLD~~~~~-~i~~~l~~~~-~-~~tii~~tH~l~e~~~l~dr  201 (220)
T cd03263         163 GLDPASRR-AIWDLILEVR-K-GRSIILTTHSMDEAEALCDR  201 (220)
T ss_pred             CCCHHHHH-HHHHHHHHHH-C-CCEEEEECCCHHHHHHHCCE
T ss_conf             88999999-9999999984-8-99899996878999996999


No 76 
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed
Probab=97.92  E-value=0.00014  Score=52.66  Aligned_cols=136  Identities=25%  Similarity=0.345  Sum_probs=72.0

Q ss_pred             EEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCC----------CCCCHHH---CCCCCCCEEEEE-
Q ss_conf             44434563587777664399996778440789999999999999719----------8530353---206822105676-
Q gi|254780750|r  634 FIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMG----------SYVPASY---AHIGIVDKLFSR-  699 (920)
Q Consensus       634 fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG----------~fVPA~~---a~i~~~D~IftR-  699 (920)
                      -|=+|+++..    ..+.++-|.|||-+||||++|.++=+.- ..-|          .|||-+-   ..++....-|.+ 
T Consensus        18 ~vL~~vs~~i----~~Gei~~LiGpNGaGKSTLlk~I~Gl~~-p~~G~I~~~~~~~igyvpq~~~~~~~~~~~~~~~~~~   92 (251)
T PRK09544         18 RVLSDVSLEL----KPGKILTLLGPNGAGKSTLVRVVLGLVA-PDEGVIKRNGKLRIGYVPQKLYLDTTLPLTVNRFLRL   92 (251)
T ss_pred             EEEECEEEEE----CCCCEEEEECCCCCCHHHHHHHHHCCCC-CCCCEEEECCCCEEECCCHHHHCCCCCHHHHHHHHHC
T ss_conf             9996307898----7997999998999889999999966888-9860899999402620437762187621899998632


Q ss_pred             ---------------EECCCCC---CCCCCHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             ---------------5237661---1385328999999999999589985699932588988056799999999999972
Q gi|254780750|r  700 ---------------VGSADNL---ASGRSTFMVEMIETASILNQATNQSFVILDEIGRGTATLDGLSIAWATIEYLHET  761 (920)
Q Consensus       700 ---------------iGa~D~l---~~g~STF~vEm~e~~~IL~~at~~SLVllDElGrGTst~DG~aiA~aile~l~~~  761 (920)
                                     ++..+-+   ....|.=+--....|..|  +.+-.++|+||--.|=++.--..+ +.++..|.+.
T Consensus        93 ~~~~~~~~i~~~l~~~~~~~~~~~~~~~LSGGq~QRv~iAraL--~~~P~lLiLDEPTsgLD~~~~~~i-~~li~~L~~e  169 (251)
T PRK09544         93 RPGTKKEDILPALKRVQAGHLIDAPMQKLSGGETQRVLLARAL--LNRPQLLVLDEPTQGVDVNGQVAL-YDLIDQLRRE  169 (251)
T ss_pred             CCCCCHHHHHHHHHHHCCCHHHHCCHHHCCHHHHHHHHHHHHH--HCCCCEEEEECCCCCCCHHHHHHH-HHHHHHHHHH
T ss_conf             7665389999999873852243265445899999999999999--749998998098646899999999-9999999983


Q ss_pred             CCCEEEEECCCHHHHH
Q ss_conf             6984999748757976
Q gi|254780750|r  762 NRCRGLLATHFHELTD  777 (920)
Q Consensus       762 ~~~~~lfaTHy~eL~~  777 (920)
                      .++-+|++||.-+...
T Consensus       170 ~g~til~vtHDl~~~~  185 (251)
T PRK09544        170 LDCAVLMVSHDLHLVM  185 (251)
T ss_pred             CCCEEEEEECCHHHHH
T ss_conf             2989999906899999


No 77 
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional
Probab=97.92  E-value=0.00028  Score=50.38  Aligned_cols=131  Identities=21%  Similarity=0.208  Sum_probs=69.8

Q ss_pred             EEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHCCCCCCC--------------------
Q ss_conf             443456358777766439999677844078999999999999971985303532068221--------------------
Q gi|254780750|r  635 IANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHIGIVD--------------------  694 (920)
Q Consensus       635 VpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a~i~~~D--------------------  694 (920)
                      |=+||+|..    ..+.+.-|.|||-+||||+||.++=+         .|.++-++.+..                    
T Consensus        25 vL~~isl~i----~~GE~v~ivG~sGsGKSTLl~~i~Gl---------~~p~~G~I~~~G~~~~~~~~~~~~~~r~~~ig   91 (228)
T PRK10584         25 ILTGVELVV----KRGETIALIGESGSGKSTLLAILAGL---------DDGSSGEVSLVGQPLHNMDEEARAKLRAKHVG   91 (228)
T ss_pred             EEECEEEEE----CCCCEEEEECCCCCHHHHHHHHHHCC---------CCCCCEEEEECCEECCCCCHHHHHHHHCCCEE
T ss_conf             984738899----99989999999985899999999669---------99996799999999997998899876306477


Q ss_pred             ------EEEEEEECCCCCCC-----CCCH-----HHHHHHH---HH------------------HHH-HHCCCCCEEEEE
Q ss_conf             ------05676523766113-----8532-----8999999---99------------------999-958998569993
Q gi|254780750|r  695 ------KLFSRVGSADNLAS-----GRST-----FMVEMIE---TA------------------SIL-NQATNQSFVILD  736 (920)
Q Consensus       695 ------~IftRiGa~D~l~~-----g~ST-----F~vEm~e---~~------------------~IL-~~at~~SLVllD  736 (920)
                            .+|..+...||+.-     |.+.     -..|+.+   ..                  .|- --+..-.++|+|
T Consensus        92 ~v~Q~~~l~~~~tv~eni~~~~~~~~~~~~~~~~~~~~~l~~~gl~~~~~~~p~~LSGGq~QRv~iAraL~~~P~llllD  171 (228)
T PRK10584         92 FVFQSFMLIPTLNALENVELPALLRGESSAQSRNGAKALLEQLGLGKRLDHLPAQLSGGEQQRVALARAFNGRPDVLFAD  171 (228)
T ss_pred             EEECCCCCCCCCCHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHCCCCCCCCHHHHHHHHHHHHHHCCCCEEEEC
T ss_conf             98140224798702123346898808998999999864554217344540887889979999999999987599999984


Q ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHH
Q ss_conf             2588988056799999999999972698499974875797664
Q gi|254780750|r  737 EIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFHELTDLS  779 (920)
Q Consensus       737 ElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~~l~  779 (920)
                      |--.|-++.....| +..+..+.+..+...+|+||..++....
T Consensus       172 EPT~~LD~~~~~~i-~~~l~~l~~~~g~tii~vtHd~~~~~~~  213 (228)
T PRK10584        172 EPTGNLDRQTGDKI-ADLLFSLNREHGTTLILVTHDLQLAARC  213 (228)
T ss_pred             CCCCCCCHHHHHHH-HHHHHHHHHHCCCEEEEECCCHHHHHHC
T ss_conf             99767899999999-9999999997298999988669999858


No 78 
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota.  The transition metal cobalt is an essential component of many enzymes and must be transported into cells in appropriate amounts when needed.  The CbiMNQO family ABC transport system is involved in cobalt transport in association with the cobalamin (vitamin B12) biosynthetic pathways.  Most cobalt (Cbi) transport systems possess a separate CbiN component, the cobalt-binding periplasmic protein, and they are encoded by the conserved gene cluster cbiMNQO.  Both the CbiM and CbiQ proteins are integral cytoplasmic membrane proteins, and the CbiO protein has the linker peptide and the Walker A and B motifs commonly found in the ATPase components of the ABC-type transport systems.
Probab=97.91  E-value=0.00017  Score=52.04  Aligned_cols=134  Identities=22%  Similarity=0.248  Sum_probs=68.9

Q ss_pred             EEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCC------------------CCCCHHHCCCCCCCE
Q ss_conf             44434563587777664399996778440789999999999999719------------------853035320682210
Q gi|254780750|r  634 FIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMG------------------SYVPASYAHIGIVDK  695 (920)
Q Consensus       634 fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG------------------~fVPA~~a~i~~~D~  695 (920)
                      .|=+|++|..    ..+.+..|.|||-+||||++|.++=+.- .+-|                  .|||-+.     -+.
T Consensus        14 ~vL~~vsl~i----~~Gei~~iiG~nGaGKSTLl~~i~Gl~~-p~~G~I~~~g~~~~~~~~~~~ig~v~Q~~-----~~~   83 (205)
T cd03226          14 EILDDLSLDL----YAGEIIALTGKNGAGKTTLAKILAGLIK-ESSGSILLNGKPIKAKERRKSIGYVMQDV-----DYQ   83 (205)
T ss_pred             EEEEEEEEEE----CCCCEEEEECCCCCCHHHHHHHHHCCCC-CCCCEEEECCEECCHHHHHCCEEEEEECC-----CCC
T ss_conf             7864037888----6998999988999989999999956857-77873899999996578744489996278-----644


Q ss_pred             EEEEEECCCCCCCCCCHHHHHHHHHHHHHH----------------------------HCCCCCEEEEECCCCCCCHHHH
Q ss_conf             567652376611385328999999999999----------------------------5899856999325889880567
Q gi|254780750|r  696 LFSRVGSADNLASGRSTFMVEMIETASILN----------------------------QATNQSFVILDEIGRGTATLDG  747 (920)
Q Consensus       696 IftRiGa~D~l~~g~STF~vEm~e~~~IL~----------------------------~at~~SLVllDElGrGTst~DG  747 (920)
                      +|.. -..+++.-+....-..-.++..+|.                            -+..-.++|+||--.|=++. +
T Consensus        84 l~~~-tv~~~l~~~~~~~~~~~~~~~~~l~~~~l~~~~~~~~~~LSGGqkQrv~iA~aL~~~P~illLDEPt~gLD~~-~  161 (205)
T cd03226          84 LFTD-SVREELLLGLKELDAGNEQAETVLKDLDLYALKERHPLSLSGGQKQRLAIAAALLSGKDLLIFDEPTSGLDYK-N  161 (205)
T ss_pred             CCHH-HHHHHHHHCCCCCCCHHHHHHHHHHHCCCCHHHHCCHHHCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCHH-H
T ss_conf             2064-7999997048785607999999999769923553891128999999999999997599999997997658999-9


Q ss_pred             HHHHHHHHHHHHHHCCCEEEEECCCHHHH-HHHH
Q ss_conf             99999999999972698499974875797-6643
Q gi|254780750|r  748 LSIAWATIEYLHETNRCRGLLATHFHELT-DLSK  780 (920)
Q Consensus       748 ~aiA~aile~l~~~~~~~~lfaTHy~eL~-~l~~  780 (920)
                      ...-+.++..|.+. +..++++||..+.. .+++
T Consensus       162 ~~~i~~ll~~l~~~-g~tvi~itHdl~~~~~~~d  194 (205)
T cd03226         162 MERVGELIRELAAQ-GKAVIVITHDYEFLAKVCD  194 (205)
T ss_pred             HHHHHHHHHHHHHC-CCEEEEEECCHHHHHHHCC
T ss_conf             99999999999979-9999998039899999799


No 79 
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters.  This family includes transporters involved in the uptake of various metallic cations such as iron, manganese, and zinc.  The ATPases of this group of transporters are very similar to members of iron-siderophore uptake family suggesting that they share a common ancestor.  The best characterized metal-type ABC transporters are the YfeABCD system of Y. pestis, the SitABCD system of Salmonella enterica serovar Typhimurium, and the SitABCD transporter of Shigella flexneri.  Moreover other uncharacterized homologs of these metal-type transporters are mainly found in pathogens like Haemophilus or enteroinvasive E. coli isolates.
Probab=97.91  E-value=0.00014  Score=52.71  Aligned_cols=48  Identities=21%  Similarity=0.216  Sum_probs=34.7

Q ss_pred             CCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHH
Q ss_conf             89985699932588988056799999999999972698499974875797
Q gi|254780750|r  727 ATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFHELT  776 (920)
Q Consensus       727 at~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~  776 (920)
                      +.+-.++|+||--.|=++.--..+ +.++..|.+. +..++|+||.-+..
T Consensus       148 ~~~P~lLlLDEPtsgLD~~~~~~~-~~~i~~l~~~-g~tii~vtHdl~~~  195 (213)
T cd03235         148 VQDPDLLLLDEPFAGVDPKTQEDI-YELLRELRRE-GMTILVVTHDLGLV  195 (213)
T ss_pred             HCCCCEEEECCCCCCCCHHHHHHH-HHHHHHHHHC-CCEEEEEECCHHHH
T ss_conf             669999998188667899999999-9999999968-99999990798999


No 80 
>KOG0062 consensus
Probab=97.89  E-value=1.7e-05  Score=59.55  Aligned_cols=43  Identities=30%  Similarity=0.279  Sum_probs=28.1

Q ss_pred             CEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHH
Q ss_conf             569993258898805679999999999997269849997487579766
Q gi|254780750|r  731 SFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFHELTDL  778 (920)
Q Consensus       731 SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~~l  778 (920)
                      -|++|||-   |+-.|--+| -|..+.|-...|- ++..||--++...
T Consensus       502 hlLVLDEP---TNhLD~dsl-~AL~~Al~~F~GG-Vv~VSHd~~fi~~  544 (582)
T KOG0062         502 HLLVLDEP---TNHLDRDSL-GALAKALKNFNGG-VVLVSHDEEFISS  544 (582)
T ss_pred             CEEEECCC---CCCCCHHHH-HHHHHHHHHCCCC-EEEEECCHHHHHH
T ss_conf             68984488---763367778-9999999855894-7999775899863


No 81 
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=97.89  E-value=0.00013  Score=52.84  Aligned_cols=138  Identities=26%  Similarity=0.288  Sum_probs=72.5

Q ss_pred             EEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCC------CC---HH--HCCCCCC-----CEEEE
Q ss_conf             443456358777766439999677844078999999999999971985------30---35--3206822-----10567
Q gi|254780750|r  635 IANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSY------VP---AS--YAHIGIV-----DKLFS  698 (920)
Q Consensus       635 VpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~f------VP---A~--~a~i~~~-----D~Ift  698 (920)
                      +=+++++..    ..+.+.-|.|||-+||||++|.++=+ +-.+-|.-      +.   ..  ...+|.+     +.+|.
T Consensus        20 aL~~vs~~i----~~Ge~~aiiG~NGsGKSTLl~~l~Gl-~~p~~G~I~i~G~~i~~~~~~~lr~~iG~vfQ~p~~ql~~   94 (273)
T PRK13647         20 ALDGVSLVI----PEGSKTAILGPNGAGKSTLLLHLNGI-YTAQRGRVKVMGKVVNEENIRWIRKKVGLVFQDPDDQLFS   94 (273)
T ss_pred             EEEEEEEEE----CCCCEEEEECCCCCHHHHHHHHHHCC-CCCCCEEEEECCEECCCCCHHHHHHHCEEEECCCHHHHCC
T ss_conf             988117898----89989999999997599999999669-8888619999999999689899987524881070243052


Q ss_pred             EEECCCCCCCCCCHH---HHHHHH-HHHHHH----------------------------HCCCCCEEEEECCCCCCCHHH
Q ss_conf             652376611385328---999999-999999----------------------------589985699932588988056
Q gi|254780750|r  699 RVGSADNLASGRSTF---MVEMIE-TASILN----------------------------QATNQSFVILDEIGRGTATLD  746 (920)
Q Consensus       699 RiGa~D~l~~g~STF---~vEm~e-~~~IL~----------------------------~at~~SLVllDElGrGTst~D  746 (920)
                      . -..|++.-|.-.+   --|+.+ +..+|.                            -|..-.++|+||--.|=++.-
T Consensus        95 ~-tV~e~v~fg~~~~g~~~~e~~~rv~~~L~~~~l~~~~~~~p~~LSGGqkqRvaiA~aL~~~P~lliLDEPtagLDp~~  173 (273)
T PRK13647         95 S-TVWDDVAFGPQNLELDKKEILRRVEEALKAVDMWDLREKAPYHLSYGQKKRVAIAGVLAMEPDIIVLDEPMAYLDPRG  173 (273)
T ss_pred             C-HHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHHCCHHHCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCHHH
T ss_conf             4-199999999988599999999999999987795876647933399989999999999981999999979765799999


Q ss_pred             HHHHHHHHHHHHHHHCCCEEEEECCCHHHH-HHHH
Q ss_conf             799999999999972698499974875797-6643
Q gi|254780750|r  747 GLSIAWATIEYLHETNRCRGLLATHFHELT-DLSK  780 (920)
Q Consensus       747 G~aiA~aile~l~~~~~~~~lfaTHy~eL~-~l~~  780 (920)
                      - ..-+.+++.|.+. +..++++||.-+.. .+++
T Consensus       174 ~-~~l~~~l~~L~~~-G~Tvi~vtHdl~~~~~~aD  206 (273)
T PRK13647        174 K-EELTAILNRLNNE-GKTVIVATHDVDLALEWAD  206 (273)
T ss_pred             H-HHHHHHHHHHHHC-CCEEEEEECCHHHHHHHCC
T ss_conf             9-9999999999848-9999999417899999699


No 82 
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids.  The  E. coli branched-chain amino acid transporter comprises a heterodimer of ABC transporters (LivF and LivG), a heterodimer of six-helix TM domains (LivM and LivH), and one of two alternative soluble periplasmic substrate binding proteins (LivK or LivJ).  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.
Probab=97.89  E-value=0.00012  Score=53.09  Aligned_cols=133  Identities=23%  Similarity=0.302  Sum_probs=72.3

Q ss_pred             EEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHH--------------------HHHHCC-CCCCHHHCCCCCC
Q ss_conf             4434563587777664399996778440789999999999--------------------999719-8530353206822
Q gi|254780750|r  635 IANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIV--------------------IMAQMG-SYVPASYAHIGIV  693 (920)
Q Consensus       635 VpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~v--------------------ilAQiG-~fVPA~~a~i~~~  693 (920)
                      |=+|+++..    ..+.+.-|-|||-+||||++|.++=+.                    -.++.| .|||-+.      
T Consensus        15 ~L~~vs~~v----~~Gei~~liG~nGaGKSTLl~~i~Gl~~p~~G~I~~~G~~i~~~~~~~~~~~gi~~v~Q~~------   84 (222)
T cd03224          15 ILFGVSLTV----PEGEIVALLGRNGAGKTTLLKTIMGLLPPRSGSIRFDGRDITGLPPHERARAGIGYVPEGR------   84 (222)
T ss_pred             EECCEEEEE----CCCCEEEEECCCCCCHHHHHHHHHCCCCCCCEEEEECCEECCCCCHHHHHHCCEEEECCCC------
T ss_conf             981408998----8998999999999859999999977988996099999999999999999975938963566------


Q ss_pred             CEEEEEEECCCCCCCCCCH-----HH---HHHHH----HHHHH-------------------HHCCCCCEEEEECCCCCC
Q ss_conf             1056765237661138532-----89---99999----99999-------------------958998569993258898
Q gi|254780750|r  694 DKLFSRVGSADNLASGRST-----FM---VEMIE----TASIL-------------------NQATNQSFVILDEIGRGT  742 (920)
Q Consensus       694 D~IftRiGa~D~l~~g~ST-----F~---vEm~e----~~~IL-------------------~~at~~SLVllDElGrGT  742 (920)
                       .+|..+-..||+.-|...     ..   -++.+    ....+                   --+..-.++|+||--.|=
T Consensus        85 -~l~~~ltv~enl~~~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~~~LSgG~~Qrv~iAraL~~~P~lllLDEPt~gL  163 (222)
T cd03224          85 -RIFPELTVEENLLLGAYARRRAKRKARLERVYELFPRLKERRKQLAGTLSGGEQQMLAIARALMSRPKLLLLDEPSEGL  163 (222)
T ss_pred             -CCCCCCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHCCHHHCCHHHHHHHHHHHHHHCCCCEEEEECCCCCC
T ss_conf             -5688990999999987635813599999999988663799874845448999999999999996499999993865479


Q ss_pred             CHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHH-HHHH
Q ss_conf             8056799999999999972698499974875797-6643
Q gi|254780750|r  743 ATLDGLSIAWATIEYLHETNRCRGLLATHFHELT-DLSK  780 (920)
Q Consensus       743 st~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~-~l~~  780 (920)
                      ++..-..| |..+..+.+. +.-++++||.-+.. .+++
T Consensus       164 D~~~~~~i-~~~l~~l~~~-g~tii~vtHdl~~~~~~~D  200 (222)
T cd03224         164 APKIVEEI-FEAIRELRDE-GVTILLVEQNARFALEIAD  200 (222)
T ss_pred             CHHHHHHH-HHHHHHHHHC-CCEEEEECCCHHHHHHHCC
T ss_conf             99999999-9999999956-9999999085899999699


No 83 
>PRK09700 D-allose transporter ATP-binding protein; Provisional
Probab=97.88  E-value=0.00023  Score=50.99  Aligned_cols=52  Identities=15%  Similarity=0.168  Sum_probs=36.7

Q ss_pred             CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHH-HHHHHHH
Q ss_conf             99856999325889880567999999999999726984999748757-9766430
Q gi|254780750|r  728 TNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFHE-LTDLSKS  781 (920)
Q Consensus       728 t~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~e-L~~l~~~  781 (920)
                      ..-.++|+||--+|=++..-..| |.++..+.+. +.-++|.||.-+ +..+.+.
T Consensus       426 ~~p~lLilDEPT~GlD~~~~~~i-~~li~~l~~~-G~tvl~ishdl~ev~~~~DR  478 (510)
T PRK09700        426 CCPEVIIFDEPTRGIDVGAKAEI-YKVMRQLADD-GKVILMVSSELPEIITVCDR  478 (510)
T ss_pred             HCCCEEEEECCCCCCCHHHHHHH-HHHHHHHHHC-CCEEEEEECCHHHHHHHCCE
T ss_conf             59988999797558999999999-9999999968-99999990758999986999


No 84 
>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional
Probab=97.88  E-value=0.00011  Score=53.52  Aligned_cols=163  Identities=18%  Similarity=0.194  Sum_probs=82.6

Q ss_pred             EEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHCCCCCCC---------EEEEEEECCCC
Q ss_conf             443456358777766439999677844078999999999999971985303532068221---------05676523766
Q gi|254780750|r  635 IANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHIGIVD---------KLFSRVGSADN  705 (920)
Q Consensus       635 VpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a~i~~~D---------~IftRiGa~D~  705 (920)
                      .=||++|..    ..+.++-|-|||-+||||++|.++        |..-|-+ -++.+.-         .++-++...++
T Consensus        39 AL~dVsf~i----~~GEivgllG~NGaGKSTLlk~I~--------Gl~~P~~-G~I~~~G~i~~~~~~~~l~~~lt~~en  105 (264)
T PRK13546         39 ALDDISLKA----YEGDVIGLVGINGSGKSTLSNIIG--------GSLSPTV-GKVDRNGEVSVIAISAGLSGQLTGIEN  105 (264)
T ss_pred             EECCCEEEE----CCCCEEEEECCCCCHHHHHHHHHH--------CCCCCCC-CEEEECCEEEEEEECCCCCCCCEEEHH
T ss_conf             952707888----599899999899861999999996--------7988887-479999887488503565744300015


Q ss_pred             CC-----CCCCH-----HH---HHHHHHHHHH-------------------HHCCCCCEEEEECCCCCCCHHHHHHHHHH
Q ss_conf             11-----38532-----89---9999999999-------------------95899856999325889880567999999
Q gi|254780750|r  706 LA-----SGRST-----FM---VEMIETASIL-------------------NQATNQSFVILDEIGRGTATLDGLSIAWA  753 (920)
Q Consensus       706 l~-----~g~ST-----F~---vEm~e~~~IL-------------------~~at~~SLVllDElGrGTst~DG~aiA~a  753 (920)
                      +.     .|.+-     ..   .|+.+....+                   --+..-.++|+||--.|-++.--..+ |.
T Consensus       106 i~~~~~~~g~~~~~~~~~~~~~le~~~l~~~~~~~~~~LSgGqkqrl~lA~al~~~P~iLiLDEPts~LD~~~~~~i-~~  184 (264)
T PRK13546        106 IEFKMLCMGFKRKEIKAMTPKIIEFSELGEFIYQPVKKYSSGMRAKLGFSINITVNPDILVIDEALSVGDQTFAQKC-LD  184 (264)
T ss_pred             HHHHHHHCCCCHHHHHHHHHHHHHHHCCHHHHHCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCHHHHHHH-HH
T ss_conf             88899872424999999999999851205565175534799999999999999569999999598754899999999-99


Q ss_pred             HHHHHHHHCCCEEEEECCCHHHH-HHHHHCCCEEEEEEEEEEECCEEEEEEEEEECCCCCCHHHHHHHHCCCCHHHHHHH
Q ss_conf             99999972698499974875797-66430688589999999609927787777447898877899999829998999999
Q gi|254780750|r  754 TIEYLHETNRCRGLLATHFHELT-DLSKSLKRFHNATLQVSDSNEGIIFLHKVIPGIADHSYGIQVGKLAGLPNTVISRA  832 (920)
Q Consensus       754 ile~l~~~~~~~~lfaTHy~eL~-~l~~~~~~v~n~~~~~~~~~~~i~flykl~~G~~~~Sygi~vA~laG~p~~vi~~A  832 (920)
                      .+..+.+. +...+|+||.-+.. .+.+.   +.     + -.+++|.                    ..|=|++|+++-
T Consensus       185 ~i~~l~~~-g~TiilvSH~l~~v~~lcDr---i~-----v-l~~GkIi--------------------~~G~~~evl~ky  234 (264)
T PRK13546        185 KIYEFKEQ-NKTIFFVSHNLGQVRQFCTK---IA-----W-IEGGKLK--------------------DYGELDDVLPKY  234 (264)
T ss_pred             HHHHHHHC-CCEEEEECCCHHHHHHHCCE---EE-----E-EECCEEE--------------------EECCHHHHHHHH
T ss_conf             99999968-98999984878999986999---99-----9-9898899--------------------985999999999


Q ss_pred             HHHHHHHHH
Q ss_conf             999999987
Q gi|254780750|r  833 YDILKTFEK  841 (920)
Q Consensus       833 ~~~~~~le~  841 (920)
                      ++....+-+
T Consensus       235 ~~~~~~~~~  243 (264)
T PRK13546        235 EAFLNDFKK  243 (264)
T ss_pred             HHHHHHHHH
T ss_conf             999999986


No 85 
>PRK03695 vitamin B12-transporter ATPase; Provisional
Probab=97.88  E-value=0.00011  Score=53.36  Aligned_cols=136  Identities=19%  Similarity=0.193  Sum_probs=71.1

Q ss_pred             EEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHH-------------------HHHHCCCCCCHHHC---CCCC
Q ss_conf             4434563587777664399996778440789999999999-------------------99971985303532---0682
Q gi|254780750|r  635 IANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIV-------------------IMAQMGSYVPASYA---HIGI  692 (920)
Q Consensus       635 VpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~v-------------------ilAQiG~fVPA~~a---~i~~  692 (920)
                      -=+|+++..    ..+.+.-|-|||-+||||++|.+.=+.                   -+|+.++|+|-+..   .+++
T Consensus        12 ~L~~isl~v----~~Ge~v~iiGpNGaGKSTLlk~i~Gl~p~~G~I~i~g~~i~~~~~~~~~~~~~~l~q~~~~~~~~~v   87 (245)
T PRK03695         12 RLGPLSGEV----RAGEILHLVGPNGAGKSTLLARMAGLLSGSGEIQFAGQPLEAWSAAELARHRAYLSQQQTPPFAMPV   87 (245)
T ss_pred             CCCCEEEEE----CCCCEEEEECCCCCHHHHHHHHHHCCCCCCCEEEECCEECCCCCHHHHHHCEEEEEECCCCCCCCCH
T ss_conf             050748999----5998999997899419999999846688896599999973538988874306899623564557739


Q ss_pred             CC----------------EEEEEEECCCCC---CCCCCHHHHHHHHHHHHHHH---C--CCCCEEEEECCCCCCCHHHHH
Q ss_conf             21----------------056765237661---13853289999999999995---8--998569993258898805679
Q gi|254780750|r  693 VD----------------KLFSRVGSADNL---ASGRSTFMVEMIETASILNQ---A--TNQSFVILDEIGRGTATLDGL  748 (920)
Q Consensus       693 ~D----------------~IftRiGa~D~l---~~g~STF~vEm~e~~~IL~~---a--t~~SLVllDElGrGTst~DG~  748 (920)
                      ++                .+..++|-.|.+   .+..|.=+.-+...+..|-+   |  .+-.++|+||--.|=++. ..
T Consensus        88 ~~~~~l~~~~~~~~~~~~~~l~~~~l~~~~~~~~~~LSgGq~Qrv~la~all~i~~a~~p~p~illLDEPt~gLD~~-~~  166 (245)
T PRK03695         88 FHYLTLHQPAKTRTGALNDVAGALGLDDKLGRSVNQLSGGEWQRVRLAAVVLQVWPDINPAGQLLLLDEPMNSLDVA-QQ  166 (245)
T ss_pred             HHHHHHCCCCCHHHHHHHHHHHHCCCCHHHCCCHHHCCHHHHHHHHHHHHHHHCCCCCCCCCCEEEECCCCCCCCHH-HH
T ss_conf             99986038621189999999998599415487926689889999999999963272327888789973876678999-99


Q ss_pred             HHHHHHHHHHHHHCCCEEEEECCCHHHH
Q ss_conf             9999999999972698499974875797
Q gi|254780750|r  749 SIAWATIEYLHETNRCRGLLATHFHELT  776 (920)
Q Consensus       749 aiA~aile~l~~~~~~~~lfaTHy~eL~  776 (920)
                      ..-+.+++.+.+. +.-++++||.-+..
T Consensus       167 ~~l~~~i~~l~~~-g~tIi~vtHdl~~~  193 (245)
T PRK03695        167 SALDRLLSELCQQ-GIAVVMSSHDLNHT  193 (245)
T ss_pred             HHHHHHHHHHHHC-CCEEEEEECCHHHH
T ss_conf             9999999999847-99999994268999


No 86 
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA. Members of this protein family are exclusive to the Bacteroidetes phylum (previously Cytophaga-Flavobacteria-Bacteroides). GldA is an ABC transporter ATP-binding protein (pfam00005) linked to a type of rapid surface gliding motility found in certain Bacteroidetes, such as Flavobacterium johnsoniae and Cytophaga hutchinsonii. Knockouts of GldA abolish the gliding phenotype. Gliding motility appears closely linked to chitin utilization in the model species Flavobacterium johnsoniae. Bacteroidetes with members of this protein family appear to have all of the genes associated with gliding motility.
Probab=97.87  E-value=0.00029  Score=50.34  Aligned_cols=138  Identities=19%  Similarity=0.224  Sum_probs=72.3

Q ss_pred             EEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHH--------------------HHHHHCCCCCCHHHC---CC
Q ss_conf             4443456358777766439999677844078999999999--------------------999971985303532---06
Q gi|254780750|r  634 FIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALI--------------------VIMAQMGSYVPASYA---HI  690 (920)
Q Consensus       634 fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~--------------------vilAQiG~fVPA~~a---~i  690 (920)
                      .+=+|+++..    ..+.+.=+-|||-+||||+||.++=.                    .+-.++| |||-...   .+
T Consensus        16 ~al~~vsf~v----~~Gei~gllGpNGAGKTTl~~~l~Gl~~p~~G~i~i~G~~~~~~~~~~~~~ig-~~pq~~~l~~~l   90 (301)
T TIGR03522        16 NALDEVSFEA----QKGRIVGFLGPNGAGKSTTMKIITGYLPPDSGSVQVCGEDVLQNPKEVQRNIG-YLPEHNPLYLDM   90 (301)
T ss_pred             EEECCEEEEE----CCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCEEEECCEECCCCHHHHHHHCE-EECCCCCCCCCC
T ss_conf             9973606788----59819999999998199999999679568977799927513448799985376-745556567888


Q ss_pred             CCCCEE--EE-------------------EEECCC---CCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHH
Q ss_conf             822105--67-------------------652376---611385328999999999999589985699932588988056
Q gi|254780750|r  691 GIVDKL--FS-------------------RVGSAD---NLASGRSTFMVEMIETASILNQATNQSFVILDEIGRGTATLD  746 (920)
Q Consensus       691 ~~~D~I--ft-------------------RiGa~D---~l~~g~STF~vEm~e~~~IL~~at~~SLVllDElGrGTst~D  746 (920)
                      ++.+.+  +.                   ++|-.+   ......|.=|.-....+..  -+..-.++|+||--.|-++.-
T Consensus        91 tv~e~l~~~~~~~g~~~~~~~~~~~~~l~~~~l~~~~~~~~~~LS~G~kqrl~la~a--L~~~P~lliLDEPt~GLDp~~  168 (301)
T TIGR03522        91 YVREYLQFIAGIYGMKGQLLKQRVEEMIELVGLRPEQHKKIGQLSKGYRQRVGLAQA--LIHDPKVLILDEPTTGLDPNQ  168 (301)
T ss_pred             CHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHCCHHHHCCHHHHCCHHHHHHHHHHHH--HCCCCCEEEEECCCCCCCHHH
T ss_conf             999999999997399989999999999988188566548276779988445998898--707998999948866789899


Q ss_pred             HHHHHHHHHHHHHHHCCCEEEEECCCHHHH-HHHHH
Q ss_conf             799999999999972698499974875797-66430
Q gi|254780750|r  747 GLSIAWATIEYLHETNRCRGLLATHFHELT-DLSKS  781 (920)
Q Consensus       747 G~aiA~aile~l~~~~~~~~lfaTHy~eL~-~l~~~  781 (920)
                       ..--|.++..+. + +..++++||+-+-. .+.+.
T Consensus       169 -~~~~~~~l~~l~-~-~~TillssH~l~e~e~lcdr  201 (301)
T TIGR03522       169 -LVEIRNVIKNIG-K-DKTIILSTHIMQEVEAICDR  201 (301)
T ss_pred             -HHHHHHHHHHHC-C-CCEEEEECCCHHHHHHHCCE
T ss_conf             -999999999875-9-99999987858999986999


No 87 
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=97.87  E-value=0.00019  Score=51.63  Aligned_cols=131  Identities=25%  Similarity=0.242  Sum_probs=68.9

Q ss_pred             CCCEEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHH------------------CCCCC
Q ss_conf             770444345635877776643999967784407899999999999997198530353------------------20682
Q gi|254780750|r  631 SKPFIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASY------------------AHIGI  692 (920)
Q Consensus       631 ~~~fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~------------------a~i~~  692 (920)
                      ...++=||+++..    ..+.+.-|.|||-+||||++|.++        |..-|-+-                  -.+++
T Consensus        20 ~~~~~L~~is~~i----~~Ge~vaiiG~sGsGKSTLl~ll~--------Gl~~p~~G~I~~~g~~i~~~~~~~~~~~ig~   87 (269)
T PRK13648         20 DASFTLKDVSFNI----PKGQWTSIVGHNGSGKSTIAKLMI--------GIEKVKSGEIFYNNQAITDDNFEKLRKDIGI   87 (269)
T ss_pred             CCCEEEEEEEEEE----CCCCEEEEECCCCCCHHHHHHHHH--------CCCCCCCEEEEECCEECCCCCHHHHHHHCEE
T ss_conf             9963566458998----599899999999997999999996--------4979985099999999998898999750269


Q ss_pred             C----C-EEEEEEECCCCCCCCCCHHH---HHH-HHHHHHHH----------------------------HCCCCCEEEE
Q ss_conf             2----1-05676523766113853289---999-99999999----------------------------5899856999
Q gi|254780750|r  693 V----D-KLFSRVGSADNLASGRSTFM---VEM-IETASILN----------------------------QATNQSFVIL  735 (920)
Q Consensus       693 ~----D-~IftRiGa~D~l~~g~STF~---vEm-~e~~~IL~----------------------------~at~~SLVll  735 (920)
                      +    + .+|..+ ..+++.-|..-+.   .|+ ..+..+|.                            -+..-.++|+
T Consensus        88 vfQ~p~~~~~~~t-v~~~i~~gl~~~~~~~~e~~~~v~~~L~~~~l~~~~~~~p~~LSGGqkQRvaiAraL~~~P~iLil  166 (269)
T PRK13648         88 VFQNPDNQFVGSI-VKYDVAFGLENHAVPYDEMHRRVSEALKQVDMLERADYEPNALSGGQKQRVAIASVLALNPSVIIL  166 (269)
T ss_pred             EEECHHHHCCCCH-HHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHHCCCCCCCHHHHHHHHHHHHHHHCCCEEEE
T ss_conf             9887132047217-999997336446999999999999999876991344189643899999999999999759899998


Q ss_pred             ECCCCCCCHHHHH--HHHHHHHHHHHHHCCCEEEEECCCHHHHH
Q ss_conf             3258898805679--99999999999726984999748757976
Q gi|254780750|r  736 DEIGRGTATLDGL--SIAWATIEYLHETNRCRGLLATHFHELTD  777 (920)
Q Consensus       736 DElGrGTst~DG~--aiA~aile~l~~~~~~~~lfaTHy~eL~~  777 (920)
                      ||-   ||..|-.  .--+..++.|....+..++++||.-+...
T Consensus       167 DEP---Ts~LD~~~~~~i~~ll~~L~~~~~~TvI~itHdl~~a~  207 (269)
T PRK13648        167 DEA---TSMLDPDARQNLLDLVRKVKSEHNITIISITHDLSEAM  207 (269)
T ss_pred             CCC---CCCCCHHHHHHHHHHHHHHHHCCCCEEEEEEECHHHHH
T ss_conf             187---55489999999999999999737989999976789997


No 88 
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional
Probab=97.87  E-value=0.00026  Score=50.60  Aligned_cols=50  Identities=18%  Similarity=0.212  Sum_probs=33.7

Q ss_pred             CCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHH
Q ss_conf             899856999325889880567999999999999726984999748757976
Q gi|254780750|r  727 ATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFHELTD  777 (920)
Q Consensus       727 at~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~~  777 (920)
                      ++.-.++|+||--+|=+. ...+.-+..++.|.+..++-.||+||+.|...
T Consensus       417 ~~~P~vLiLDEPT~gLD~-~~~~~i~~ll~~l~~~g~~~il~vSHd~e~~~  466 (490)
T PRK10938        417 VKHPTLLILDEPLQGLDP-LNRQLVRRFVDVLISEGETQLLFVSHHAEDAP  466 (490)
T ss_pred             HHCCCEEEEECCCCCCCH-HHHHHHHHHHHHHHHCCCCEEEEECCCHHHHH
T ss_conf             719998999687547699-99999999999999779929999748999999


No 89 
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms]
Probab=97.86  E-value=0.00016  Score=52.19  Aligned_cols=137  Identities=24%  Similarity=0.342  Sum_probs=73.5

Q ss_pred             CEEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHH--------------------HHHCCCCCCHHHC---C
Q ss_conf             0444345635877776643999967784407899999999999--------------------9971985303532---0
Q gi|254780750|r  633 PFIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVI--------------------MAQMGSYVPASYA---H  689 (920)
Q Consensus       633 ~fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vi--------------------lAQiG~fVPA~~a---~  689 (920)
                      ..+=||+++..    ..+.+.-+-|||-+||||+||.++=++-                    ..++| |||-+-.   .
T Consensus        18 ~~~l~~vs~~i----~~Gei~gllG~NGAGKTTllk~l~Gl~~p~~G~i~i~G~~~~~~~~~~~~~ig-y~~~~~~~~~~   92 (293)
T COG1131          18 KTALDGVSFEV----EPGEIFGLLGPNGAGKTTLLKILAGLLKPTSGEILVLGYDVVKEPAKVRRRIG-YVPQEPSLYPE   92 (293)
T ss_pred             CEEEEEEEEEE----ECCEEEEEECCCCCCHHHHHHHHHCCCCCCCEEEEECCCCCCCCHHHHHCEEE-EEECCCCCCCC
T ss_conf             78886049998----28959999899999899999999679778864999958627512676505299-99478777714


Q ss_pred             CC---------------------CCCEEEEEEECCC---CCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHH
Q ss_conf             68---------------------2210567652376---61138532899999999999958998569993258898805
Q gi|254780750|r  690 IG---------------------IVDKLFSRVGSAD---NLASGRSTFMVEMIETASILNQATNQSFVILDEIGRGTATL  745 (920)
Q Consensus       690 i~---------------------~~D~IftRiGa~D---~l~~g~STF~vEm~e~~~IL~~at~~SLVllDElGrGTst~  745 (920)
                      ++                     .++++..++|-.+   ...++.|.=|---.-.+  +--+..-+|+|+||--.|=++.
T Consensus        93 lTv~e~l~~~~~l~~~~~~~~~~~~~~~l~~~~L~~~~~~~~~~lS~G~kqrl~ia--~aL~~~P~lliLDEPt~GLDp~  170 (293)
T COG1131          93 LTVRENLEFFARLYGLSKEEAEERIEELLELFGLEDKANKKVRTLSGGMKQRLSIA--LALLHDPELLILDEPTSGLDPE  170 (293)
T ss_pred             CCHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCCHHCCCHHHCCHHHHHHHHHH--HHHHCCCCEEEEECCCCCCCHH
T ss_conf             75999999999984997166799999999986996032881023798899999999--9996699999996997787999


Q ss_pred             HHHHHHHHHHHHHHHHCCCEEEEECCCHHHHH
Q ss_conf             67999999999999726984999748757976
Q gi|254780750|r  746 DGLSIAWATIEYLHETNRCRGLLATHFHELTD  777 (920)
Q Consensus       746 DG~aiA~aile~l~~~~~~~~lfaTHy~eL~~  777 (920)
                      - ...-|.++..+.+..+...+++||+.+-.+
T Consensus       171 ~-~~~~~~~l~~l~~~g~~tvlissH~l~e~~  201 (293)
T COG1131         171 S-RREIWELLRELAKEGGVTILLSTHILEEAE  201 (293)
T ss_pred             H-HHHHHHHHHHHHHCCCCEEEEECCCHHHHH
T ss_conf             9-999999999999679959999838869999


No 90 
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional
Probab=97.86  E-value=0.00059  Score=47.97  Aligned_cols=140  Identities=26%  Similarity=0.356  Sum_probs=72.0

Q ss_pred             EEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHH----HC-CCC---CCHHHCCCCCC---CEEEEEEEC
Q ss_conf             44434563587777664399996778440789999999999999----71-985---30353206822---105676523
Q gi|254780750|r  634 FIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMA----QM-GSY---VPASYAHIGIV---DKLFSRVGS  702 (920)
Q Consensus       634 fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilA----Qi-G~f---VPA~~a~i~~~---D~IftRiGa  702 (920)
                      -+=+|++|..    ..+.+..|-|||-+||||+||.++=+.--.    .+ |-.   +|...-.++.+   ..+|-.+-.
T Consensus        17 ~al~~vsl~i----~~Ge~~~llGpsG~GKSTllr~i~Gl~~p~~G~I~i~g~~v~~~~~~~r~ig~vfQ~~~L~p~ltV   92 (369)
T PRK11000         17 VISKDINLDI----HEGEFVVFVGPSGCGKSTLLRMIAGLEDITSGDLFIGEKRMNDVPPAERGVGMVFQSYALYPHLSV   92 (369)
T ss_pred             EEECCCEEEE----CCCCEEEEECCCCCHHHHHHHHHHCCCCCCCEEEEECCEECCCCCHHHCCEEEEECCCCCCCCCCH
T ss_conf             9986438898----799899999999736999999997799999549999999998799778786999407854789899


Q ss_pred             CCCCCCCC-----CH--------HHHHHHHHHHHHH-------------------HCCCCCEEEEECCCCCCCHHHHH--
Q ss_conf             76611385-----32--------8999999999999-------------------58998569993258898805679--
Q gi|254780750|r  703 ADNLASGR-----ST--------FMVEMIETASILN-------------------QATNQSFVILDEIGRGTATLDGL--  748 (920)
Q Consensus       703 ~D~l~~g~-----ST--------F~vEm~e~~~IL~-------------------~at~~SLVllDElGrGTst~DG~--  748 (920)
                      .|||.-|.     +.        =+.|+.++..+++                   -+.+-.++|+||-   ||..|-.  
T Consensus        93 ~eNi~~~l~~~~~~~~e~~~rv~~~l~~~~l~~~~~r~p~~LSGGq~QRvaiARAL~~~P~illlDEP---~s~LD~~~r  169 (369)
T PRK11000         93 AENMSFGLKLAGAKKEEINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEP---LSNLDAALR  169 (369)
T ss_pred             HHHHHHHHHHCCCCHHHHHHHHHHHHHHHCCHHHHHCCHHHCCHHHHHHHHHHHHHHCCCCEEEECCC---CCCCCHHHE
T ss_conf             99997788763898899999999999863745355588746694277999999886259985884366---678886665


Q ss_pred             HHHHHHHHHHHHHCCCEEEEECCCHHHH-HHHH
Q ss_conf             9999999999972698499974875797-6643
Q gi|254780750|r  749 SIAWATIEYLHETNRCRGLLATHFHELT-DLSK  780 (920)
Q Consensus       749 aiA~aile~l~~~~~~~~lfaTHy~eL~-~l~~  780 (920)
                      .--+..+..|++..+..++|+||..+-+ .+++
T Consensus       170 ~~~~~~l~~l~~~~g~T~i~vTHD~~eA~~laD  202 (369)
T PRK11000        170 VQMRIEISRLHKRLGRTMIYVTHDQVEAMTLAD  202 (369)
T ss_pred             EHHHHHHHHHHHHHCCEEEEEECCHHHHHHHCC
T ss_conf             247899999999869859999089999998599


No 91 
>PRK10895 putative ABC transporter ATP-binding protein YhbG; Provisional
Probab=97.85  E-value=0.00072  Score=47.34  Aligned_cols=139  Identities=27%  Similarity=0.341  Sum_probs=72.2

Q ss_pred             EEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHH--------------------HHHCC-CCCCHHHC---C
Q ss_conf             444345635877776643999967784407899999999999--------------------99719-85303532---0
Q gi|254780750|r  634 FIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVI--------------------MAQMG-SYVPASYA---H  689 (920)
Q Consensus       634 fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vi--------------------lAQiG-~fVPA~~a---~  689 (920)
                      -|=+|+++..    ..+.+.-|-|||-+||||+||.++=+.-                    .++-| .|||-+..   .
T Consensus        17 ~~l~~vsl~i----~~Gei~~liGpNGaGKSTLl~~i~Gl~~~~~G~I~i~g~~i~~~~~~~~~~~~ig~v~Q~~~l~~~   92 (241)
T PRK10895         17 RVVEDVSLTV----NSGEIVGLLGPNGAGKTTTFYMVVGIVPRDAGNIIIDDEDISLLPLHARARRGIGYLPQEASIFRR   92 (241)
T ss_pred             EEEEEEEEEE----CCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCEEEECCEECCCCCHHHHHHCCEEEECCCCCCCCC
T ss_conf             9995207898----399799998899986999999996788888762776345234489889985776996243545778


Q ss_pred             CCCCCEEEEEEECC-------------------------CCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCH
Q ss_conf             68221056765237-------------------------66113853289999999999995899856999325889880
Q gi|254780750|r  690 IGIVDKLFSRVGSA-------------------------DNLASGRSTFMVEMIETASILNQATNQSFVILDEIGRGTAT  744 (920)
Q Consensus       690 i~~~D~IftRiGa~-------------------------D~l~~g~STF~vEm~e~~~IL~~at~~SLVllDElGrGTst  744 (920)
                      ++++|.++......                         |......|-=+--....|..|  +..-.++|+||--.|=++
T Consensus        93 ltv~enl~~~~~~~~~~~~~~~~~~~~~~l~~~~l~~~~~~~~~~LSgG~kqrv~iAraL--~~~P~illLDEPt~gLD~  170 (241)
T PRK10895         93 LSVYDNLMAVLQIRDDLSAEQREDRANELMEEFHIEHLRDSMGQSLSGGERRRVEIARAL--AANPKFILLDEPFAGVDP  170 (241)
T ss_pred             CCHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHCCCHHHCCHHHHHHHHHHHHH--HCCCCEEEEECCCCCCCH
T ss_conf             889999999999844899899999999999977991464110666898889999999999--669988999587547999


Q ss_pred             HHHHHHHHHHHHHHHHHCCCEEEEECCCHHHH-HHHH
Q ss_conf             56799999999999972698499974875797-6643
Q gi|254780750|r  745 LDGLSIAWATIEYLHETNRCRGLLATHFHELT-DLSK  780 (920)
Q Consensus       745 ~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~-~l~~  780 (920)
                      .--.. -|.+++.+.+. +.-++++||.-+.. .+.+
T Consensus       171 ~~~~~-i~~~l~~l~~~-g~tvl~~tHdl~~~~~~~d  205 (241)
T PRK10895        171 ISVID-IKRIIEHLRDS-GLGVLITDHNVRETLAVCE  205 (241)
T ss_pred             HHHHH-HHHHHHHHHHC-CCEEEEECCCHHHHHHHCC
T ss_conf             99999-99999999964-9999999072999999799


No 92 
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=97.84  E-value=0.00063  Score=47.76  Aligned_cols=171  Identities=22%  Similarity=0.252  Sum_probs=87.5

Q ss_pred             EEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHH----------------------CCCCC
Q ss_conf             44345635877776643999967784407899999999999997198530353----------------------20682
Q gi|254780750|r  635 IANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASY----------------------AHIGI  692 (920)
Q Consensus       635 VpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~----------------------a~i~~  692 (920)
                      +=+||++..    ..+.+..|.|||-+||||++|.++        |.+.|-+-                      -.+|.
T Consensus        22 aL~~Vsl~i----~~Ge~~aiiG~nGsGKSTLl~~l~--------Gl~~p~~G~i~~~g~~i~~~~~~~~~~~~~~~iG~   89 (280)
T PRK13649         22 ALFDVNLDI----LDGSYTAFIGHTGSGKSTIMQLLN--------GLHVPTTGIVSVDDTDITSHSKNKEIKSIRKKVGL   89 (280)
T ss_pred             EEEEEEEEE----CCCCEEEEECCCCCHHHHHHHHHH--------CCCCCCCEEEEECCEECCCCCCHHHHHHHHHHEEE
T ss_conf             541026898----799899999599986999999996--------69998860899999998777820139999876469


Q ss_pred             C-----CEEEEEEECCCCCCCCCCHHH---HHHHHH-HHHHH-----------------------------HCCCCCEEE
Q ss_conf             2-----105676523766113853289---999999-99999-----------------------------589985699
Q gi|254780750|r  693 V-----DKLFSRVGSADNLASGRSTFM---VEMIET-ASILN-----------------------------QATNQSFVI  734 (920)
Q Consensus       693 ~-----D~IftRiGa~D~l~~g~STF~---vEm~e~-~~IL~-----------------------------~at~~SLVl  734 (920)
                      +     .++|.. -..|++.-|..-|-   -|+.+. ...|.                             -|..-.++|
T Consensus        90 vfQ~p~~ql~~~-tV~eev~fg~~~~g~~~~e~~~~v~~~l~~~gL~e~~~~r~p~~LSGGqkqRvaiA~aL~~~P~iLl  168 (280)
T PRK13649         90 VFQFPESQLFEE-TVLKDVAFGPQNFGVSPEEAEALAREKLALVGISENLFEKNPFELSGGQMRRVAIAGILAMEPKILV  168 (280)
T ss_pred             EEECCCCCCCCC-HHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCHHHHHCCCCCCCHHHHHHHHHHHHHHCCCCEEE
T ss_conf             974652123603-0999998689886999999999999999876997466542900099999999999999974999999


Q ss_pred             EECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHH-HHHHHCCCEEEEEEEEEEECCEEEEEEEEEECCCCCC
Q ss_conf             932588988056799999999999972698499974875797-6643068858999999960992778777744789887
Q gi|254780750|r  735 LDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFHELT-DLSKSLKRFHNATLQVSDSNEGIIFLHKVIPGIADHS  813 (920)
Q Consensus       735 lDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~-~l~~~~~~v~n~~~~~~~~~~~i~flykl~~G~~~~S  813 (920)
                      +||--.|=++. +..--+.++..|.+. ++.++++||.-+.. .+++.   +..  |    .+++|     +..|....=
T Consensus       169 lDEPTsgLDp~-~~~~i~~ll~~l~~~-G~Tii~vTHdl~~v~~~aDr---v~v--l----~~G~i-----v~~G~p~ev  232 (280)
T PRK13649        169 LDEPTAGLDPK-GRKELMTIFKKLHQS-GMTIVLVTHLMDDVANYADF---VYV--L----EKGKI-----VLSGKPKDI  232 (280)
T ss_pred             EECCCCCCCHH-HHHHHHHHHHHHHHC-CCEEEEECCCHHHHHHHCCE---EEE--E----ECCEE-----EEECCHHHH
T ss_conf             84875548999-999999999999863-99999987589999997999---999--9----89999-----998789999


Q ss_pred             HH-HHHHHHCCC-CHHHHHHHHH
Q ss_conf             78-999998299-9899999999
Q gi|254780750|r  814 YG-IQVGKLAGL-PNTVISRAYD  834 (920)
Q Consensus       814 yg-i~vA~laG~-p~~vi~~A~~  834 (920)
                      |. .+.-+.+|+ |+.+++-|.+
T Consensus       233 f~~~~~l~~~~l~~P~~~~~~~~  255 (280)
T PRK13649        233 FQQVSFLEKKQLGVPKITKFAQR  255 (280)
T ss_pred             HCCHHHHHHCCCCCCHHHHHHHH
T ss_conf             75989998779999919999999


No 93 
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane.  The FtsE/X transporter is thought to be involved in cell division and is important for assembly or stability of the septal ring.
Probab=97.84  E-value=0.00038  Score=49.45  Aligned_cols=131  Identities=21%  Similarity=0.277  Sum_probs=69.8

Q ss_pred             EEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHCCCCCCCEEEE------------EEEC
Q ss_conf             4434563587777664399996778440789999999999999719853035320682210567------------6523
Q gi|254780750|r  635 IANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHIGIVDKLFS------------RVGS  702 (920)
Q Consensus       635 VpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a~i~~~D~Ift------------RiGa  702 (920)
                      +=+|+++..    ..+.+..|.|||-+||||+||.++-        ..-| ++-++-+.+.-.+            .||-
T Consensus        16 aL~~vsl~i----~~Ge~v~i~GpSGsGKSTLl~~i~g--------l~~p-~sG~i~i~g~~~~~~~~~~~~~~Rr~iG~   82 (214)
T cd03292          16 ALDGINISI----SAGEFVFLVGPSGAGKSTLLKLIYK--------EELP-TSGTIRVNGQDVSDLRGRAIPYLRRKIGV   82 (214)
T ss_pred             EEEEEEEEE----CCCCEEEEECCCCCHHHHHHHHHHC--------CCCC-CCEEEEECCEECCCCCHHHHHHHHCCEEE
T ss_conf             982217798----5998999997999539999999962--------9898-86499999999898997789998667499


Q ss_pred             --C-CCCCCCCCHHH-------------HHHHH-HHHHH---------------------------H-HCCCCCEEEEEC
Q ss_conf             --7-66113853289-------------99999-99999---------------------------9-589985699932
Q gi|254780750|r  703 --A-DNLASGRSTFM-------------VEMIE-TASIL---------------------------N-QATNQSFVILDE  737 (920)
Q Consensus       703 --~-D~l~~g~STF~-------------vEm~e-~~~IL---------------------------~-~at~~SLVllDE  737 (920)
                        + .++....|-+-             -|..+ +..+|                           + -+..-.++|+||
T Consensus        83 VfQ~~~L~~~ltV~eNv~~~l~~~~~~~~~~~~rv~~~L~~vgL~~~~~~~p~~LSGGqkQRvaIARALv~~P~ill~DE  162 (214)
T cd03292          83 VFQDFRLLPDRNVYENVAFALEVTGVPPREIRKRVPAALELVGLSHKHRALPAELSGGEQQRVAIARAIVNSPTILIADE  162 (214)
T ss_pred             EEECCCCCCCCCHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHCCCHHHCCHHHHHHHHHHHHHHCCCCEEEECC
T ss_conf             90187647999799999999998499999999999999987799657549942488899999999999972999999839


Q ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHH-HHH
Q ss_conf             5889880567999999999999726984999748757976-643
Q gi|254780750|r  738 IGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFHELTD-LSK  780 (920)
Q Consensus       738 lGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~~-l~~  780 (920)
                      ---+=++.-.. .-+..++.+.+. +...+++||..++.. +++
T Consensus       163 PT~~LD~~~~~-~i~~ll~~l~~~-g~Tii~vTHd~~~~~~~~d  204 (214)
T cd03292         163 PTGNLDPDTTW-EIMNLLKKINKA-GTTVVVATHAKELVDTTRH  204 (214)
T ss_pred             CCCCCCHHHHH-HHHHHHHHHHHC-CCEEEEECCCHHHHHHHCC
T ss_conf             87877989999-999999999850-9999998989899998689


No 94 
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export.  They belong to the subfamily C of the ATP-binding cassette (ABC) superfamily of transport proteins.  The ABCC subfamily contains transporters with a diverse functional spectrum that includes ion transport, cell surface receptor, and toxin secretion activities.  The MRP-like family, simlar to all ABC proteins, have a common four-domain core structure constituted by two membrane-spanning domains, each composed of six transmembrane (TM) helices, and two nucleotide-binding domains (NBD).  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=97.83  E-value=0.00021  Score=51.33  Aligned_cols=123  Identities=27%  Similarity=0.327  Sum_probs=66.7

Q ss_pred             EEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHCCC-------------------CCCC
Q ss_conf             444345635877776643999967784407899999999999997198530353206-------------------8221
Q gi|254780750|r  634 FIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHI-------------------GIVD  694 (920)
Q Consensus       634 fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a~i-------------------~~~D  694 (920)
                      +|=+|++|..    ..+.+.-|.|||-+||||++|.++        |.+-|.+ -++                   +.+.
T Consensus        16 ~iL~~isl~i----~~Ge~i~ivG~sGsGKSTLl~ll~--------gl~~p~~-G~I~i~g~~i~~~~~~~~~~~i~~v~   82 (171)
T cd03228          16 PVLKDVSLTI----KPGEKVAIVGPSGSGKSTLLKLLL--------RLYDPTS-GEILIDGVDLRDLDLESLRKNIAYVP   82 (171)
T ss_pred             CCEECEEEEE----CCCCEEEEECCCCCHHHHHHHHHH--------CCCCCCC-CEEEECCEECCCCCHHHHHHHEEEEC
T ss_conf             6167718998----599899999999983999999997--------6775897-48999999988599899863189996


Q ss_pred             ---EEEEEEECCCCC-CCCCCHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHH-CCCEEEEE
Q ss_conf             ---056765237661-1385328999999999999589985699932588988056799999999999972-69849997
Q gi|254780750|r  695 ---KLFSRVGSADNL-ASGRSTFMVEMIETASILNQATNQSFVILDEIGRGTATLDGLSIAWATIEYLHET-NRCRGLLA  769 (920)
Q Consensus       695 ---~IftRiGa~D~l-~~g~STF~vEm~e~~~IL~~at~~SLVllDElGrGTst~DG~aiA~aile~l~~~-~~~~~lfa  769 (920)
                         .+|.. --.||| +.|+    .-..-.|..|  +.+..++|+||-   ||..|..+ ...+.+.|.+. .++.++++
T Consensus        83 Q~~~lf~~-tv~eNiLSgGq----~Qri~lARal--~~~p~illlDEp---ts~LD~~~-~~~i~~~l~~~~~~~Tvi~v  151 (171)
T cd03228          83 QDPFLFSG-TIRENILSGGQ----RQRIAIARAL--LRDPPILILDEA---TSALDPET-EALILEALRALAKGKTVIVI  151 (171)
T ss_pred             CCCCCCCC-CHHHHCCCHHH----HHHHHHHHHH--HHCCCEEEEECC---CCCCCHHH-HHHHHHHHHHHCCCCEEEEE
T ss_conf             66843757-79997744889----9999999999--748998999577---66799899-99999999998099989999


Q ss_pred             CCCHHHHHHHH
Q ss_conf             48757976643
Q gi|254780750|r  770 THFHELTDLSK  780 (920)
Q Consensus       770 THy~eL~~l~~  780 (920)
                      ||-.++...++
T Consensus       152 tH~~~~~~~~D  162 (171)
T cd03228         152 AHRLSTIRDAD  162 (171)
T ss_pred             ECCHHHHHHCC
T ss_conf             57999997099


No 95 
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor.  The ABC ATPase, RNase L inhibitor (RLI), is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids.  RLI's are not transport proteins and thus cluster with a group of soluble proteins that lack the transmembrane components commonly found in other members of the family.  Structurally, RLI's have an N-terminal Fe-S domain and two nucleotide-binding domains which are arranged to form two composite active sites in their interface cleft.  RLI is one of the most conserved enzymes between archaea and eukaryotes with a sequence identity of more than 48%.  The high degree of evolutionary conservation suggests that RLI performs a central role in archaeal and eukaryotic physiology.
Probab=97.83  E-value=0.00017  Score=52.01  Aligned_cols=138  Identities=21%  Similarity=0.169  Sum_probs=67.8

Q ss_pred             EEEEEEECCCCC-CCCCEEEEEECCCCCCHHHHHHHHHHHH--------HHHHCCCCCCHHH---CCCCCCCEEEEEEEC
Q ss_conf             443456358777-7664399996778440789999999999--------9997198530353---206822105676523
Q gi|254780750|r  635 IANDCDLSCPND-KNSGKLWLLTGPNMGGKSTFLRQNALIV--------IMAQMGSYVPASY---AHIGIVDKLFSRVGS  702 (920)
Q Consensus       635 VpNdi~l~~~~~-~~~~~~~iiTGpNmgGKSt~lRqval~v--------ilAQiG~fVPA~~---a~i~~~D~IftRiGa  702 (920)
                      +=+|++|..... -..+.+.-|.|||-+||||+||.++=+.        +--+-=+|+|-.-   ..+.+.+-++...  
T Consensus         9 ~l~~~sL~i~~Gti~~GEiv~liGpNGaGKSTLlk~l~Gll~p~~G~I~~~g~~i~~~pq~~~~~~~~tv~~~l~~~~--   86 (246)
T cd03237           9 TLGEFTLEVEGGSISESEVIGILGPNGIGKTTFIKMLAGVLKPDEGDIEIELDTVSYKPQYIKADYEGTVRDLLSSIT--   86 (246)
T ss_pred             ECCEEEEEECCCCCCCCCEEEEECCCCCHHHHHHHHHHCCCCCCCCEEEECCCCCCCCCHHHCCCCCCCHHHHHHHHH--
T ss_conf             615068985688465798999997999769999999977878886079989820576874332577727999999886--


Q ss_pred             CCCCCCCCCHHHHHHHH----------------------HHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             76611385328999999----------------------99999958998569993258898805679999999999997
Q gi|254780750|r  703 ADNLASGRSTFMVEMIE----------------------TASILNQATNQSFVILDEIGRGTATLDGLSIAWATIEYLHE  760 (920)
Q Consensus       703 ~D~l~~g~STF~vEm~e----------------------~~~IL~~at~~SLVllDElGrGTst~DG~aiA~aile~l~~  760 (920)
                        +.....+.|..|+.+                      ++-..--+.+-.++|+||--.|=++.--.. -+.++..|.+
T Consensus        87 --~~~~~~~~~~~e~~~~l~l~~~~~r~~~~LSGGqkQRv~iA~aL~~~p~ilLLDEPts~LD~~~~~~-i~~~i~~l~~  163 (246)
T cd03237          87 --KDFYTHPYFKTEIAKPLQIEQILDREVPELSGGELQRVAIAACLSKDADIYLLDEPSAYLDVEQRLM-ASKVIRRFAE  163 (246)
T ss_pred             --HHCCCCHHHHHHHHHHCCCHHHHCCCHHHCCHHHHHHHHHHHHHHCCCCEEEECCCCCCCCHHHHHH-HHHHHHHHHH
T ss_conf             --4312127999999988499567648700289859999999999841999999848987689999999-9999999998


Q ss_pred             HCCCEEEEECCCHHHHH
Q ss_conf             26984999748757976
Q gi|254780750|r  761 TNRCRGLLATHFHELTD  777 (920)
Q Consensus       761 ~~~~~~lfaTHy~eL~~  777 (920)
                      ..+..++++||.-++..
T Consensus       164 ~~~~Tvi~VtHDl~~a~  180 (246)
T cd03237         164 NNEKTAFVVEHDIIMID  180 (246)
T ss_pred             HCCCEEEEECCCHHHHH
T ss_conf             67989999837899999


No 96 
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism]
Probab=97.83  E-value=4.5e-05  Score=56.34  Aligned_cols=133  Identities=26%  Similarity=0.358  Sum_probs=71.1

Q ss_pred             EEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHH--------HHH----------HCCCCCCHHH---CCCC--
Q ss_conf             4434563587777664399996778440789999999999--------999----------7198530353---2068--
Q gi|254780750|r  635 IANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIV--------IMA----------QMGSYVPASY---AHIG--  691 (920)
Q Consensus       635 VpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~v--------ilA----------QiG~fVPA~~---a~i~--  691 (920)
                      |=.||++..    ..+.+.-|.|||-+||||++|.+.=+.        +..          -| .|||=..   ..+|  
T Consensus        19 vl~~i~l~v----~~G~~~~iiGPNGaGKSTLlK~iLGll~p~~G~i~~~g~~~~~~~~~~~I-gYVPQ~~~~d~~fP~t   93 (254)
T COG1121          19 VLEDISLSV----EKGEITALIGPNGAGKSTLLKAILGLLKPSSGEIKIFGKPVRKRRKRLRI-GYVPQKSSVDRSFPIT   93 (254)
T ss_pred             EEECCEEEE----CCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCEE-EECCCCCCCCCCCCCC
T ss_conf             041538997----48968999999888889999999678767742699836663334667769-9757610267679967


Q ss_pred             CCC----------EEEEEEECCCCCCCCCCHHHHHHHHHH-------------HH-HH--HCCCCCEEEEECCCCCCCHH
Q ss_conf             221----------056765237661138532899999999-------------99-99--58998569993258898805
Q gi|254780750|r  692 IVD----------KLFSRVGSADNLASGRSTFMVEMIETA-------------SI-LN--QATNQSFVILDEIGRGTATL  745 (920)
Q Consensus       692 ~~D----------~IftRiGa~D~l~~g~STF~vEm~e~~-------------~I-L~--~at~~SLVllDElGrGTst~  745 (920)
                      +.|          ..|-|.++.|.-.-..+==.|+|.+.+             .+ |-  -|++--|.+|||---|-+..
T Consensus        94 V~d~V~~g~~~~~g~~~~~~~~d~~~v~~aL~~Vgm~~~~~r~i~~LSGGQ~QRV~lARAL~~~p~lllLDEP~~gvD~~  173 (254)
T COG1121          94 VKDVVLLGRYGKKGWFRRLNKKDKEKVDEALERVGMEDLRDRQIGELSGGQKQRVLLARALAQNPDLLLLDEPFTGVDVA  173 (254)
T ss_pred             HHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCHHHHCCCCCCCCCHHHHHHHHHHHHCCCCCEEEECCCCCCCCHH
T ss_conf             99998606754466013666777999999999839266647955546727999999999853699989966875457987


Q ss_pred             HHHHHHHHHHHHHHHHCCCEEEEECCCHH
Q ss_conf             67999999999999726984999748757
Q gi|254780750|r  746 DGLSIAWATIEYLHETNRCRGLLATHFHE  774 (920)
Q Consensus       746 DG~aiA~aile~l~~~~~~~~lfaTHy~e  774 (920)
                       |...-+.++..|.+. +|..|..||...
T Consensus       174 -~~~~i~~lL~~l~~e-g~tIl~vtHDL~  200 (254)
T COG1121         174 -GQKEIYDLLKELRQE-GKTVLMVTHDLG  200 (254)
T ss_pred             -HHHHHHHHHHHHHHC-CCEEEEEECCCH
T ss_conf             -899999999999878-988999958817


No 97 
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family. Type I protein secretion is a system in some Gram-negative bacteria to export proteins (often proteases) across both inner and outer membranes to the extracellular medium. This is one of three proteins of the type I secretion apparatus. Targeted proteins are not cleaved at the N-terminus, but rather carry signals located toward the extreme C-terminus to direct type I secretion. This model is related to models TIGR01842 and TIGR01846, and to bacteriocin ABC transporters that cleave their substrates during export.
Probab=97.81  E-value=0.00052  Score=48.39  Aligned_cols=131  Identities=27%  Similarity=0.321  Sum_probs=72.6

Q ss_pred             EEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHC------------------CCCCCC-
Q ss_conf             4443456358777766439999677844078999999999999971985303532------------------068221-
Q gi|254780750|r  634 FIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYA------------------HIGIVD-  694 (920)
Q Consensus       634 fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a------------------~i~~~D-  694 (920)
                      .|=+|+++..    ..+...-|+||+-+||||++|-+        .|.|-|.+-.                  .++.+. 
T Consensus       479 ~vl~~vsl~i----~~Ge~vaIvG~sGsGKSTL~kll--------~Gl~~p~~G~i~idg~~~~~~~~~~~r~~i~~v~Q  546 (694)
T TIGR03375       479 PALDNVSLTI----RPGEKVAIIGRIGSGKSTLLKLL--------LGLYQPTEGSVLLDGVDIRQIDPADLRRNIGYVPQ  546 (694)
T ss_pred             HHHCCHHHEE----CCCCEEEEEECCCCCHHHHHHHH--------CCCCCCCCCEEEECCEECCCCCHHHHHHHCEEECC
T ss_conf             2213631188----79978999805898788999985--------56758998879989854254999999730213576


Q ss_pred             --EEEEEEECCCCCCCCCCHH-HHHHHHHHHHH----------------------------------HH--CCCCCEEEE
Q ss_conf             --0567652376611385328-99999999999----------------------------------95--899856999
Q gi|254780750|r  695 --KLFSRVGSADNLASGRSTF-MVEMIETASIL----------------------------------NQ--ATNQSFVIL  735 (920)
Q Consensus       695 --~IftRiGa~D~l~~g~STF-~vEm~e~~~IL----------------------------------~~--at~~SLVll  735 (920)
                        .+|.. -=.|||.-+.... ..+|.+++.+.                                  -.  ..+-+++|+
T Consensus       547 ~~~lf~g-Ti~eNi~~~~~~~~~~~i~~a~~~a~l~~~I~~lp~g~~t~i~e~G~~LSgGqrQri~lARAl~~~p~ilil  625 (694)
T TIGR03375       547 DPRLFYG-TLRDNIALGAPYADDEEILRAAELAGVTEFVRRHPDGLDMQIGERGRSLSGGQRQAVALARALLRDPPILLL  625 (694)
T ss_pred             CCCCCCC-CHHHHHHCCCCCCCHHHHHHHHHHHCCHHHHHHCCCCCCCEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEE
T ss_conf             7711074-699998416999999999999998197999971856678774689994689999999999999579998999


Q ss_pred             ECCCCCCCHHHHHHHHHHHHHHHHHH-CCCEEEEECCCHHHHHHHHH
Q ss_conf             32588988056799999999999972-69849997487579766430
Q gi|254780750|r  736 DEIGRGTATLDGLSIAWATIEYLHET-NRCRGLLATHFHELTDLSKS  781 (920)
Q Consensus       736 DElGrGTst~DG~aiA~aile~l~~~-~~~~~lfaTHy~eL~~l~~~  781 (920)
                      ||-   ||.-|-.. ...+.+.|.+. .++.+++.||-.+....++.
T Consensus       626 DE~---ts~LD~~~-e~~i~~~l~~~~~~~T~i~itHrls~i~~aD~  668 (694)
T TIGR03375       626 DEP---TSAMDNRS-EERFKDRLKRWLAGKTLVLVTHRTSLLDLVDR  668 (694)
T ss_pred             ECC---CCCCCHHH-HHHHHHHHHHHCCCCEEEEEECCHHHHHHCCE
T ss_conf             787---56889999-99999999986699989998168999984999


No 98 
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional
Probab=97.81  E-value=0.00024  Score=50.91  Aligned_cols=136  Identities=20%  Similarity=0.239  Sum_probs=71.8

Q ss_pred             EEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHH-HH-------------------HHHHCCCCCCHHHC---CCC
Q ss_conf             44345635877776643999967784407899999999-99-------------------99971985303532---068
Q gi|254780750|r  635 IANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNAL-IV-------------------IMAQMGSYVPASYA---HIG  691 (920)
Q Consensus       635 VpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval-~v-------------------ilAQiG~fVPA~~a---~i~  691 (920)
                      |=+|+++..    ..+.+.-|-|||-+||||++|.++= ..                   -+|+...|||-...   .++
T Consensus        17 ~L~~vsl~i----~~Gei~~liGpNGaGKSTLlk~i~Gl~~p~~G~I~~~g~~i~~~~~~~~~~~~g~v~Q~~~l~~~~t   92 (257)
T PRK13548         17 VLDDVSLTL----RPGEVVAILGPNGAGKSTLLRALSGELPPSSGEVRLFGRPLADWSPAELARRRAVLPQHSSLSFPFT   92 (257)
T ss_pred             EECCEEEEE----CCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCEEEEECEECCCCCHHHHHHHEEEECCCCCCCCCCC
T ss_conf             880337898----6998999999999879999999856757787569993657675899999754658612366789983


Q ss_pred             CCCEE---------------------EEEEECCC---CCCCCCCHHHHHHHHHHHHHHH----CCCCCEEEEECCCCCCC
Q ss_conf             22105---------------------67652376---6113853289999999999995----89985699932588988
Q gi|254780750|r  692 IVDKL---------------------FSRVGSAD---NLASGRSTFMVEMIETASILNQ----ATNQSFVILDEIGRGTA  743 (920)
Q Consensus       692 ~~D~I---------------------ftRiGa~D---~l~~g~STF~vEm~e~~~IL~~----at~~SLVllDElGrGTs  743 (920)
                      +.+.|                     ..++|-.+   .-....|-=+--....|..|-+    +..-.++|+||--.|=+
T Consensus        93 v~e~v~~g~~~~~~~~~~~~~~~~~~l~~~~l~~~~~~~~~~LSGGq~QRv~iAraL~q~~~~~~~P~lLlLDEPtsgLD  172 (257)
T PRK13548         93 VEEVVAMGRYPHTLSQKEDDQLVAAALAQVDLAHLAGRSYPTLSGGEQQRVQLARVLAQLWEPGGGPRWLLLDEPTSALD  172 (257)
T ss_pred             HHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCHHHCCCHHHCCHHHHHHHHHHHHHHHCCCCCCCCCEEEECCCCCCCC
T ss_conf             99999977876589989999999999987699024169816699999999999999962001047998899889876689


Q ss_pred             HHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHH
Q ss_conf             056799999999999972698499974875797
Q gi|254780750|r  744 TLDGLSIAWATIEYLHETNRCRGLLATHFHELT  776 (920)
Q Consensus       744 t~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~  776 (920)
                      +..-..+ +.++..|.+. +.-++++||.-+..
T Consensus       173 ~~~~~~i-~~ll~~l~~~-g~tvl~vtHdl~~~  203 (257)
T PRK13548        173 LAHQHHV-LRLARQLAER-GAAVIVVLHDLNLA  203 (257)
T ss_pred             HHHHHHH-HHHHHHHHHC-CCEEEEEECCHHHH
T ss_conf             9999999-9999999855-99999992788999


No 99 
>cd03239 ABC_SMC_head The structural maintenance of chromosomes (SMC) proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms.  SMCs are generally present as single proteins in bacteria, and as at least six distinct proteins in eukaryotes.  The proteins range in size from approximately 110 to 170 kDa, and each has five distinct domains: amino- and carboxy-terminal globular domains, which contain sequences characteristic of ATPases, two coiled-coil regions separating the terminal domains , and a central flexible hinge.  SMC proteins function together with other proteins in a range of chromosomal transactions, including chromosome condensation, sister-chromatid cohesion, recombination, DNA repair, and epigenetic silencing of gene expression.
Probab=97.81  E-value=0.00019  Score=51.66  Aligned_cols=129  Identities=22%  Similarity=0.291  Sum_probs=67.0

Q ss_pred             EEEEEECCCCCCHHHHHHHHHHHH-----------HHHHCCCCC--CHHHCCCCC--CCEEE-EEEECCCC-CCCCCCHH
Q ss_conf             399996778440789999999999-----------999719853--035320682--21056-76523766-11385328
Q gi|254780750|r  651 KLWLLTGPNMGGKSTFLRQNALIV-----------IMAQMGSYV--PASYAHIGI--VDKLF-SRVGSADN-LASGRSTF  713 (920)
Q Consensus       651 ~~~iiTGpNmgGKSt~lRqval~v-----------ilAQiG~fV--PA~~a~i~~--~D~If-tRiGa~D~-l~~g~STF  713 (920)
                      ++-+|.|||-+|||+++..++...           .+...+.++  ++.+|.+..  .+.-| ..-|..+. |..|+-+ 
T Consensus        23 ~~~~ivG~nGsGKSni~~ai~~~~g~~~~~~~~~~~l~~~~~~~~~~~~~a~v~~~~~~~~~~v~qg~~~~lLSGGEks-  101 (178)
T cd03239          23 SFNAIVGPNGSGKSNIVDAICFVLGGKAAKLRRGSLLFLAGGGVKAGINSASVEITFDKSYFLVLQGKVEQILSGGEKS-  101 (178)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHHCCCHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHCCCCCCCHHHCCCCCHHH-
T ss_conf             8179989998877899999999986642765200135432443556744236799998754044124410016752589-


Q ss_pred             HHHHHHHHHHH--HHCCCCCEEEEECCCCCCCHHHHHHH--HHHHHHHHHHHCCCEEEEECCCHHHHHHHHHCCCEEE
Q ss_conf             99999999999--95899856999325889880567999--9999999997269849997487579766430688589
Q gi|254780750|r  714 MVEMIETASIL--NQATNQSFVILDEIGRGTATLDGLSI--AWATIEYLHETNRCRGLLATHFHELTDLSKSLKRFHN  787 (920)
Q Consensus       714 ~vEm~e~~~IL--~~at~~SLVllDElGrGTst~DG~ai--A~aile~l~~~~~~~~lfaTHy~eL~~l~~~~~~v~n  787 (920)
                         |..++.++  ....+..++|+||+   ++..|....  ....+..+.+. ++-.+++||-.+.-+.++.+=+|.+
T Consensus       102 ---l~alal~~ai~~~~p~p~~iLDEv---dAaLD~~N~~r~~~~i~el~~~-~sQfIiITH~~~~m~~ad~l~gVtm  172 (178)
T cd03239         102 ---LSALALIFALQEIKPSPFYVLDEI---DAALDPTNRRRVSDMIKEMAKH-TSQFIVITLKKEMFENADKLIGVLF  172 (178)
T ss_pred             ---HHHHHHHHHHHCCCCCCEEEEECC---CCCCCHHHHHHHHHHHHHHHHC-CCEEEEEECCHHHHHHCCEEEEEEE
T ss_conf             ---999999999971389966998276---5547988999999999999738-9989999868999974785899980


No 100
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=97.81  E-value=0.00016  Score=52.14  Aligned_cols=51  Identities=22%  Similarity=0.104  Sum_probs=33.3

Q ss_pred             CCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHH
Q ss_conf             8998569993258898805679999999999997269849997487579766
Q gi|254780750|r  727 ATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFHELTDL  778 (920)
Q Consensus       727 at~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~~l  778 (920)
                      |.+-.++|+||--.|=++. +..--+.+++.|.+..+..++++||.-+.+.+
T Consensus       160 a~~P~iLllDEPTs~LD~~-~~~~i~~~l~~l~~e~g~TvI~itHd~~~a~~  210 (283)
T PRK13640        160 AVEPQIIILDESTSMLDPA-GKEQILKLIRKLMKDNNLTIISITHDIDEAAG  210 (283)
T ss_pred             HCCCCEEEECCCCCCCCHH-HHHHHHHHHHHHHHCCCCEEEEEEECHHHHHH
T ss_conf             7199999976874548989-99999999999997069899999788789970


No 101
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional
Probab=97.80  E-value=0.00013  Score=52.78  Aligned_cols=141  Identities=26%  Similarity=0.346  Sum_probs=73.9

Q ss_pred             EEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCC------C---CCHHHCCCCCC---CEEEEEEEC
Q ss_conf             44345635877776643999967784407899999999999997198------5---30353206822---105676523
Q gi|254780750|r  635 IANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGS------Y---VPASYAHIGIV---DKLFSRVGS  702 (920)
Q Consensus       635 VpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~------f---VPA~~a~i~~~---D~IftRiGa  702 (920)
                      |=+|++|..    ..+.+.-|-|||.+||||+||.++=+.- ...|.      -   .|+..-.++.+   ..+|-.+-.
T Consensus        17 al~~vsl~i----~~GE~~~llGpSGsGKSTLlr~iaGL~~-p~sG~I~~~G~dv~~~~~~~r~Ig~vfQ~~~L~p~ltV   91 (352)
T PRK10851         17 VLNDISLDI----PSGQMVALLGPSGSGKTTLLRIIAGLEH-QTSGHIRFHGTDVSRLHARDRKVGFVFQHYALFRHMTV   91 (352)
T ss_pred             EEECCEEEE----CCCCEEEEECCCCCHHHHHHHHHHCCCC-CCCEEEEECCEECCCCCCCCCCEEEEECCCHHCCCCCH
T ss_conf             990637699----9998999999998469999999976999-99569999999999899300848999407121458809


Q ss_pred             CCCCCCCCCHH-----------------HHHHHHHHHHHH-------------------HCCCCCEEEEECCCCCCCHHH
Q ss_conf             76611385328-----------------999999999999-------------------589985699932588988056
Q gi|254780750|r  703 ADNLASGRSTF-----------------MVEMIETASILN-------------------QATNQSFVILDEIGRGTATLD  746 (920)
Q Consensus       703 ~D~l~~g~STF-----------------~vEm~e~~~IL~-------------------~at~~SLVllDElGrGTst~D  746 (920)
                      .||+.-|..-+                 +.|+......++                   -+.+-.++|+||--.|=++.-
T Consensus        92 ~eNi~~gl~~~~~~~~~~~~~~~~rv~~~l~~vgL~~~~~r~p~~LSGGqrQRVaiARAL~~~P~vLLLDEPts~LD~~~  171 (352)
T PRK10851         92 FDNIAFGLTVLPRRERPNAAAIKAKVTQLLEMVQLAHLADRYPAQLSGGQKQRVALARALAVEPQILLLDEPFGALDAQV  171 (352)
T ss_pred             HHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHCCCHHHHCCCHHHCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCHHH
T ss_conf             99998777542211376899999999999987599447609931499999999999999865999999908876689899


Q ss_pred             HHHHHHHHHHHHHHHCCCEEEEECCCHHHH-HHHHH
Q ss_conf             799999999999972698499974875797-66430
Q gi|254780750|r  747 GLSIAWATIEYLHETNRCRGLLATHFHELT-DLSKS  781 (920)
Q Consensus       747 G~aiA~aile~l~~~~~~~~lfaTHy~eL~-~l~~~  781 (920)
                      -..+ +..+..|.+..+..++|+||..+.+ .+++.
T Consensus       172 r~~i-~~~l~~L~~e~g~T~i~VTHD~~eA~~laDr  206 (352)
T PRK10851        172 RKEL-RRWLRQLHEELKFTSVFVTHDQEEAMEVADR  206 (352)
T ss_pred             HHHH-HHHHHHHHHHHCCEEEEECCCHHHHHHHCCE
T ss_conf             9999-9999999997399899998899999986989


No 102
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=97.79  E-value=0.00022  Score=51.16  Aligned_cols=174  Identities=20%  Similarity=0.200  Sum_probs=83.3

Q ss_pred             EEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCC------CCHH-----HCCCCCC----C-EEE
Q ss_conf             4443456358777766439999677844078999999999999971985------3035-----3206822----1-056
Q gi|254780750|r  634 FIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSY------VPAS-----YAHIGIV----D-KLF  697 (920)
Q Consensus       634 fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~f------VPA~-----~a~i~~~----D-~If  697 (920)
                      .+=+|++|..    ..+.+.-|.|||-+||||++|.++=+. ..+-|.-      +...     .-.+|.+    | .+|
T Consensus        24 ~~L~~isl~i----~~Ge~vaivG~nGsGKSTLlk~l~Gll-~p~~G~I~v~G~~i~~~~~~~~~~~ig~VfQ~Pd~q~~   98 (273)
T PRK13632         24 NALKNVSFTI----NEGEYVAILGHNGSGKSTISKILTGLL-KPQSGEIKIFGITISKENLKYLRKKIGIIFQNPDNQFI   98 (273)
T ss_pred             CEEEEEEEEE----CCCCEEEEECCCCCHHHHHHHHHHCCC-CCCCCEEEECCEECCCCCHHHHHHHEEEEEECCCHHCC
T ss_conf             6066428898----499899999999986999999997387-78887599999999968989987435699877102027


Q ss_pred             EEEECCCCCCCCCCHH---HHHHHH-HHHHHH----------------------------HCCCCCEEEEECCCCCCCHH
Q ss_conf             7652376611385328---999999-999999----------------------------58998569993258898805
Q gi|254780750|r  698 SRVGSADNLASGRSTF---MVEMIE-TASILN----------------------------QATNQSFVILDEIGRGTATL  745 (920)
Q Consensus       698 tRiGa~D~l~~g~STF---~vEm~e-~~~IL~----------------------------~at~~SLVllDElGrGTst~  745 (920)
                      . .-..|++.-|.-.+   -.|+.+ +..+++                            -|..-.++|+||--.|=++.
T Consensus        99 ~-~tV~e~iafgl~~~~~~~~~~~~~v~~~l~~~gl~~~~~~~p~~LSGGqkQRvaiA~aLa~~P~iliLDEPTs~LD~~  177 (273)
T PRK13632         99 G-ITVEDDIAFGLENKKIPPKKMKDIIDDLAKKVGMEDYLKKEPQNLSGGQKQRVAIASVLALNPEIIIFDESTSMLDPK  177 (273)
T ss_pred             C-CCHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHHCCCHHCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCHH
T ss_conf             7-517888886786679999999999999999869888774782009999999999999997199999980775569989


Q ss_pred             HHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHCCCEEEEEEEEEEECCEEEEEEEEEECCCCCCH-HHHHHHHCCC
Q ss_conf             679999999999997269849997487579766430688589999999609927787777447898877-8999998299
Q gi|254780750|r  746 DGLSIAWATIEYLHETNRCRGLLATHFHELTDLSKSLKRFHNATLQVSDSNEGIIFLHKVIPGIADHSY-GIQVGKLAGL  824 (920)
Q Consensus       746 DG~aiA~aile~l~~~~~~~~lfaTHy~eL~~l~~~~~~v~n~~~~~~~~~~~i~flykl~~G~~~~Sy-gi~vA~laG~  824 (920)
                       +..--|.++..|.+..+..++++||.-+....+   .++.  .    -.+++|++     .|....=| -.++-+.+|+
T Consensus       178 -~~~~l~~~l~~l~~~~g~TvI~iTHd~~~~~~a---Drv~--v----m~~G~iv~-----~G~p~el~~~~e~l~~~~l  242 (273)
T PRK13632        178 -GKREIKKIMVDLRKDRKKTLISITHDMDEAILA---DKVI--V----FSNGKLIA-----QGKPKEILNDKEILEKAKL  242 (273)
T ss_pred             -HHHHHHHHHHHHHHHCCCEEEEEEECHHHHHCC---CEEE--E----EECCEEEE-----ECCHHHHHCCHHHHHHCCC
T ss_conf             -999999999999984698999994288899719---9999--9----98999999-----7699998779999997799


Q ss_pred             CHHH
Q ss_conf             9899
Q gi|254780750|r  825 PNTV  828 (920)
Q Consensus       825 p~~v  828 (920)
                      ..+.
T Consensus       243 ~~P~  246 (273)
T PRK13632        243 DSPF  246 (273)
T ss_pred             CCCH
T ss_conf             9986


No 103
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional
Probab=97.79  E-value=0.00034  Score=49.78  Aligned_cols=52  Identities=23%  Similarity=0.255  Sum_probs=36.6

Q ss_pred             CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHH-HHHH
Q ss_conf             9985699932588988056799999999999972698499974875797-6643
Q gi|254780750|r  728 TNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFHELT-DLSK  780 (920)
Q Consensus       728 t~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~-~l~~  780 (920)
                      ..-.++|+||--.|=++..-..| +.++..|.+..++-++++||.-+.. .+++
T Consensus       170 ~~P~lLlLDEPt~gLD~~~~~~i-~~~i~~l~~~~g~tvl~itHdl~~v~~~aD  222 (255)
T PRK11300        170 TQPRILMLDEPAAGLNPKETKEL-DELIAELRNEHNVTVLLIEHDMKLVMGISD  222 (255)
T ss_pred             HCCCEEEECCCCCCCCHHHHHHH-HHHHHHHHHCCCCEEEEECCCHHHHHHHCC
T ss_conf             29996998187546999999999-999999997159799999273899998699


No 104
>CHL00131 ycf16 sulfate ABC transporter protein; Validated
Probab=97.79  E-value=0.0007  Score=47.42  Aligned_cols=135  Identities=30%  Similarity=0.344  Sum_probs=68.7

Q ss_pred             EEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHH-HHHHHCCC----------CCCHHHCCCCCCCEEE-----
Q ss_conf             4443456358777766439999677844078999999999-99997198----------5303532068221056-----
Q gi|254780750|r  634 FIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALI-VIMAQMGS----------YVPASYAHIGIVDKLF-----  697 (920)
Q Consensus       634 fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~-vilAQiG~----------fVPA~~a~i~~~D~If-----  697 (920)
                      -|=+||+|..    ..+.++-|-|||-+||||++|.++=. .+-..-|.          .-|.+.++.+++ .+|     
T Consensus        20 ~vL~~isl~i----~~Gei~aiiG~nGsGKSTL~~~i~G~~~~~~~~G~I~~~G~~i~~~~~~~~~~~gi~-~~~Q~~~~   94 (252)
T CHL00131         20 EILKGINLSI----NAGEIHAIMGPNGSGKSTLSKVIAGHPAYTVLEGDILFKGESILELEPEERAHLGIF-LAFQYPIE   94 (252)
T ss_pred             EEEECCEEEE----CCCCEEEEECCCCCCHHHHHHHHCCCCCCCCCCCEEEECCEECCCCCHHHHHHCCEE-EEEECHHH
T ss_conf             9885617788----799899999999999999999972787667664259987727685999999865967-85420243


Q ss_pred             -E--------EE------------------------------ECCC-----CCCCCCCHHHHHHHHHHHHHHHCCCCCEE
Q ss_conf             -7--------65------------------------------2376-----61138532899999999999958998569
Q gi|254780750|r  698 -S--------RV------------------------------GSAD-----NLASGRSTFMVEMIETASILNQATNQSFV  733 (920)
Q Consensus       698 -t--------Ri------------------------------Ga~D-----~l~~g~STF~vEm~e~~~IL~~at~~SLV  733 (920)
                       .        |+                              |-.+     ++..+.|-=+--...+|..|  +..-.++
T Consensus        95 ~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~l~~~~l~r~~~~~LSGGqkqRv~iaral--~~~P~iL  172 (252)
T CHL00131         95 IPGVSNADFLRLAYNAKRKFQGLPELDPLEFFEIISEKLKLVGMDPSFLNRNVNEGFSGGEKKRNEILQMA--LLDSKLA  172 (252)
T ss_pred             CCCCCHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHCCCCHHHHHCCCCCCCCHHHHHHHHHHHHH--HHCCCEE
T ss_conf             25755999999887666554043315889999999999987499857753365545789999999999999--6399999


Q ss_pred             EEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHH
Q ss_conf             99325889880567999999999999726984999748757976
Q gi|254780750|r  734 ILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFHELTD  777 (920)
Q Consensus       734 llDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~~  777 (920)
                      |+||--.|=++.. ...-+.++..|.+. +.-++++||+.++.+
T Consensus       173 iLDEPTsgLD~~~-~~~i~~~l~~l~~~-g~tii~itH~~~~~~  214 (252)
T CHL00131        173 ILDETDSGLDIDA-LKIIAEGINKLATS-DNAIILITHYQRLLD  214 (252)
T ss_pred             EEECCCCCCCHHH-HHHHHHHHHHHHHC-CCEEEEEEECHHHHH
T ss_conf             9979876699999-99999999999858-999999998669898


No 105
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional
Probab=97.79  E-value=0.00077  Score=47.14  Aligned_cols=125  Identities=26%  Similarity=0.251  Sum_probs=69.1

Q ss_pred             EEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHH--------------------HHHHCCCCCCHHHC---CC
Q ss_conf             44434563587777664399996778440789999999999--------------------99971985303532---06
Q gi|254780750|r  634 FIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIV--------------------IMAQMGSYVPASYA---HI  690 (920)
Q Consensus       634 fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~v--------------------ilAQiG~fVPA~~a---~i  690 (920)
                      -|=+|++|..    ..+.+.-|-|||-+||||++|.++=+.                    -+++.=.|||-...   .+
T Consensus        16 ~~L~~isl~i----~~Gei~~liGpNGaGKSTLlk~i~Gl~~p~sG~I~i~g~~i~~~~~~~~~~~i~~vpQ~~~~~~~~   91 (255)
T PRK11231         16 RILNDLSLSL----PTGKITALIGPNGCGKSTLLKCFARLLTPQSGTVFLGDKPISMLSARQLARRLSLLPQHHLTPEGI   91 (255)
T ss_pred             EEEECCEEEE----CCCCEEEEECCCCCHHHHHHHHHHCCCCCCCCEEEECCEECCCCCHHHHHHHEEEECCCCCCCCCC
T ss_conf             9982308899----899799999999981999999997598888648999999836299899851189976767578998


Q ss_pred             CCCCEEEEEEECCCCCCCCCCHH--------------------------------------HHHHHHHHHHHHHCCCCCE
Q ss_conf             82210567652376611385328--------------------------------------9999999999995899856
Q gi|254780750|r  691 GIVDKLFSRVGSADNLASGRSTF--------------------------------------MVEMIETASILNQATNQSF  732 (920)
Q Consensus       691 ~~~D~IftRiGa~D~l~~g~STF--------------------------------------~vEm~e~~~IL~~at~~SL  732 (920)
                      ++.          |++.-|++.+                                      +--....|..|  +..-.+
T Consensus        92 tv~----------e~v~~g~~~~~~~~~~~~~~~~~~v~~~l~~~~l~~~~~~~~~~LSGGqkQRv~iAraL--~~~p~l  159 (255)
T PRK11231         92 TVR----------ELVSYGRSPWLSLWGRLSAEDNARVNQAMNQTRINHLADRRLTELSGGQRQRAFLAMVL--AQDTPV  159 (255)
T ss_pred             CHH----------HHHHCCCCHHHHHCCCCCHHHHHHHHHHHHHCCCHHHHCCCCCCCCHHHHHHHHHHHHH--HCCCCE
T ss_conf             899----------99970550123441568688999999999882982564797452999999999999999--539997


Q ss_pred             EEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHH
Q ss_conf             99932588988056799999999999972698499974875797
Q gi|254780750|r  733 VILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFHELT  776 (920)
Q Consensus       733 VllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~  776 (920)
                      +|+||--.|-++..-..+ +.++..+.+. +..++++||.-+..
T Consensus       160 llLDEPtsgLD~~~~~~i-~~li~~l~~~-g~tvi~vtHdl~~~  201 (255)
T PRK11231        160 VLLDEPTTYLDINHQVEL-MRLMRELNTQ-GKTVVTVLHDLNQA  201 (255)
T ss_pred             EEEECCCCCCCHHHHHHH-HHHHHHHHHC-CCEEEEEECCHHHH
T ss_conf             998388644899999999-9999999868-99999993788999


No 106
>PRK10535 macrolide transporter ATP-binding /permease protein; Provisional
Probab=97.78  E-value=0.00021  Score=51.33  Aligned_cols=12  Identities=33%  Similarity=0.595  Sum_probs=7.4

Q ss_pred             CCCCCCHHHHHH
Q ss_conf             822279899999
Q gi|254780750|r  881 NLDEMSPLTALK  892 (920)
Q Consensus       881 ~~~~~~p~~al~  892 (920)
                      ...++.|+|||-
T Consensus       635 kAArLdPIeALR  646 (648)
T PRK10535        635 NAARLDPVDALA  646 (648)
T ss_pred             HHHCCCHHHHHC
T ss_conf             887789989821


No 107
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors.  The eye pigmentation of Drosophila is developed from the synthesis and deposition in the cells of red pigments, which are synthesized from guanine, and brown pigments, which are synthesized from tryptophan.  The pigment precursors are encoded by the white, brown, and scarlet genes, respectively.  Evidence from genetic and biochemical studies suggest that the White and Brown proteins function as heterodimers to import guanine, while the White and Scarlet proteins function to import tryptophan.  However, a recent study also suggests that White may be involved in the transport of a metabolite, such as 3-hydroxykynurenine, across intracellular membranes.  Mammalian ABC transporters belonging to the White subfamily (ABCG1, ABCG5, and ABCG8) have been shown to be involved in the regulation of lipid-trafficking mechanisms in 
Probab=97.78  E-value=0.00052  Score=48.40  Aligned_cols=33  Identities=33%  Similarity=0.509  Sum_probs=27.3

Q ss_pred             EEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHH
Q ss_conf             4434563587777664399996778440789999999
Q gi|254780750|r  635 IANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNA  671 (920)
Q Consensus       635 VpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqva  671 (920)
                      |=+|+++..    ..+.+.-|-|||-+||||+|+.++
T Consensus        22 vL~~vs~~i----~~Ge~~~ilGpnGsGKSTLl~~i~   54 (226)
T cd03234          22 ILNDVSLHV----ESGQVMAILGSSGSGKTTLLDAIS   54 (226)
T ss_pred             EEECCEEEE----ECCCEEEEECCCCCHHHHHHHHHH
T ss_conf             988977899----188099999899960999999996


No 108
>PRK13537 lipooligosaccharide transporter ATP-binding subunit; Provisional
Probab=97.78  E-value=0.00067  Score=47.56  Aligned_cols=139  Identities=24%  Similarity=0.343  Sum_probs=72.0

Q ss_pred             EEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHC------CCCCCH----HHCCCCCC---CEEEEEE
Q ss_conf             4443456358777766439999677844078999999999999971------985303----53206822---1056765
Q gi|254780750|r  634 FIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQM------GSYVPA----SYAHIGIV---DKLFSRV  700 (920)
Q Consensus       634 fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQi------G~fVPA----~~a~i~~~---D~IftRi  700 (920)
                      .+=+|++|..    ..+.+.=+-|||-+||||++|.+.=+.- ..-      |-.|+-    ....+|.+   ..+|-.+
T Consensus        19 ~al~~vs~~V----~~Gei~gllGpNGAGKTTli~~l~Gl~~-p~sG~v~i~G~~i~~~~~~~r~~iG~~pq~~~l~~~l   93 (304)
T PRK13537         19 LVVDGLSFHV----QPGECFGLLGPNGAGKTTTLKMLLGLTH-PDAGTISLCGEPVPSRARHARQRVGVVPQFDNLDPDF   93 (304)
T ss_pred             EEECCEEEEE----CCCCEEEEECCCCCCHHHHHHHHHCCCC-CCCCEEEECCEECCCCHHHHHHCEEEEECCCCCCCCC
T ss_conf             9983717788----6995999999989729999999977956-8976899999988756288873559991776568898


Q ss_pred             ECCCCCC----------------------------------CCCCHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHH
Q ss_conf             2376611----------------------------------385328999999999999589985699932588988056
Q gi|254780750|r  701 GSADNLA----------------------------------SGRSTFMVEMIETASILNQATNQSFVILDEIGRGTATLD  746 (920)
Q Consensus       701 Ga~D~l~----------------------------------~g~STF~vEm~e~~~IL~~at~~SLVllDElGrGTst~D  746 (920)
                      -..+++.                                  ...|.=|--....+..  -+..-.++++||--.|=++.-
T Consensus        94 tv~e~l~~~~~~~g~~~~~~~~~~~~ll~~~~L~~~~~~~~~~lSgG~kqrl~ia~a--l~~~P~lliLDEPT~GLDp~~  171 (304)
T PRK13537         94 TVRENLLVFGRYFGLSAAAARALVPPLLEFAKLENKADAKVGELSGGMKRRLTLARA--LVNDPDVLVLDEPTTGLDPQA  171 (304)
T ss_pred             CHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHCCCHHHCCHHHHHHHHHHHH--HHCCCCEEEEECCCCCCCHHH
T ss_conf             999999999997299999999999999997799568567366799999999999999--837999999938866789999


Q ss_pred             HHHHHHHHHHHHHHHCCCEEEEECCCHHHHH-HHHH
Q ss_conf             7999999999999726984999748757976-6430
Q gi|254780750|r  747 GLSIAWATIEYLHETNRCRGLLATHFHELTD-LSKS  781 (920)
Q Consensus       747 G~aiA~aile~l~~~~~~~~lfaTHy~eL~~-l~~~  781 (920)
                      - ..-|..+..+.+. +..++++|||-+-.+ +.+.
T Consensus       172 r-~~i~~~i~~l~~~-G~TillttH~l~E~e~lcDr  205 (304)
T PRK13537        172 R-HLMWERLRSLLAR-GKTILLTTHFMEEAERLCDR  205 (304)
T ss_pred             H-HHHHHHHHHHHHC-CCEEEEECCCHHHHHHHCCE
T ss_conf             9-9999999999968-99999988848999986999


No 109
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota.  The transition metal cobalt is an essential component of many enzymes and must be transported into cells in appropriate amounts when needed.  This ABC transport system of the CbiMNQO family is involved in cobalt transport in association with the cobalamin (vitamin B12) biosynthetic pathways.  Most of cobalt (Cbi) transport systems possess a separate CbiN component, the cobalt-binding periplasmic protein, and they are encoded by the conserved gene cluster cbiMNQO.  Both the CbiM and CbiQ proteins are integral cytoplasmic membrane proteins, and the CbiO protein has the linker peptide and the Walker A and B motifs commonly found in the ATPase components of the ABC-type transport systems.
Probab=97.78  E-value=0.00013  Score=52.88  Aligned_cols=137  Identities=24%  Similarity=0.306  Sum_probs=69.2

Q ss_pred             EEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCC---------CHHH--CCCCCC----CE-EE
Q ss_conf             44434563587777664399996778440789999999999999719853---------0353--206822----10-56
Q gi|254780750|r  634 FIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYV---------PASY--AHIGIV----DK-LF  697 (920)
Q Consensus       634 fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fV---------PA~~--a~i~~~----D~-If  697 (920)
                      .|=+|+++..    ..+.+.-|.|||-+||||++|.++-+. -.+-|.--         +...  -.++.+    +. +|
T Consensus        15 ~~L~~vsl~i----~~Gei~~iiG~nGaGKSTLlk~i~Gl~-~p~~G~I~~~g~~i~~~~~~~~~~~ig~v~Q~p~~~~~   89 (211)
T cd03225          15 PALDDISLTI----KKGEFVLIVGPNGSGKSTLLRLLNGLL-GPTSGEVLVDGKDLTKLSLKELRRKVGLVFQNPDDQFF   89 (211)
T ss_pred             EEEEEEEEEE----CCCCEEEEECCCCCCHHHHHHHHHCCC-CCCCCCEEECCEECCCCCHHHHHCCEEEEEECCHHHCC
T ss_conf             5775317888----499799998899998999999996467-79888778999999979989984038999778325305


Q ss_pred             EEEECCCCCCC-----CCCHHHHHHHH-HHHHHH----------------------------HCCCCCEEEEECCCCCCC
Q ss_conf             76523766113-----85328999999-999999----------------------------589985699932588988
Q gi|254780750|r  698 SRVGSADNLAS-----GRSTFMVEMIE-TASILN----------------------------QATNQSFVILDEIGRGTA  743 (920)
Q Consensus       698 tRiGa~D~l~~-----g~STF~vEm~e-~~~IL~----------------------------~at~~SLVllDElGrGTs  743 (920)
                      . .-..|+|.-     +.|.  .|+.+ +..+|.                            -++.-.++|+||--.|=+
T Consensus        90 ~-~tv~e~i~~~~~~~~~~~--~~~~~~~~~~l~~~~l~~~~~~~~~~LSGGqkQrv~iAral~~~P~ililDEPTsgLD  166 (211)
T cd03225          90 G-PTVEEEVAFGLENLGLPE--EEIEERVEEALELVGLEGLRDRSPFTLSGGQKQRVAIAGVLAMDPDILLLDEPTAGLD  166 (211)
T ss_pred             C-CCHHHHHHHHHHHCCCCH--HHHHHHHHHHHHHCCCHHHHHCCHHHCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCC
T ss_conf             5-869999999999869999--9999999999998699466638954599989999999999975999999979855589


Q ss_pred             HHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHH-HHH
Q ss_conf             0567999999999999726984999748757976-643
Q gi|254780750|r  744 TLDGLSIAWATIEYLHETNRCRGLLATHFHELTD-LSK  780 (920)
Q Consensus       744 t~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~~-l~~  780 (920)
                      +.- ...-|..+..+.+. +.-++++||.-+... +++
T Consensus       167 ~~~-~~~i~~~l~~l~~~-g~tii~itHdl~~~~~~~d  202 (211)
T cd03225         167 PAG-RRELLELLKKLKAE-GKTIIIVTHDLDLLLELAD  202 (211)
T ss_pred             HHH-HHHHHHHHHHHHHC-CCEEEEEECCHHHHHHHCC
T ss_conf             999-99999999999978-9999999259999999799


No 110
>COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism]
Probab=97.76  E-value=0.00081  Score=46.97  Aligned_cols=21  Identities=38%  Similarity=0.725  Sum_probs=18.4

Q ss_pred             EEEEEECCCCCCHHHHHHHHH
Q ss_conf             399996778440789999999
Q gi|254780750|r  651 KLWLLTGPNMGGKSTFLRQNA  671 (920)
Q Consensus       651 ~~~iiTGpNmgGKSt~lRqva  671 (920)
                      .=|.|+|||-+||||+||.++
T Consensus        58 e~W~I~G~NGsGKTTLL~ll~   78 (257)
T COG1119          58 EHWAIVGPNGAGKTTLLSLLT   78 (257)
T ss_pred             CCEEEECCCCCCHHHHHHHHH
T ss_conf             847998889877899999996


No 111
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed
Probab=97.76  E-value=0.00065  Score=47.66  Aligned_cols=134  Identities=22%  Similarity=0.294  Sum_probs=70.1

Q ss_pred             EEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCC------CCC---HHH----CCCCCC-C--EEEE
Q ss_conf             44345635877776643999967784407899999999999997198------530---353----206822-1--0567
Q gi|254780750|r  635 IANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGS------YVP---ASY----AHIGIV-D--KLFS  698 (920)
Q Consensus       635 VpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~------fVP---A~~----a~i~~~-D--~Ift  698 (920)
                      +=+|+++..    ..+.+..|.|||-+||||++|.++=+. -..-|.      -|.   +..    -.++.+ .  .+|.
T Consensus        16 ~L~dvs~~i----~~Ge~~~liG~nGsGKSTll~~i~Gl~-~~~~G~i~~~G~~i~~~~~~~~~~r~~ig~v~Q~~~l~~   90 (240)
T PRK09493         16 VLHNIDLNI----DQGEVVVIIGPSGSGKSTLLRCINKLE-EITSGDLIVDGLKVNDPKVDERLIRQEAGMVFQQFYLFP   90 (240)
T ss_pred             EEECEEEEE----CCCCEEEEECCCCCHHHHHHHHHHCCC-CCCCCEEEECCEECCCCCHHHHHHHHHCEEECCCCCCCC
T ss_conf             881307898----799899999999980999999996389-999974878999878876658998752428801122478


Q ss_pred             EEECCCCCCCC------CCHH-----HHHHHH------------------------HHHHHHHCCCCCEEEEECCCCCCC
Q ss_conf             65237661138------5328-----999999------------------------999999589985699932588988
Q gi|254780750|r  699 RVGSADNLASG------RSTF-----MVEMIE------------------------TASILNQATNQSFVILDEIGRGTA  743 (920)
Q Consensus       699 RiGa~D~l~~g------~STF-----~vEm~e------------------------~~~IL~~at~~SLVllDElGrGTs  743 (920)
                      .+-..||+.-|      .+.-     ..|+.+                        .|..  -+.+-.++|+||--.|-+
T Consensus        91 ~ltv~eni~~~~~~~~~~~~~~~~~~~~~~l~~~gl~~~~~~~~~~LSGGq~QRvaiAra--L~~~P~lLllDEPt~~LD  168 (240)
T PRK09493         91 HLTALENVMFGPLRVRGASKEEAEKQARELLAKVGLAERAHHYPSELSGGQQQRVAIARA--LAVKPKLMLFDEPTSALD  168 (240)
T ss_pred             CCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHCCCCCCCCHHHHHHHHHHHH--HHCCCCEEEEECCCCCCC
T ss_conf             877999998789997599878999999999997699246629877289999999999987--735999999908876689


Q ss_pred             HHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHH
Q ss_conf             0567999999999999726984999748757976
Q gi|254780750|r  744 TLDGLSIAWATIEYLHETNRCRGLLATHFHELTD  777 (920)
Q Consensus       744 t~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~~  777 (920)
                      +.--.-| +..+..|.+. +.-++++||.-++..
T Consensus       169 ~~~~~~i-~~ll~~l~~~-g~tvi~vtHdl~~~~  200 (240)
T PRK09493        169 PELRHEV-LKVMQDLAEE-GMTMVIVTHEIGFAE  200 (240)
T ss_pred             HHHHHHH-HHHHHHHHHC-CCEEEEECCCHHHHH
T ss_conf             9999999-9999999976-998999947999999


No 112
>PRK13542 consensus
Probab=97.76  E-value=0.00024  Score=50.84  Aligned_cols=131  Identities=19%  Similarity=0.243  Sum_probs=63.4

Q ss_pred             EEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHH--------------------HHHHCCCCCCHH---HCCCC
Q ss_conf             4434563587777664399996778440789999999999--------------------999719853035---32068
Q gi|254780750|r  635 IANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIV--------------------IMAQMGSYVPAS---YAHIG  691 (920)
Q Consensus       635 VpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~v--------------------ilAQiG~fVPA~---~a~i~  691 (920)
                      |=.+++|..    ..+.+.-|.|||-+||||+||.++=+.                    +..++| |||=.   .-.++
T Consensus        33 il~~isl~i----~~Gei~~liGpNGaGKTTLlk~l~Gll~p~~G~I~~~G~~i~~~~~~~~~~~~-~v~~~~~l~~~lt  107 (224)
T PRK13542         33 VFRGIDISL----APGDLLQVMGPNGSGKTSLLRVLSGLMPPAEGDLYWRGRAVRAGDPDYLQQLA-YVGHANGIDPDLS  107 (224)
T ss_pred             EEECCEEEE----CCCCEEEEECCCCCCHHHHHHHHHCCCCCCCEEEEECCEECCCCCHHHHHHEE-EECCCCCCCCCCC
T ss_conf             884616787----59979999999999999999999579788852899999999879988884447-8666333587872


Q ss_pred             CCCEEE-------------------EEEECCCCCCCCCCHHHHHHHHHHHHHH-HCCCCCEEEEECCCCCCCHHHHHHHH
Q ss_conf             221056-------------------7652376611385328999999999999-58998569993258898805679999
Q gi|254780750|r  692 IVDKLF-------------------SRVGSADNLASGRSTFMVEMIETASILN-QATNQSFVILDEIGRGTATLDGLSIA  751 (920)
Q Consensus       692 ~~D~If-------------------tRiGa~D~l~~g~STF~vEm~e~~~IL~-~at~~SLVllDElGrGTst~DG~aiA  751 (920)
                      +.+.+-                   .+.|-.+-.-.--.++.--|..--.|.+ -+.+..++|+||-..|=++. +....
T Consensus       108 v~enl~~~~~~~~~~~~~~~~~~~l~~~gl~~~~~~~~~~LSgGqrqRv~lA~al~~~p~illLDEPtagLD~~-~~~~l  186 (224)
T PRK13542        108 AFENLRFAARLAGQQATADAVHHALARFGLDRVMHAPARTLSQGQRRRVALARLALTPRALWLLDEPLTSLDDA-SAACF  186 (224)
T ss_pred             HHHHHHHHHHHCCCCCHHHHHHHHHHHCCCCHHHCCCHHHCCHHHHHHHHHHHHHHCCCCEEEECCCCCCCCHH-HHHHH
T ss_conf             99999999987388746999999999849902546881249999999999999980799889973853548999-99999


Q ss_pred             HHHHHHHHHHCCCEEEEECCC
Q ss_conf             999999997269849997487
Q gi|254780750|r  752 WATIEYLHETNRCRGLLATHF  772 (920)
Q Consensus       752 ~aile~l~~~~~~~~lfaTHy  772 (920)
                      +.++..+.+. +..++++||.
T Consensus       187 ~~~i~~~~~~-g~tvIi~tH~  206 (224)
T PRK13542        187 HTLLDEHLRR-GGMAVVATHQ  206 (224)
T ss_pred             HHHHHHHHHC-CCEEEEEECC
T ss_conf             9999999968-9989999588


No 113
>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D.  PotA has two domains with the N-terminal domain containing the ATPase activity and the residues required for homodimerization with PotA and heterdimerization with PotB.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=97.76  E-value=0.00039  Score=49.36  Aligned_cols=133  Identities=22%  Similarity=0.264  Sum_probs=73.7

Q ss_pred             EEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHCCCCCCC-------------------
Q ss_conf             4443456358777766439999677844078999999999999971985303532068221-------------------
Q gi|254780750|r  634 FIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHIGIVD-------------------  694 (920)
Q Consensus       634 fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a~i~~~D-------------------  694 (920)
                      -|=+|++|..    ..+.+..|-|||-+||||+||.++        |..=| ++-++-+-+                   
T Consensus        14 ~vl~~vsl~v----~~Ge~~~iiGpSGsGKSTllr~i~--------Gl~~p-~~G~I~~~g~~v~~~~~~~r~ig~VfQ~   80 (232)
T cd03300          14 VALDGVSLDI----KEGEFFTLLGPSGCGKTTLLRLIA--------GFETP-TSGEILLDGKDITNLPPHKRPVNTVFQN   80 (232)
T ss_pred             EEECCCEEEE----CCCCEEEEECCCCCHHHHHHHHHH--------CCCCC-CCEEEEECCEECCCCCHHHCCEEEEECC
T ss_conf             8987617488----799899999999983999999997--------79999-8539999999999999545775699148


Q ss_pred             -EEEEEEECCCCCCCC-----CCHH-----HHHHHHH---------------------HHHHH-HCCCCCEEEEECCCCC
Q ss_conf             -056765237661138-----5328-----9999999---------------------99999-5899856999325889
Q gi|254780750|r  695 -KLFSRVGSADNLASG-----RSTF-----MVEMIET---------------------ASILN-QATNQSFVILDEIGRG  741 (920)
Q Consensus       695 -~IftRiGa~D~l~~g-----~STF-----~vEm~e~---------------------~~IL~-~at~~SLVllDElGrG  741 (920)
                       .+|-.+-..||+.-|     .|.=     .-|+.+.                     ..|-+ -|++-.++|+||--.+
T Consensus        81 ~~Lfp~ltV~~Nva~~l~~~~~~~~e~~~rv~e~l~~v~l~~~~~~~p~~LSGGqkQRVaiARAl~~~P~llllDEP~s~  160 (232)
T cd03300          81 YALFPHLTVFENIAFGLRLKKLPKAEIKERVAEALDLVQLEGYANRKPSQLSGGQQQRVAIARALVNEPKVLLLDEPLGA  160 (232)
T ss_pred             CCCCCCCCHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHCCCHHHCCHHHHHHHHHHHHHHCCCCEEEECCCCCC
T ss_conf             85477891999987799876999999999999998758977876199666998999999999998659999998088764


Q ss_pred             CCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHH-HHHH
Q ss_conf             88056799999999999972698499974875797-6643
Q gi|254780750|r  742 TATLDGLSIAWATIEYLHETNRCRGLLATHFHELT-DLSK  780 (920)
Q Consensus       742 Tst~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~-~l~~  780 (920)
                      =++.--..| +..+..+.+..+..++++||..+-+ .+++
T Consensus       161 LD~~~~~~i-~~~l~~l~~~~~~T~i~VTHd~~ea~~lad  199 (232)
T cd03300         161 LDLKLRKDM-QLELKRLQKELGITFVFVTHDQEEALTMSD  199 (232)
T ss_pred             CCHHHHHHH-HHHHHHHHHHHCCEEEEECCCHHHHHHHCC
T ss_conf             699999999-999999999859999999999999999699


No 114
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain.  They export degradative enzymes by using a type I protein secretion system and  lack an N-terminal signal peptide, but contain a C-terminal secretion signal.  The Type I secretion apparatus is made up of three components, an ABC transporter, a membrane fusion protein (MFP), and an outer membrane protein (OMP).  For the HlyA transporter complex, HlyB (ABC transporter) and HlyD (MFP) reside in the inner membrane of E. coli.  The OMP component is TolC, which is thought to interact with the MFP to form a continuous channel across the periplasm from the cytoplasm to the exterior.  HlyB belongs to the family of ABC transporters, which are ubiquitous, ATP-dependent transmembrane pumps or channels.  The spectrum of transport substra
Probab=97.76  E-value=0.00042  Score=49.08  Aligned_cols=128  Identities=23%  Similarity=0.250  Sum_probs=66.1

Q ss_pred             EEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHCCCCCCC------------EEEEEEE
Q ss_conf             4443456358777766439999677844078999999999999971985303532068221------------0567652
Q gi|254780750|r  634 FIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHIGIVD------------KLFSRVG  701 (920)
Q Consensus       634 fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a~i~~~D------------~IftRiG  701 (920)
                      .|=+|++|..    ..+.+.-|+|||-+||||+++.++        |.+-|-+- ++-+-.            +-+.=+.
T Consensus        16 ~vL~~i~l~i----~~G~~vaIvG~sGsGKSTLl~ll~--------gl~~p~~G-~i~i~g~~~~~~~~~~~~~~i~~v~   82 (173)
T cd03246          16 PVLRNVSFSI----EPGESLAIIGPSGSGKSTLARLIL--------GLLRPTSG-RVRLDGADISQWDPNELGDHVGYLP   82 (173)
T ss_pred             CCEECEEEEE----CCCCEEEEECCCCCHHHHHHHHHH--------CCCCCCCC-EEEECCEECCCCCHHHHHCCEEEEE
T ss_conf             6454769998----599999999999980999999996--------66667999-8999999933289989842089990


Q ss_pred             CCCCCCCC------CCHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHH--HHHHHHHHHHHHHHHCCCEEEEECCCH
Q ss_conf             37661138------5328999999999999589985699932588988056--799999999999972698499974875
Q gi|254780750|r  702 SADNLASG------RSTFMVEMIETASILNQATNQSFVILDEIGRGTATLD--GLSIAWATIEYLHETNRCRGLLATHFH  773 (920)
Q Consensus       702 a~D~l~~g------~STF~vEm~e~~~IL~~at~~SLVllDElGrGTst~D--G~aiA~aile~l~~~~~~~~lfaTHy~  773 (920)
                      -.+.++.|      .|-=..-..-.|..|  +....++|+||-   ||..|  +...-+..++.+..+ +..++++||-.
T Consensus        83 Q~~~lf~~ti~eNiLSGGQkQRvalARal--~~~p~ililDEp---ts~LD~~~e~~i~~~l~~l~~~-~~Tvi~vtH~~  156 (173)
T cd03246          83 QDDELFSGSIAENILSGGQRQRLGLARAL--YGNPRILVLDEP---NSHLDVEGERALNQAIAALKAA-GATRIVIAHRP  156 (173)
T ss_pred             CCCEECCCCHHHHCCCHHHHHHHHHHHHH--HCCCCEEEEECC---CCCCCHHHHHHHHHHHHHHHHC-CCEEEEECCCH
T ss_conf             88836777589976769999999999998--279999999687---6689989999999999978648-98999984799


Q ss_pred             HHHHHHH
Q ss_conf             7976643
Q gi|254780750|r  774 ELTDLSK  780 (920)
Q Consensus       774 eL~~l~~  780 (920)
                      ++...++
T Consensus       157 ~~~~~aD  163 (173)
T cd03246         157 ETLASAD  163 (173)
T ss_pred             HHHHHCC
T ss_conf             9998499


No 115
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters. Many non-lantibiotic bacteriocins of lactic acid bacteria are produced as precursors which have N-terminal leader peptides that share similarities in amino acid sequence and contain a conserved processing site of two glycine residues in positions -1 and -2.  A dedicated ATP-binding cassette (ABC) transporter is responsible for the proteolytic cleavage of the leader peptides and subsequent translocation of the bacteriocins across the cytoplasmic membrane.
Probab=97.76  E-value=0.00028  Score=50.43  Aligned_cols=136  Identities=24%  Similarity=0.279  Sum_probs=69.8

Q ss_pred             CEEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHH---------------------HHHHHCCCCCCHHHC--C
Q ss_conf             04443456358777766439999677844078999999999---------------------999971985303532--0
Q gi|254780750|r  633 PFIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALI---------------------VIMAQMGSYVPASYA--H  689 (920)
Q Consensus       633 ~fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~---------------------vilAQiG~fVPA~~a--~  689 (920)
                      .+|=+|++|..    ..+....|.|||-+||||++|.+.=.                     .+..++ +|||-+.-  .
T Consensus        17 ~~~L~~isl~i----~~G~~v~ivG~sGsGKSTLl~ll~gl~~p~~G~I~i~g~~~~~~~~~~~r~~i-~~v~Q~~~lf~   91 (220)
T cd03245          17 IPALDNVSLTI----RAGEKVAIIGRVGSGKSTLLKLLAGLYKPTSGSVLLDGTDIRQLDPADLRRNI-GYVPQDVTLFY   91 (220)
T ss_pred             CCCEECEEEEE----CCCCEEEEECCCCCHHHHHHHHHHCCCCCCCCEEEECCEEHHHHCHHHHHHCE-EEECCCCEEEC
T ss_conf             85153459998----79999999999998599999999672547865899999995772599997326-99916896766


Q ss_pred             CCCCCEEEEEEEC---CC-CCC-----CCCCHHHHHH----------------------HHHHHHHHHCCCCCEEEEECC
Q ss_conf             6822105676523---76-611-----3853289999----------------------999999995899856999325
Q gi|254780750|r  690 IGIVDKLFSRVGS---AD-NLA-----SGRSTFMVEM----------------------IETASILNQATNQSFVILDEI  738 (920)
Q Consensus       690 i~~~D~IftRiGa---~D-~l~-----~g~STF~vEm----------------------~e~~~IL~~at~~SLVllDEl  738 (920)
                      -++.+.|  ++|.   .| .+.     .|...|...+                      .-.|..|  +.+..++|+||-
T Consensus        92 ~Ti~eNi--~~~~~~~~~~~i~~~~~~~~l~~~i~~~~~g~~t~i~~~g~~LSgGqkQri~lARal--~~~~~ililDEp  167 (220)
T cd03245          92 GTLRDNI--TLGAPLADDERILRAAELAGVTDFVNKHPNGLDLQIGERGRGLSGGQRQAVALARAL--LNDPPILLLDEP  167 (220)
T ss_pred             CCHHHHH--HCCCCCCCHHHHHHHHHHHCCHHHHHHCCCCCCCCCCCCCCEECHHHHHHHHHHHHH--HCCCCEEEEECC
T ss_conf             7599985--357977897999999999597899973755434535899972189999999999999--559999999687


Q ss_pred             CCCCCHHHHHHHHHHHHHHHHHHC-CCEEEEECCCHHHHHHHHH
Q ss_conf             889880567999999999999726-9849997487579766430
Q gi|254780750|r  739 GRGTATLDGLSIAWATIEYLHETN-RCRGLLATHFHELTDLSKS  781 (920)
Q Consensus       739 GrGTst~DG~aiA~aile~l~~~~-~~~~lfaTHy~eL~~l~~~  781 (920)
                         ||..|-..- ..+++.|.+.. +..++++||-.++...++.
T Consensus       168 ---ts~LD~~~~-~~i~~~l~~~~~~~Tvi~itH~~~~~~~~D~  207 (220)
T cd03245         168 ---TSAMDMNSE-ERLKERLRQLLGDKTLIIITHRPSLLDLVDR  207 (220)
T ss_pred             ---CCCCCHHHH-HHHHHHHHHHCCCCEEEEEECCHHHHHHCCE
T ss_conf             ---568898999-9999999987699989999359889984999


No 116
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional
Probab=97.76  E-value=0.00043  Score=49.02  Aligned_cols=48  Identities=8%  Similarity=0.080  Sum_probs=31.0

Q ss_pred             CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHH
Q ss_conf             9985699932588988056799999999999972698499974875797
Q gi|254780750|r  728 TNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFHELT  776 (920)
Q Consensus       728 t~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~  776 (920)
                      .+--++|+||--.|=++.--.- -+.++..|.+..+..++++||.-+..
T Consensus       169 ~~P~iLllDEPta~LDp~~~~~-i~~~l~~l~~~~g~Til~vtHdl~~a  216 (262)
T PRK09984        169 QQAKVILADEPIASLDPESARI-VMDTLRDINQNDGITVVVTLHQVDYA  216 (262)
T ss_pred             CCCCEEEECCCCCCCCHHHHHH-HHHHHHHHHHHCCCEEEEECCCHHHH
T ss_conf             1999999838867799999999-99999999985497999988898999


No 117
>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed
Probab=97.75  E-value=0.00032  Score=49.93  Aligned_cols=142  Identities=23%  Similarity=0.244  Sum_probs=72.1

Q ss_pred             EEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCC---------CCCHHHCCCCCC---CEEEEEEE
Q ss_conf             444345635877776643999967784407899999999999997198---------530353206822---10567652
Q gi|254780750|r  634 FIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGS---------YVPASYAHIGIV---DKLFSRVG  701 (920)
Q Consensus       634 fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~---------fVPA~~a~i~~~---D~IftRiG  701 (920)
                      -+=+|++|..    ..+.+.-|.|||-+||||+||.++=+.-- .-|.         -+|++.-.++.+   ..+|-.+-
T Consensus        31 ~aL~~vsl~I----~~GE~~~llGpSGsGKSTLlr~iaGl~~p-~sG~I~~~G~~v~~~~~~~R~ig~VfQ~~aLfp~lT  105 (378)
T PRK09452         31 EVISNLDLTI----NNGEFLTLLGPSGCGKTTVLRLIAGFETP-DSGRIMLDGQDITHVPAENRYVNTVFQSYALFPHMT  105 (378)
T ss_pred             EEEECCEEEE----CCCCEEEEECCCCCHHHHHHHHHHCCCCC-CCEEEEECCEECCCCCHHHCCEEEEECCCCCCCCCC
T ss_conf             9993627799----99989999989997699999999769999-846999999998989978988589922764378986


Q ss_pred             CCCCCCCCC-----CHH-----HHHHH---HHHHHHH-------------------HCCCCCEEEEECCCCCCCHHHHHH
Q ss_conf             376611385-----328-----99999---9999999-------------------589985699932588988056799
Q gi|254780750|r  702 SADNLASGR-----STF-----MVEMI---ETASILN-------------------QATNQSFVILDEIGRGTATLDGLS  749 (920)
Q Consensus       702 a~D~l~~g~-----STF-----~vEm~---e~~~IL~-------------------~at~~SLVllDElGrGTst~DG~a  749 (920)
                      ..||+.-|.     +.=     ..|+.   .+...++                   -+.+-.++|+||--.+=++.--..
T Consensus       106 V~eNv~~~l~~~~~~~~e~~~rv~e~L~~v~L~~~~~r~p~~LSGGqqQRVaiARAL~~~P~vLLLDEPts~LD~~~r~~  185 (378)
T PRK09452        106 VFENVAFGLRMQKTPAAEITPRVMEALRMVQLEEFAQRKPHQLSGGQQQRVAIARAVVNKPKVLLLDESLSALDYKLRKQ  185 (378)
T ss_pred             HHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCEEEECCCCCCCCHHHHHH
T ss_conf             99999989976599879999999999875073435436835499889999999998623998999578644479999999


Q ss_pred             HHHHHHHHHHHHCCCEEEEECCCHHHH-HHHHH
Q ss_conf             999999999972698499974875797-66430
Q gi|254780750|r  750 IAWATIEYLHETNRCRGLLATHFHELT-DLSKS  781 (920)
Q Consensus       750 iA~aile~l~~~~~~~~lfaTHy~eL~-~l~~~  781 (920)
                      + +..+..|.+..+..++|+||..+.+ .+++.
T Consensus       186 ~-~~~l~~l~~~~g~T~i~VTHD~~eA~~laDr  217 (378)
T PRK09452        186 M-QNELKALQRKLGITFVFVTHDQEEALTMSDR  217 (378)
T ss_pred             H-HHHHHHHHHHHCCEEEEECCCHHHHHHHCCE
T ss_conf             9-9999999998499899998899999986998


No 118
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional
Probab=97.75  E-value=0.0013  Score=45.38  Aligned_cols=130  Identities=24%  Similarity=0.346  Sum_probs=69.9

Q ss_pred             EEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHH-----------------C-----CCCC
Q ss_conf             44345635877776643999967784407899999999999997198530353-----------------2-----0682
Q gi|254780750|r  635 IANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASY-----------------A-----HIGI  692 (920)
Q Consensus       635 VpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~-----------------a-----~i~~  692 (920)
                      |=+|+++..    ..+.+.-|.|||-+||||++|.++        |..-|.+-                 +     .++.
T Consensus        24 ~l~~vs~~i----~~GE~v~iiG~sGsGKSTLl~~i~--------Gl~~p~~G~I~~~g~~i~~~~~~~~~~~r~~~ig~   91 (233)
T PRK11629         24 VLHNVSFSI----GEGEMMAIVGSSGSGKSTLLHLLG--------GLDTPTSGDVIFNGQPMSKLSSAAKAELRNQKLGF   91 (233)
T ss_pred             EEECEEEEE----CCCCEEEEECCCCCCHHHHHHHHH--------CCCCCCCEEEEECCEECCCCCHHHHHHHHCCCEEE
T ss_conf             984628998----899899999999940999999996--------69999863999999998869988999873797899


Q ss_pred             C---CEEEEEEECCCCCCC-----CCCHH-----HHHHHHHHH---------------------HHH-HCCCCCEEEEEC
Q ss_conf             2---105676523766113-----85328-----999999999---------------------999-589985699932
Q gi|254780750|r  693 V---DKLFSRVGSADNLAS-----GRSTF-----MVEMIETAS---------------------ILN-QATNQSFVILDE  737 (920)
Q Consensus       693 ~---D~IftRiGa~D~l~~-----g~STF-----~vEm~e~~~---------------------IL~-~at~~SLVllDE  737 (920)
                      +   ..+|.++-..||+..     +.+.-     ..|+.|.-.                     |-+ -++.-.++|+||
T Consensus        92 v~Q~~~l~~~~tv~eni~~~l~~~~~~~~~~~~~~~~~l~~~gl~~~~~~~~~~LSGGqkQRvaiAraL~~~P~illlDE  171 (233)
T PRK11629         92 IYQFHHLLPDFTALENVAMPLLIGKKKPAEINSRALEMLKAVGLEHRANHRPSELSGGERQRVAIARALVNNPRLVLADE  171 (233)
T ss_pred             ECCCCCCCCCCCHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHHCCCCEECHHHHHHHHHHHHHHCCCCEEEEEC
T ss_conf             91675237786699999889998499999999989999987273667749846638999999999999965999999928


Q ss_pred             CCCCCCHHHHHHH--HHHHHHHHHHHCCCEEEEECCCHHHHHHH
Q ss_conf             5889880567999--99999999972698499974875797664
Q gi|254780750|r  738 IGRGTATLDGLSI--AWATIEYLHETNRCRGLLATHFHELTDLS  779 (920)
Q Consensus       738 lGrGTst~DG~ai--A~aile~l~~~~~~~~lfaTHy~eL~~l~  779 (920)
                      -   |+..|..+-  -+.++..+.+..+...+|+||..++....
T Consensus       172 P---Ts~LD~~~~~~i~~~l~~l~~~~g~tvi~vtHdl~~a~~~  212 (233)
T PRK11629        172 P---TGNLDARNADSIFQLLGELNRLQGTAFLVVTHDLQLAKRM  212 (233)
T ss_pred             C---CCCCCHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHH
T ss_conf             8---8879999999999999999997098999986899999960


No 119
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system.  Phosphonates are a class of organophosphorus compounds characterized by a chemically stable carbon-to-phosphorus (C-P) bond.  Phosphonates are widespread among naturally occurring compounds in all kingdoms of wildlife, but only procaryotic microorganisms are able to cleave this bond.  Certain bacteria such as E. coli can use alkylphosphonates as a phosphorus source.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=97.75  E-value=0.00021  Score=51.35  Aligned_cols=34  Identities=41%  Similarity=0.490  Sum_probs=27.1

Q ss_pred             EEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHH
Q ss_conf             44345635877776643999967784407899999999
Q gi|254780750|r  635 IANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNAL  672 (920)
Q Consensus       635 VpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval  672 (920)
                      |=+||++..    ..+.+.-|-|||-+||||+||.++-
T Consensus        16 ~L~~isl~i----~~Ge~~~iiGpsGsGKSTLl~~i~g   49 (241)
T cd03256          16 ALKDVSLSI----NPGEFVALIGPSGAGKSTLLRCLNG   49 (241)
T ss_pred             EEECCEEEE----CCCCEEEEECCCCCHHHHHHHHHHC
T ss_conf             997838899----9998999999998339999999974


No 120
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional
Probab=97.75  E-value=0.0011  Score=45.89  Aligned_cols=138  Identities=22%  Similarity=0.265  Sum_probs=72.7

Q ss_pred             EEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHC------CCCCCHH--------HCCCCCC---CEEE
Q ss_conf             443456358777766439999677844078999999999999971------9853035--------3206822---1056
Q gi|254780750|r  635 IANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQM------GSYVPAS--------YAHIGIV---DKLF  697 (920)
Q Consensus       635 VpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQi------G~fVPA~--------~a~i~~~---D~If  697 (920)
                      |=+|+++..    ..+.+.-|.|||-+||||++|.++=+.- ..-      |--+|.-        ...++.+   ..+|
T Consensus        23 vL~~is~~i----~~Gei~~iiGpnGsGKSTLlk~i~Gl~~-p~~G~I~~~G~~i~~~~~~~~~~~r~~i~~v~Q~~~l~   97 (269)
T PRK11831         23 IFDNISLTV----PRGKITAIMGPSGIGKTTLLRLIGGQIA-PDHGEILFDGENIPAMSRSRLYTVRKRMSMLFQSGALF   97 (269)
T ss_pred             EEECCEEEE----CCCCEEEEECCCCCHHHHHHHHHHCCCC-CCCCEEEECCEECCCCCHHHHHHHHHCEEEECCCCCCC
T ss_conf             994716688----7998999993999759999999967988-89866999998887658878998761468985376326


Q ss_pred             EEEECCCCCCCCC-----------------------------------CHHHHHHHHHHHHHHHCCCCCEEEEECCCCCC
Q ss_conf             7652376611385-----------------------------------32899999999999958998569993258898
Q gi|254780750|r  698 SRVGSADNLASGR-----------------------------------STFMVEMIETASILNQATNQSFVILDEIGRGT  742 (920)
Q Consensus       698 tRiGa~D~l~~g~-----------------------------------STF~vEm~e~~~IL~~at~~SLVllDElGrGT  742 (920)
                      ..+-..||+.-+.                                   |-=+--...+|..|  +.+-.++|+||-..|-
T Consensus        98 ~~ltv~eni~~~l~~~~~~~~~~~~~~v~~~Le~~gL~~~~~~~~~~LSGGq~QRv~iAraL--~~~P~iLlLDEPtsgL  175 (269)
T PRK11831         98 TDMNVFDNVAYPLREHTQLPAPLLHSTVMMKLEAVGLRGAAKLMPSELSGGMARRAALARAI--ALEPDLIMFDEPFVGQ  175 (269)
T ss_pred             CCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHHCCCCCCCHHHHHHHHHHHHH--HCCCCEEEECCCCCCC
T ss_conf             78859999989999955899999999999999861765456388231899999999999999--7599999982875679


Q ss_pred             CHHHHHHHHHHHHHHHHHHCCCEEEEECCCH-HHHHHHH
Q ss_conf             8056799999999999972698499974875-7976643
Q gi|254780750|r  743 ATLDGLSIAWATIEYLHETNRCRGLLATHFH-ELTDLSK  780 (920)
Q Consensus       743 st~DG~aiA~aile~l~~~~~~~~lfaTHy~-eL~~l~~  780 (920)
                      ++..-..| +.++..|.+..+..++++||.- +...+++
T Consensus       176 D~~~~~~i-~~li~~l~~~~g~TiiivtHdl~~v~~iaD  213 (269)
T PRK11831        176 DPITMGVL-VKLISELNSALGVTCVVVSHDVPEVLSIAD  213 (269)
T ss_pred             CHHHHHHH-HHHHHHHHHHCCCEEEEECCCHHHHHHHCC
T ss_conf             99999999-999999998529899998649899998699


No 121
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional
Probab=97.74  E-value=0.00058  Score=48.04  Aligned_cols=49  Identities=14%  Similarity=0.070  Sum_probs=33.3

Q ss_pred             CCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHH
Q ss_conf             899856999325889880567999999999999726984999748757976
Q gi|254780750|r  727 ATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFHELTD  777 (920)
Q Consensus       727 at~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~~  777 (920)
                      +.+-.++|+||--.|-++.--..| +.++..|.+. +.-++|+||.-+...
T Consensus       168 ~~~P~lLllDEPts~LD~~~~~~i-~~ll~~l~~~-g~tii~vtHdl~~~~  216 (257)
T PRK10619        168 AMEPEVLLFDEPTSALDPELVGEV-LRIMQQLAEE-GKTMVVVTHEMGFAR  216 (257)
T ss_pred             HCCCCEEEECCCCCCCCHHHHHHH-HHHHHHHHHC-CCEEEEECCCHHHHH
T ss_conf             639989997688665898999999-9999999975-999999948999999


No 122
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE. Members of this protein family are ABC transporter ATP-binding subunits associated with urea transport and metabolism. This protein is found in a conserved five-gene transport operon typically found adjacent to urease genes. It was shown in Cyanobacteria that disruption leads to the loss of high-affinity urea transport activity.
Probab=97.74  E-value=0.00037  Score=49.52  Aligned_cols=133  Identities=25%  Similarity=0.318  Sum_probs=73.3

Q ss_pred             EEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCH-----------------HHCCCCC-----
Q ss_conf             443456358777766439999677844078999999999999971985303-----------------5320682-----
Q gi|254780750|r  635 IANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPA-----------------SYAHIGI-----  692 (920)
Q Consensus       635 VpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA-----------------~~a~i~~-----  692 (920)
                      |=+|+++..    ..+.+.-|-|||-+||||++|.+        +|.+-|-                 +.++.++     
T Consensus        15 ~L~~vs~~v----~~Gei~~liGpNGaGKSTL~~~i--------~Gl~~p~~G~I~~~G~~i~~~~~~~~~r~gig~v~Q   82 (230)
T TIGR03410        15 ILRGVSLEV----PKGEVTCVLGRNGVGKTTLLKTL--------MGLLPVKSGSIRLDGEDITKLPPHERARAGIAYVPQ   82 (230)
T ss_pred             EECCEEEEE----CCCCEEEEECCCCCHHHHHHHHH--------HCCCCCCCEEEEECCEECCCCCHHHHHHCCEEEECC
T ss_conf             888717799----99979999999994099999999--------779999954999999999999989999829599377


Q ss_pred             CCEEEEEEECCCCCCCCCCHH-------HHHHHHHHHHHH-----------------------HCCCCCEEEEECCCCCC
Q ss_conf             210567652376611385328-------999999999999-----------------------58998569993258898
Q gi|254780750|r  693 VDKLFSRVGSADNLASGRSTF-------MVEMIETASILN-----------------------QATNQSFVILDEIGRGT  742 (920)
Q Consensus       693 ~D~IftRiGa~D~l~~g~STF-------~vEm~e~~~IL~-----------------------~at~~SLVllDElGrGT  742 (920)
                      -..+|.++-..+|+.-|...+       .-++.|.-.+|.                       -++.-.++|+||--.|=
T Consensus        83 ~~~lf~~lTV~Enl~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~r~~~~LSGGq~Qrv~iAraL~~~P~lLlLDEPt~gL  162 (230)
T TIGR03410        83 GREIFPRLTVEENLLTGLAALPRRSRKIPDEIYELFPVLKEMLGRRGGDLSGGQQQQLAIARALVTRPKLLLLDEPTEGI  162 (230)
T ss_pred             CCCCCCCCCHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHCCHHHCCHHHHHHHHHHHHHHCCCCEEEEECCCCCC
T ss_conf             74257678899999999987496678899999999999999983851119999999999999996299889993852269


Q ss_pred             CHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHH-HHHH
Q ss_conf             8056799999999999972698499974875797-6643
Q gi|254780750|r  743 ATLDGLSIAWATIEYLHETNRCRGLLATHFHELT-DLSK  780 (920)
Q Consensus       743 st~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~-~l~~  780 (920)
                      ++..-..| |.++..|.+..++-++++||.-+.. .+++
T Consensus       163 D~~~~~~i-~~~i~~l~~~~g~tvl~vtH~l~~~~~~ad  200 (230)
T TIGR03410       163 QPSIIKDI-GRVIRRLRAEGGMAILLVEQYLDFARELAD  200 (230)
T ss_pred             CHHHHHHH-HHHHHHHHHCCCCEEEEEECCHHHHHHHCC
T ss_conf             99999999-999999997179899999088899999699


No 123
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional
Probab=97.74  E-value=0.0011  Score=45.95  Aligned_cols=132  Identities=27%  Similarity=0.286  Sum_probs=69.4

Q ss_pred             EEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHCCCCCCCE-----------------EE
Q ss_conf             4434563587777664399996778440789999999999999719853035320682210-----------------56
Q gi|254780750|r  635 IANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHIGIVDK-----------------LF  697 (920)
Q Consensus       635 VpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a~i~~~D~-----------------If  697 (920)
                      |=+|++|..    ..+.+.-|-|||-+||||+||.++        |..-| ++-++.+.++                 +|
T Consensus        16 ~L~dvsl~i----~~Ge~~~lvGpnGaGKSTLl~~i~--------Gl~~p-~~G~I~~~G~~i~~~~~~~g~vfQ~~~l~   82 (255)
T PRK11248         16 ALEDINLTL----ESGELLVVLGPSGCGKTTLLNLIA--------GFVPP-QHGSITLDGKPVEGPGAERGVVFQNEGLL   82 (255)
T ss_pred             EEECEEEEE----CCCCEEEEECCCCCHHHHHHHHHH--------CCCCC-CCCEEEECCCCCCCCCHHCEEEECCCCCC
T ss_conf             881317798----699899999999846999999997--------59988-99718579964788621106994557547


Q ss_pred             EEEECCCCCCCCCCHH---HHHHHHHH-HHH----------------------------HHCCCCCEEEEECCCCCCCHH
Q ss_conf             7652376611385328---99999999-999----------------------------958998569993258898805
Q gi|254780750|r  698 SRVGSADNLASGRSTF---MVEMIETA-SIL----------------------------NQATNQSFVILDEIGRGTATL  745 (920)
Q Consensus       698 tRiGa~D~l~~g~STF---~vEm~e~~-~IL----------------------------~~at~~SLVllDElGrGTst~  745 (920)
                      -..-..||+.-+.--.   -.|..+.+ .+|                            --++.-.++|+||--.|=++.
T Consensus        83 p~~tv~env~~~l~~~g~~~~~~~~~~~~~L~~vgL~~~~~~~p~~LSGGqkQRVaiArAL~~~P~iLllDEPt~~LD~~  162 (255)
T PRK11248         83 PWRNVQDNVAFGLQLAGVEKMQRLEIAHQMLKKVGLEGAEKRYIWQLSGGQRQRVGIARALAANPQLLLLDEPFGALDAF  162 (255)
T ss_pred             CCCCHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHCCCHHHCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCHH
T ss_conf             56879999998998748987899999999999769902441893349999999999999997299999980887779989


Q ss_pred             HHHHHHHHHHHHHHHHCCCEEEEECCCHHHH-HHHH
Q ss_conf             6799999999999972698499974875797-6643
Q gi|254780750|r  746 DGLSIAWATIEYLHETNRCRGLLATHFHELT-DLSK  780 (920)
Q Consensus       746 DG~aiA~aile~l~~~~~~~~lfaTHy~eL~-~l~~  780 (920)
                      --..+ +..+..|.+..+.-++|+||.-+.+ .+++
T Consensus       163 ~r~~l-~~ll~~l~~~~g~Til~vTHdl~ea~~lad  197 (255)
T PRK11248        163 TREQM-QELLLKLWQETGKQVLLITHDIEEAVFMAT  197 (255)
T ss_pred             HHHHH-HHHHHHHHHHCCCEEEEECCCHHHHHHHCC
T ss_conf             99999-999999999619999998868999999699


No 124
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import.  Responsible for energy coupling to the transport system.  The complex is composed of two ATP-binding proteins (cysA), two transmembrane proteins (cysT and cysW), and a solute-binding protein (cysP).  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=97.73  E-value=0.0004  Score=49.21  Aligned_cols=132  Identities=23%  Similarity=0.277  Sum_probs=73.4

Q ss_pred             EEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHCCCCCCC--------------------
Q ss_conf             443456358777766439999677844078999999999999971985303532068221--------------------
Q gi|254780750|r  635 IANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHIGIVD--------------------  694 (920)
Q Consensus       635 VpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a~i~~~D--------------------  694 (920)
                      |=+|+++..    ..+.+..|.|||-+||||++|.++=+        .=| ++-++-+-+                    
T Consensus        17 ~l~~is~~v----~~Ge~~~iiGpSGsGKSTll~~i~Gl--------~~p-~~G~I~~~g~~i~~~~~~~r~ig~vfQ~~   83 (239)
T cd03296          17 ALDDVSLDI----PSGELVALLGPSGSGKTTLLRLIAGL--------ERP-DSGTILFGGEDATDVPVQERNVGFVFQHY   83 (239)
T ss_pred             EECCCEEEE----CCCCEEEEECCCCCHHHHHHHHHHCC--------CCC-CCEEEEECCEECCCCCHHHCCEEEECCCC
T ss_conf             986638698----89989999999997799999999769--------999-86399999999999996567767981782


Q ss_pred             EEEEEEECCCCCCCCC------C---HH--------HHHHHHHHHHH------------------H-HCCCCCEEEEECC
Q ss_conf             0567652376611385------3---28--------99999999999------------------9-5899856999325
Q gi|254780750|r  695 KLFSRVGSADNLASGR------S---TF--------MVEMIETASIL------------------N-QATNQSFVILDEI  738 (920)
Q Consensus       695 ~IftRiGa~D~l~~g~------S---TF--------~vEm~e~~~IL------------------~-~at~~SLVllDEl  738 (920)
                      .+|-.+-..||+.-|.      +   .=        ..|+.+.+..+                  | -|.+-.++|+||-
T Consensus        84 ~Lfp~ltV~eNi~~~l~~~~~~~~~~~~e~~~rv~~~l~~v~l~~~~~~~p~eLSGGq~QRVaiARAl~~~P~vlllDEP  163 (239)
T cd03296          84 ALFRHMTVFDNVAFGLRVKPRSERPPEAEIRAKVHELLKLVQLDWLADRYPAQLSGGQRQRVALARALAVEPKVLLLDEP  163 (239)
T ss_pred             CCCCCCCHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHCCCHHHHHCCHHHCCHHHHHHHHHHHHHHCCCCEEEECCC
T ss_conf             10679969999987997335456998999999999998654997677489666999898999999987649998997388


Q ss_pred             CCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHH-HHHH
Q ss_conf             88988056799999999999972698499974875797-6643
Q gi|254780750|r  739 GRGTATLDGLSIAWATIEYLHETNRCRGLLATHFHELT-DLSK  780 (920)
Q Consensus       739 GrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~-~l~~  780 (920)
                      -.|=++.-...| +..+..|.+..+..++|+||..+.+ .+++
T Consensus       164 ~s~LD~~~~~~i-~~~l~~l~~e~~~T~i~vTHd~~~a~~laD  205 (239)
T cd03296         164 FGALDAKVRKEL-RRWLRRLHDELHVTTVFVTHDQEEALEVAD  205 (239)
T ss_pred             CCCCCHHHHHHH-HHHHHHHHHHHCCEEEEECCCHHHHHHHCC
T ss_conf             664699999999-999999999859989999889999999699


No 125
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK.  ATP binding cassette (ABC) proteins function from bacteria to human, mediating the translocation of substances into and out of cells or organelles.  ABC transporters contain two transmembrane-spanning domains (TMDs) or subunits and two nucleotide binding domains (NBDs) or subunits that couple transport to the hydrolysis of ATP.  In the maltose transport system, the periplasmic maltose binding protein (MBP) stimulates the ATPase activity of the membrane-associated transporter, which consists of two transmembrane subunits, MalF and MalG, and two copies of the ATP binding subunit, MalK, and becomes tightly bound to the transporter in the catalytic transition state, ensuring that maltose is passed to the transporter as ATP is hydrolyzed.
Probab=97.73  E-value=0.0004  Score=49.23  Aligned_cols=134  Identities=21%  Similarity=0.255  Sum_probs=71.5

Q ss_pred             EEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHCCC----------CCCC---------
Q ss_conf             444345635877776643999967784407899999999999997198530353206----------8221---------
Q gi|254780750|r  634 FIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHI----------GIVD---------  694 (920)
Q Consensus       634 fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a~i----------~~~D---------  694 (920)
                      .|=+|++|..    ..+.+..|-||+-+||||+||.++        |..=| ++-++          ++-+         
T Consensus        14 ~~l~~isl~v----~~Ge~~~i~GpSG~GKSTlLr~ia--------Gl~~p-~~G~I~~~g~~i~~~~~~~R~ig~VfQ~   80 (213)
T cd03301          14 TALDDLNLDI----ADGEFVVLLGPSGCGKTTTLRMIA--------GLEEP-TSGRIYIGGRDVTDLPPKDRDIAMVFQN   80 (213)
T ss_pred             EEECCCEEEE----CCCCEEEEECCCCCHHHHHHHHHH--------CCCCC-CCEEEEECCEECCCCCHHHCCEEEEECC
T ss_conf             9987617798----699899999999880999999997--------69999-8639999999999999767887899458


Q ss_pred             -EEEEEEECCCCCCCC-----CCHH--------HHHHHHHHHH------------------HH-HCCCCCEEEEECCCCC
Q ss_conf             -056765237661138-----5328--------9999999999------------------99-5899856999325889
Q gi|254780750|r  695 -KLFSRVGSADNLASG-----RSTF--------MVEMIETASI------------------LN-QATNQSFVILDEIGRG  741 (920)
Q Consensus       695 -~IftRiGa~D~l~~g-----~STF--------~vEm~e~~~I------------------L~-~at~~SLVllDElGrG  741 (920)
                       .+|-.+-..|||.-|     .+.=        +.|+......                  -| -+++-.++|+||--.+
T Consensus        81 ~~LfP~ltV~eNI~~~l~~~~~~~~e~~~~v~~~l~~~gl~~~~~~~P~~LSGGqkQRVaiARAl~~~P~lLLlDEP~sa  160 (213)
T cd03301          81 YALYPHMTVYDNIAFGLKLRKVPKDEIDERVREVAELLQIEHLLDRKPKQLSGGQRQRVALGRAIVREPKVFLMDEPLSN  160 (213)
T ss_pred             CCCCCCCCHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHCCCHHHCCHHHHHHHHHHHHHHCCCCEEEECCCCCC
T ss_conf             76465470999999899985999899999999999875992465099556999999999999998759998998388764


Q ss_pred             CCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHH-HHHHH
Q ss_conf             88056799999999999972698499974875797-66430
Q gi|254780750|r  742 TATLDGLSIAWATIEYLHETNRCRGLLATHFHELT-DLSKS  781 (920)
Q Consensus       742 Tst~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~-~l~~~  781 (920)
                      =++.-...| ...+..+.+..+..++|+||..+-+ .+++.
T Consensus       161 LD~~~r~~i-~~~l~~~~~~~~~T~i~vTHd~~ea~~l~dr  200 (213)
T cd03301         161 LDAKLRVQM-RAELKRLQQRLGTTTIYVTHDQVEAMTMADR  200 (213)
T ss_pred             CCHHHHHHH-HHHHHHHHHHHCCEEEEECCCHHHHHHHCCE
T ss_conf             298999999-9999999997499899999998999996998


No 126
>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor.  The ABC ATPase, RNase L inhibitor (RLI), is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids.  RLI s are not transport proteins and thus cluster with a group of soluble proteins that lack the transmembrane components commonly found in other members of the family.  Structurally, RLIs have an N-terminal Fe-S domain and two nucleotide binding domains which are arranged to form two composite active sites in their interface cleft.  RLI is one of the most conserved enzymes between archaea and eukaryotes with a sequence identity more than 48%.  The high degree of evolutionary conservation suggests that RLI performs a central role in archaeal and eukaryotic physiology.
Probab=97.73  E-value=0.00062  Score=47.82  Aligned_cols=48  Identities=21%  Similarity=0.066  Sum_probs=31.7

Q ss_pred             CCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHH
Q ss_conf             89985699932588988056799999999999972698499974875797
Q gi|254780750|r  727 ATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFHELT  776 (920)
Q Consensus       727 at~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~  776 (920)
                      +..-.++|+||--.|=++.. ..-.+.++..|.+. +-.++++||.-...
T Consensus       155 ~~~P~iLlLDEPTs~LD~~~-~~~v~~li~~L~~~-G~Tvi~vtHDl~~~  202 (255)
T cd03236         155 ARDADFYFFDEPSSYLDIKQ-RLNAARLIRELAED-DNYVLVVEHDLAVL  202 (255)
T ss_pred             CCCCCEEEEECCCCCCCHHH-HHHHHHHHHHHHHC-CCEEEEECCCHHHH
T ss_conf             68999999979876589999-99999999999978-99999990789999


No 127
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional
Probab=97.73  E-value=0.00035  Score=49.72  Aligned_cols=131  Identities=24%  Similarity=0.325  Sum_probs=71.5

Q ss_pred             EEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHCCCCCCC--------------------
Q ss_conf             443456358777766439999677844078999999999999971985303532068221--------------------
Q gi|254780750|r  635 IANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHIGIVD--------------------  694 (920)
Q Consensus       635 VpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a~i~~~D--------------------  694 (920)
                      +=+|++|..    ..+.+.-|-|||-+||||+||.++=+         .+.++-++-+.+                    
T Consensus        19 al~~vsl~i----~~Ge~~~llGpsG~GKTTllr~iaGl---------~~p~~G~I~~~g~~v~~~~~~~R~i~~vfQ~~   85 (358)
T PRK11650         19 VIKGIDLDV----ADGEFIVLVGPSGCGKSTLLRMVAGL---------ERITSGEIWIGGRVVNELEPADRDIAMVFQNY   85 (358)
T ss_pred             EEECCEEEE----CCCCEEEEECCCCCHHHHHHHHHHCC---------CCCCCEEEEECCEECCCCCHHHCCEEEECCCC
T ss_conf             982527798----89989999999863699999999769---------99886299999999999997787576772555


Q ss_pred             EEEEEEECCCCCCCC-----CCHH--------HHHHHHHHHHHH-------------------HCCCCCEEEEECCCCCC
Q ss_conf             056765237661138-----5328--------999999999999-------------------58998569993258898
Q gi|254780750|r  695 KLFSRVGSADNLASG-----RSTF--------MVEMIETASILN-------------------QATNQSFVILDEIGRGT  742 (920)
Q Consensus       695 ~IftRiGa~D~l~~g-----~STF--------~vEm~e~~~IL~-------------------~at~~SLVllDElGrGT  742 (920)
                      .+|-.+-..||+.-+     .|.=        +.|+.++...++                   -+.+-.++|+||-   |
T Consensus        86 ~L~p~ltV~eni~~~l~~~~~~~~~~~~rv~~~l~~l~l~~~~~r~p~~LSGGq~QRvalARAL~~~P~vlllDEP---~  162 (358)
T PRK11650         86 ALYPHMSVRENMAYGLKIRGMPKAEIEERVAEAARILELEPLLDRKPRELSGGQRQRVAMGRAIVREPAVFLFDEP---L  162 (358)
T ss_pred             CCCCCCCHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHCCCCHHHCCHHHCCHHHHHHHHHHHHHHCCCCEEEECCC---C
T ss_conf             4487874878665578762886467889999998752262422489747895678999983575049986887388---7


Q ss_pred             CHHHHH--HHHHHHHHHHHHHCCCEEEEECCCHHHH-HHHHH
Q ss_conf             805679--9999999999972698499974875797-66430
Q gi|254780750|r  743 ATLDGL--SIAWATIEYLHETNRCRGLLATHFHELT-DLSKS  781 (920)
Q Consensus       743 st~DG~--aiA~aile~l~~~~~~~~lfaTHy~eL~-~l~~~  781 (920)
                      |..|-.  .--+..+..|++..+..++|+||..+-+ .+++.
T Consensus       163 s~LD~~~r~~~~~~l~~l~~~~g~T~i~vTHd~~eA~~laDr  204 (358)
T PRK11650        163 SNLDAKLRVQMRLEIQRLHRRLGTTSLYVTHDQVEAMTLADR  204 (358)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHCCEEEEEECCHHHHHHHCCE
T ss_conf             767998999999999999997597799998999999986999


No 128
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component.  The biological function of this family is not well characterized, but display ABC domains similar to members of ABCA subfamily.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=97.71  E-value=0.001  Score=46.17  Aligned_cols=47  Identities=21%  Similarity=0.213  Sum_probs=30.7

Q ss_pred             CCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHH
Q ss_conf             89985699932588988056799999999999972698499974875797
Q gi|254780750|r  727 ATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFHELT  776 (920)
Q Consensus       727 at~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~  776 (920)
                      +..-.++|+||--.|=++.--..+ |..+..+. . +...+++||+-+-.
T Consensus       146 ~~~P~lliLDEPt~gLDp~~~~~~-~~ll~~l~-~-~~tii~stH~l~e~  192 (211)
T cd03264         146 VGDPSILIVDEPTAGLDPEERIRF-RNLLSELG-E-DRIVILSTHIVEDV  192 (211)
T ss_pred             HCCCCEEEEECCCCCCCHHHHHHH-HHHHHHHC-C-CCEEEEECCCHHHH
T ss_conf             289999999489767899999999-99999972-9-98999989988999


No 129
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed
Probab=97.70  E-value=0.00022  Score=51.22  Aligned_cols=134  Identities=20%  Similarity=0.229  Sum_probs=66.0

Q ss_pred             EEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHCCCCCCCEEEEEEEC----CCCCCCC
Q ss_conf             444345635877776643999967784407899999999999997198530353206822105676523----7661138
Q gi|254780750|r  634 FIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHIGIVDKLFSRVGS----ADNLASG  709 (920)
Q Consensus       634 fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a~i~~~D~IftRiGa----~D~l~~g  709 (920)
                      .+=+|+++..    ..+..+-|.|||-+||||+||.++=. +-..-|...-....+++-||+-.-.+-.    .+++..|
T Consensus       338 ~ll~~vs~~i----~~Ge~iaivG~NGsGKSTLlk~l~G~-~~p~~G~i~~g~~v~igy~~Q~~~~l~~~~tv~e~v~~~  412 (556)
T PRK11819        338 LLIDDLSFKL----PPGGIVGIIGPNGAGKSTLFKMITGQ-EQPDSGTIKIGETVKLAYVDQSRDALDPNKTVWEEISGG  412 (556)
T ss_pred             EEEEEECCCC----CCCCEEEEECCCCCCHHHHHHHHHCC-CCCCCCEEEECCCCCCCCCCHHHHHCCCCCCHHHHHHCH
T ss_conf             7887640235----78824789889877588999998386-568885599899665032212054269768499987452


Q ss_pred             CCH----------------H---------------HHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             532----------------8---------------999999999999589985699932588988056799999999999
Q gi|254780750|r  710 RST----------------F---------------MVEMIETASILNQATNQSFVILDEIGRGTATLDGLSIAWATIEYL  758 (920)
Q Consensus       710 ~ST----------------F---------------~vEm~e~~~IL~~at~~SLVllDElGrGTst~DG~aiA~aile~l  758 (920)
                      ...                |               .-|-..++-..--+++--|.|+||-   |+-.|=.++ .|+-+.|
T Consensus       413 ~~~~~~~~~e~~~r~~L~~f~~~~~~~~~~v~~LSGGek~Rv~lA~~l~~~p~lLiLDEP---Tn~LDi~s~-e~Le~aL  488 (556)
T PRK11819        413 LDIIKVGNREIPSRAYVGRFNFKGGDQQKKVGVLSGGERNRLHLAKTLKSGGNVLLLDEP---TNDLDVETL-RALEDAL  488 (556)
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCHHHCCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECC---CCCCCHHHH-HHHHHHH
T ss_conf             666542167789999998707872455197031889999999999999629898999297---756799999-9999999


Q ss_pred             HHHCCCEEEEECCCHHHHH
Q ss_conf             9726984999748757976
Q gi|254780750|r  759 HETNRCRGLLATHFHELTD  777 (920)
Q Consensus       759 ~~~~~~~~lfaTHy~eL~~  777 (920)
                      .+-.|+ +||++|...+.+
T Consensus       489 ~~y~Gt-vl~VSHDr~fi~  506 (556)
T PRK11819        489 LEFPGC-AVVISHDRWFLD  506 (556)
T ss_pred             HHCCCE-EEEEECCHHHHH
T ss_conf             877996-999978999999


No 130
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional
Probab=97.70  E-value=0.00045  Score=48.90  Aligned_cols=153  Identities=24%  Similarity=0.259  Sum_probs=80.8

Q ss_pred             CCCCCEEECCCCCHHHHHHHHHCCCCCEEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHH
Q ss_conf             47871400004680588763102877044434563587777664399996778440789999999999999719853035
Q gi|254780750|r  607 DNSTNFIVKDGRHPIVEKTLKQQSSKPFIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPAS  686 (920)
Q Consensus       607 ~~~~~l~i~~gRHPviE~~l~~~~~~~fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~  686 (920)
                      ++++.+.+++..+-         -+..-+=+|++|..    ..+.+..|-||+-+||||+||.+|        |..-|.+
T Consensus         2 ~~~~~i~~~~lsk~---------yg~~~al~~vsl~i----~~Ge~~~llGpSG~GKTTlLr~ia--------Gl~~p~~   60 (351)
T PRK11432          2 SNKNFVVLKNITKR---------FGKNTVIDNLDLTI----KQGTMVTLLGPSGCGKTTVLRLVA--------GLEKPTS   60 (351)
T ss_pred             CCCCEEEEEEEEEE---------ECCEEEECCCEEEE----CCCCEEEEECCCCCHHHHHHHHHH--------CCCCCCC
T ss_conf             99976999647999---------89948984457498----899899999999649999999997--------6999883


Q ss_pred             ----------------HCCCCCC---CEEEEEEECCCCCCCCC-----CHH-----HHHHHH---HHHHH----------
Q ss_conf             ----------------3206822---10567652376611385-----328-----999999---99999----------
Q gi|254780750|r  687 ----------------YAHIGIV---DKLFSRVGSADNLASGR-----STF-----MVEMIE---TASIL----------  724 (920)
Q Consensus       687 ----------------~a~i~~~---D~IftRiGa~D~l~~g~-----STF-----~vEm~e---~~~IL----------  724 (920)
                                      .-.++.+   -.+|-.+-..||+.-|.     +.=     ..|+.+   +..++          
T Consensus        61 G~I~~~g~~v~~~~~~~R~i~~VfQ~~aLfPh~tV~eNi~~~l~~~~~~~~e~~~rv~e~l~~v~L~~~~~r~P~~LSGG  140 (351)
T PRK11432         61 GQIFIDGEDVTKRSIQQRDICMVFQSYALFPHMSLGENVGYGLKMLGVPKEERKQRVKEALELVDLAGFEDRYVDQISGG  140 (351)
T ss_pred             EEEEECCEECCCCCHHHCCEEEEECCCCCCCCCCHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCCHHHCCHHHCCHH
T ss_conf             69999999999999545886999448876766809999977998759999999999999997649966145895578998


Q ss_pred             --------H-HCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHH-HHHHH
Q ss_conf             --------9-589985699932588988056799999999999972698499974875797-66430
Q gi|254780750|r  725 --------N-QATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFHELT-DLSKS  781 (920)
Q Consensus       725 --------~-~at~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~-~l~~~  781 (920)
                              | -+.+-+++|+||--.+=++.=-..+ +.-+..|++..+..++|+||..+-+ .+++.
T Consensus       141 q~QRValARAL~~~P~vlLlDEP~s~LD~~lR~~~-~~~l~~l~~~~~~T~i~VTHD~~EA~~laDr  206 (351)
T PRK11432        141 QQQRVALARALVLKPKVLLFDEPLSNLDANLRRSM-REKIRELQQQFNITSLYVTHDQSEAFAVSDT  206 (351)
T ss_pred             HHHHHHHHHHHHCCCCEEEECCCCCCCCHHHHHHH-HHHHHHHHHHHCCEEEEECCCHHHHHHHCCE
T ss_conf             99999999998449989998687543699999999-9999999998699999999998999986999


No 131
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=97.69  E-value=0.00014  Score=52.61  Aligned_cols=130  Identities=25%  Similarity=0.243  Sum_probs=66.2

Q ss_pred             EEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHCCCCCCCE-----------------EE
Q ss_conf             4434563587777664399996778440789999999999999719853035320682210-----------------56
Q gi|254780750|r  635 IANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHIGIVDK-----------------LF  697 (920)
Q Consensus       635 VpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a~i~~~D~-----------------If  697 (920)
                      |=+|++|..    ..+.+..|.|||-+||||+||.++=        ..-| ++-++.+..+                 +|
T Consensus        19 al~~vsl~i----~~Ge~~~iiGpsGsGKSTLl~~i~G--------l~~p-~~G~I~~~G~~i~~~~~~ig~vfQ~~~L~   85 (220)
T cd03293          19 ALEDISLSV----EEGEFVALVGPSGCGKSTLLRIIAG--------LERP-TSGEVLVDGEPVTGPGPDRGYVFQQDALL   85 (220)
T ss_pred             EEECEEEEE----CCCCEEEEECCCCCHHHHHHHHHHC--------CCCC-CCCEEEECCEECCCCCCCEEEEECCCCCC
T ss_conf             996718898----7998999999999579999999975--------9998-87389999996788898879992488537


Q ss_pred             EEEECCCCCCCC-----CCHHHHHHHH-HHHHHH----------------------------HCCCCCEEEEECCCCCCC
Q ss_conf             765237661138-----5328999999-999999----------------------------589985699932588988
Q gi|254780750|r  698 SRVGSADNLASG-----RSTFMVEMIE-TASILN----------------------------QATNQSFVILDEIGRGTA  743 (920)
Q Consensus       698 tRiGa~D~l~~g-----~STF~vEm~e-~~~IL~----------------------------~at~~SLVllDElGrGTs  743 (920)
                      -.+-..+|+.-+     .+.  .|..+ +..+|+                            -+.+-.++|+||--.|=+
T Consensus        86 p~~tv~eni~~~l~~~~~~~--~~~~~~v~~~l~~~gL~~~~~~~p~~LSGGqkQRvaiARaL~~~P~llllDEPts~LD  163 (220)
T cd03293          86 PWLTVLDNVALGLELQGVPK--AEARERAEELLELVGLSGFENAYPHQLSGGMRQRVALARALAVDPDVLLLDEPFSALD  163 (220)
T ss_pred             CCCCHHHHHHHHHHHCCCCH--HHHHHHHHHHHHHCCCHHHHHCCHHHCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCC
T ss_conf             78879999988998659998--9999999999998789547618931299999999999999866999999808876569


Q ss_pred             HHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHH-HHHH
Q ss_conf             056799999999999972698499974875797-6643
Q gi|254780750|r  744 TLDGLSIAWATIEYLHETNRCRGLLATHFHELT-DLSK  780 (920)
Q Consensus       744 t~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~-~l~~  780 (920)
                      +.-... -|..+..+.+..+..++|+||..+.+ .+++
T Consensus       164 ~~~~~~-i~~~l~~l~~~~g~tii~vTHdl~~a~~laD  200 (220)
T cd03293         164 ALTREQ-LQEELLDIWRETGKTVLLVTHDIDEAVFLAD  200 (220)
T ss_pred             HHHHHH-HHHHHHHHHHHCCCEEEEECCCHHHHHHHCC
T ss_conf             999999-9999999998519999998888999999699


No 132
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=97.69  E-value=0.0015  Score=44.85  Aligned_cols=139  Identities=19%  Similarity=0.270  Sum_probs=69.4

Q ss_pred             EEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCC------CCCHHH-------CCCCCC-----CEE
Q ss_conf             44345635877776643999967784407899999999999997198------530353-------206822-----105
Q gi|254780750|r  635 IANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGS------YVPASY-------AHIGIV-----DKL  696 (920)
Q Consensus       635 VpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~------fVPA~~-------a~i~~~-----D~I  696 (920)
                      +=+|++|..    ..+.+..|.|||-+||||++|.++=+.- .+-|.      -|...+       -++|.+     ..+
T Consensus        22 aL~~isl~i----~~GE~v~iiG~nGsGKSTLl~~l~GLl~-p~~G~V~i~G~~i~~~~~~~~~~r~~iG~VfQ~P~~~l   96 (287)
T PRK13637         22 ALDNVNIEI----EDGEFVALIGHTGSGKSTLIQHLNGLLK-PTSGKIIIDGVDITDKKVKLSDIRKKVGLVFQYPEYQL   96 (287)
T ss_pred             EEECEEEEE----CCCCEEEEECCCCCHHHHHHHHHHCCCC-CCCCEEEECCEECCCCCCCHHHHHHCEEEEEECCCCCC
T ss_conf             753207698----7998999999999399999999973998-88726999999987888677888741789961752023


Q ss_pred             EEEEECCCCCCCCCCHH---HHHHHH-HHHHH----------H--------------------HCCCCCEEEEECCCCCC
Q ss_conf             67652376611385328---999999-99999----------9--------------------58998569993258898
Q gi|254780750|r  697 FSRVGSADNLASGRSTF---MVEMIE-TASIL----------N--------------------QATNQSFVILDEIGRGT  742 (920)
Q Consensus       697 ftRiGa~D~l~~g~STF---~vEm~e-~~~IL----------~--------------------~at~~SLVllDElGrGT  742 (920)
                      |.+ -..|++.-|....   -.|+.+ +..+|          .                    -+..-.++|+||--.|=
T Consensus        97 ~~~-tV~e~i~fg~~~~g~~~~e~~~rv~~~l~~vgL~~~~~~~~~p~~LSGGqkQRvaiA~aL~~~P~iLllDEPTs~L  175 (287)
T PRK13637         97 FEE-TIEKDIAFGPINLGLSEEEIENRVKEAMNIVGLDYEVYKDKSPFELSGGQKRRVAIAGVVAMEPKVLILDEPTAGL  175 (287)
T ss_pred             CCC-CHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCHHHHHCCCHHHCCHHHHHHHHHHHHHHCCCCEEEEECCCCCC
T ss_conf             703-0999998689886999999999999999766998488706891129988999999999998399999983886648


Q ss_pred             CHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHH-HHHH
Q ss_conf             8056799999999999972698499974875797-6643
Q gi|254780750|r  743 ATLDGLSIAWATIEYLHETNRCRGLLATHFHELT-DLSK  780 (920)
Q Consensus       743 st~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~-~l~~  780 (920)
                      ++.- ..--+..+..|.+..+..++++||.-+.. .+++
T Consensus       176 Dp~~-~~~i~~~l~~L~~e~g~Tvi~vTHdl~~v~~~aD  213 (287)
T PRK13637        176 DPKG-RDDILEKIKALHKEYNMTIILVSHSMEDVAKIAD  213 (287)
T ss_pred             CHHH-HHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCC
T ss_conf             9999-9999999999998509899999579999999699


No 133
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional
Probab=97.68  E-value=0.00068  Score=47.53  Aligned_cols=53  Identities=15%  Similarity=0.124  Sum_probs=33.9

Q ss_pred             CCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHH-HHHHH
Q ss_conf             89985699932588988056799999999999972698499974875797-66430
Q gi|254780750|r  727 ATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFHELT-DLSKS  781 (920)
Q Consensus       727 at~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~-~l~~~  781 (920)
                      +.+-.++|+||--+|=+..-- .--|..+..|.++ +.-+||.||.-+.. ++++.
T Consensus       412 ~~~p~vLilDEPT~GLD~~~~-~~i~~ll~~l~~~-G~tvl~ITHDl~~~~~~aDR  465 (501)
T PRK11288        412 SEDMKVILLDEPTRGIDVGAK-HEIYNVIYELAAQ-GVAVLVVSSDLPEVLGVADR  465 (501)
T ss_pred             HHCCCEEEEECCCCCCCHHHH-HHHHHHHHHHHHC-CCEEEEEECCHHHHHHHCCE
T ss_conf             709998999798778999999-9999999999968-99999990768999986999


No 134
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=97.68  E-value=0.0004  Score=49.23  Aligned_cols=139  Identities=24%  Similarity=0.259  Sum_probs=67.1

Q ss_pred             CEEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCC------HH-----HCCCCCC----CEEE
Q ss_conf             0444345635877776643999967784407899999999999997198530------35-----3206822----1056
Q gi|254780750|r  633 PFIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVP------AS-----YAHIGIV----DKLF  697 (920)
Q Consensus       633 ~fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVP------A~-----~a~i~~~----D~If  697 (920)
                      .++=+|+++..    ..+.+.-|.|||-+||||++|.++=+. -.+-|.-.-      ..     .-.++.+    |..|
T Consensus        17 ~~aL~~vsl~i----~~GE~vaivG~nGsGKSTL~~~l~Gll-~p~~G~I~i~G~~i~~~~~~~lr~~ig~VfQ~p~~~~   91 (276)
T PRK13650         17 KYTLDDVSFHV----KQGEWLSIIGHNGSGKSTTVRLIDGLL-EAESGSIIIDGDLLTEENVWEIRHKIGMVFQNPDNQF   91 (276)
T ss_pred             CEEEECCEEEE----CCCCEEEEECCCCCHHHHHHHHHHCCC-CCCCEEEEECCEECCCCCHHHHHHCEEEEEECCCHHC
T ss_conf             77878758799----899899999999987999999997388-9886089999999986776887641469976720105


Q ss_pred             EEEECCCCCCCCCCHH---HHHHHH-HHHHHH----------------------------HCCCCCEEEEECCCCCCCHH
Q ss_conf             7652376611385328---999999-999999----------------------------58998569993258898805
Q gi|254780750|r  698 SRVGSADNLASGRSTF---MVEMIE-TASILN----------------------------QATNQSFVILDEIGRGTATL  745 (920)
Q Consensus       698 tRiGa~D~l~~g~STF---~vEm~e-~~~IL~----------------------------~at~~SLVllDElGrGTst~  745 (920)
                      .-.-..|++.-|....   ..|+.+ +..+|.                            -|..-.++|+||--.|=++.
T Consensus        92 ~~~tV~e~i~fgl~~~g~~~~e~~~rv~~~l~~~gl~~~~~r~p~~LSGGQrQRvaIA~aLa~~P~lLilDEPTs~LD~~  171 (276)
T PRK13650         92 VGATVEDDVAFGLENKGIPHEEMKERVNEALELVGMQDFKEREPARLSGGQKQRVAIAGAVAMRPKIIILDEATSMLDPE  171 (276)
T ss_pred             CCCCHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHHCCHHHCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCHH
T ss_conf             63639999987998779999999999999998779924553890338999999999999997399999983886658999


Q ss_pred             HHHHHHHHHHHHHHHHCCCEEEEECCCHHHHH
Q ss_conf             67999999999999726984999748757976
Q gi|254780750|r  746 DGLSIAWATIEYLHETNRCRGLLATHFHELTD  777 (920)
Q Consensus       746 DG~aiA~aile~l~~~~~~~~lfaTHy~eL~~  777 (920)
                       +..--+..+..|.+..+-.++++||.-+...
T Consensus       172 -~~~~i~~~l~~l~~~~g~Tvi~iTHdl~~v~  202 (276)
T PRK13650        172 -GRLELIKTIKNIRDDYQLTVISITHDLDEVA  202 (276)
T ss_pred             -HHHHHHHHHHHHHHHCCCEEEEEEECHHHHH
T ss_conf             -9999999999999842989999957789996


No 135
>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=97.67  E-value=0.00015  Score=52.37  Aligned_cols=128  Identities=29%  Similarity=0.353  Sum_probs=67.3

Q ss_pred             EEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHCC-------------------CCCC-
Q ss_conf             44434563587777664399996778440789999999999999719853035320-------------------6822-
Q gi|254780750|r  634 FIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAH-------------------IGIV-  693 (920)
Q Consensus       634 fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a~-------------------i~~~-  693 (920)
                      ++=+|++|..    ..+.+.-|-|||-+||||++|.+        .|.+-|- +-+                   ++.+ 
T Consensus        21 ~aL~~isl~i----~~GE~vaivG~nGsGKSTL~k~l--------~Gl~~p~-~G~I~i~G~~i~~~~~~~lr~~ig~Vf   87 (279)
T PRK13635         21 YALKDVSFSV----YEGEWVAIVGHNGSGKSTLAKLL--------NGLLLPE-AGTITVGGMVLSEETVWDVRKQIGMVF   87 (279)
T ss_pred             EEEEEEEEEE----CCCCEEEEECCCCCHHHHHHHHH--------HCCCCCC-CCEEEECCEECCCCCHHHHHHHEEEEE
T ss_conf             2576307688----79989999999996599999999--------7288888-964999999998578799974366882


Q ss_pred             ---CEEEEEEECCCCCCCCCCHH---HHHHHH-HHHHHH----------------------------HCCCCCEEEEECC
Q ss_conf             ---10567652376611385328---999999-999999----------------------------5899856999325
Q gi|254780750|r  694 ---DKLFSRVGSADNLASGRSTF---MVEMIE-TASILN----------------------------QATNQSFVILDEI  738 (920)
Q Consensus       694 ---D~IftRiGa~D~l~~g~STF---~vEm~e-~~~IL~----------------------------~at~~SLVllDEl  738 (920)
                         |.-|...--.|++.-|....   -.|+.+ +..+|.                            -+..-.++|+||-
T Consensus        88 Q~P~~~l~~~tV~e~iafgl~~~g~~~~e~~~rv~~~l~~~gl~~~~~~~p~~LSGGQrQRvaIAraL~~~P~iLilDEP  167 (279)
T PRK13635         88 QNPDNQFVGTTVQDDVAFGLENIGVPREEMVERVDQALRQVGMEDFLNREPHRLSGGQKQRVAIAGVLALQPDILILDEA  167 (279)
T ss_pred             CCHHHHCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHHCCHHHCCHHHHHHHHHHHHHHCCCCEEEECCC
T ss_conf             18565257626899998899877999999999999999877997886179343999999999999999709998997387


Q ss_pred             CCCCCHHHHHH--HHHHHHHHHHHHCCCEEEEECCCHHHHH
Q ss_conf             88988056799--9999999999726984999748757976
Q gi|254780750|r  739 GRGTATLDGLS--IAWATIEYLHETNRCRGLLATHFHELTD  777 (920)
Q Consensus       739 GrGTst~DG~a--iA~aile~l~~~~~~~~lfaTHy~eL~~  777 (920)
                         ||..|-.+  --+..+..|.+..+..++++||.-+...
T Consensus       168 ---Ts~LD~~~~~~i~~~l~~L~~~~g~TvI~itHdl~~~~  205 (279)
T PRK13635        168 ---TSMLDPQGRREVLETVRQLKEQKGITVLSITHDLDEAA  205 (279)
T ss_pred             ---CCCCCHHHHHHHHHHHHHHHHCCCCEEEEEEECHHHHH
T ss_conf             ---45489899999999999999837989999976789996


No 136
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2. The enzyme that catalyzes the final step in methanogenesis, methyl coenzyme M reductase, contains alpha, beta, and gamma chains. In older literature, the complex of alpha, beta, and gamma chains was termed component C, while this single chain protein was termed methyl coenzyme M reductase system component A2.
Probab=97.67  E-value=0.00047  Score=48.70  Aligned_cols=32  Identities=22%  Similarity=0.433  Sum_probs=25.4

Q ss_pred             EEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHH
Q ss_conf             434563587777664399996778440789999999
Q gi|254780750|r  636 ANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNA  671 (920)
Q Consensus       636 pNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqva  671 (920)
                      =+|++|..    ..+.++=|.|||-+||||++|.++
T Consensus       300 l~~vs~~v----~~GEi~gi~G~nGsGKsTL~k~l~  331 (520)
T TIGR03269       300 VDNVSLEV----KEGEIFGIVGTSGAGKTTLSKIIA  331 (520)
T ss_pred             EECEEEEE----CCCCEEEEECCCCCCHHHHHHHHH
T ss_conf             51206897----289689998788887899999994


No 137
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis.  The CydC and CydD proteins are important for the formation of cytochrome bd terminal oxidase of E. coli and it has been proposed that they were necessary for biosynthesis of the cytochrome bd quinol oxidase and for periplasmic c-type cytochromes.  CydCD were proposed to determine a heterooligomeric complex important for heme export into the periplasm or to be involved in the maintenance of the proper redox state of the periplasmic space.  In Bacillus subtilius, the absence of CydCD does not affect the presence of halo-cytochrome c in the membrane and this observation suggests that CydCD proteins are not involved in the export of heme in this organism.
Probab=97.65  E-value=0.0011  Score=45.95  Aligned_cols=126  Identities=21%  Similarity=0.158  Sum_probs=67.1

Q ss_pred             EEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCC--------------------CCCCHHHCCCCCC
Q ss_conf             44434563587777664399996778440789999999999999719--------------------8530353206822
Q gi|254780750|r  634 FIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMG--------------------SYVPASYAHIGIV  693 (920)
Q Consensus       634 fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG--------------------~fVPA~~a~i~~~  693 (920)
                      .|=++++|..    ..+.+.-|.|||-+||||++|.+.=.. -.+-|                    +|||-..      
T Consensus        16 ~~L~~i~l~i----~~Ge~~aivG~sGsGKSTLl~~l~G~~-~p~~G~i~i~g~~i~~~~~~~~~~i~~v~Q~~------   84 (178)
T cd03247          16 QVLKNLSLEL----KQGEKIALLGRSGSGKSTLLQLLTGDL-KPQQGEITLDGVPVSDLEKALSSLISVLNQRP------   84 (178)
T ss_pred             CCEECEEEEE----CCCCEEEEECCCCCHHHHHHHHHHHCC-CCCCCEEEECCEEHHHHHHHHHHHEEEECCCC------
T ss_conf             6332558998----699999999999875999999998617-66788699999988997899997208983556------


Q ss_pred             CEEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCH
Q ss_conf             10567652376611385328999999999999589985699932588988056799999999999972698499974875
Q gi|254780750|r  694 DKLFSRVGSADNLASGRSTFMVEMIETASILNQATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFH  773 (920)
Q Consensus       694 D~IftRiGa~D~l~~g~STF~vEm~e~~~IL~~at~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~  773 (920)
                       .+|.. .-.||+....|-=+.--...|..|  +....++|+||--.|=++.-...|-..+. .+. + +..++++||.-
T Consensus        85 -~lf~~-ti~~nlg~~LSgGqkqRv~iAral--~~~p~ililDEpts~LD~~t~~~i~~~l~-~~~-~-~~Tvi~itH~~  157 (178)
T cd03247          85 -YLFDT-TLRNNLGRRFSGGERQRLALARIL--LQDAPIVLLDEPTVGLDPITERQLLSLIF-EVL-K-DKTLIWITHHL  157 (178)
T ss_pred             -CCCCC-HHHHHCCCCCCHHHHHHHHHHHHH--HHCCCEEEECCCCCCCCHHHHHHHHHHHH-HHC-C-CCEEEEEECCH
T ss_conf             -36454-199862888899999999999999--64979767228655699899999999999-983-9-99999980589


Q ss_pred             HHHH
Q ss_conf             7976
Q gi|254780750|r  774 ELTD  777 (920)
Q Consensus       774 eL~~  777 (920)
                      +...
T Consensus       158 ~~l~  161 (178)
T cd03247         158 TGIE  161 (178)
T ss_pred             HHHH
T ss_conf             8998


No 138
>COG3910 Predicted ATPase [General function prediction only]
Probab=97.64  E-value=0.00032  Score=50.02  Aligned_cols=127  Identities=26%  Similarity=0.268  Sum_probs=82.4

Q ss_pred             EEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCC------CHH------HCCC----CCCCEEEEE---------------
Q ss_conf             399996778440789999999999999719853------035------3206----822105676---------------
Q gi|254780750|r  651 KLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYV------PAS------YAHI----GIVDKLFSR---------------  699 (920)
Q Consensus       651 ~~~iiTGpNmgGKSt~lRqval~vilAQiG~fV------PA~------~a~i----~~~D~IftR---------------  699 (920)
                      ++-+|||-|-+||||+|-.+|...=.--+|--=      -++      ++++    -+-++-|-|               
T Consensus        38 pIT~i~GENGsGKSTLLEaiA~~~~~n~aGg~~n~~~~~~~s~s~l~~~~k~~~~~k~~~g~FlRAEs~yn~as~~De~~  117 (233)
T COG3910          38 PITFITGENGSGKSTLLEAIAAGMGFNAAGGGKNFKGELDASHSALVDYAKLHKRKKPPIGFFLRAESFYNVASYLDEAD  117 (233)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCEEEEHHHHHHHHHHHHHHH
T ss_conf             64899768986578899999965651455787675751143314687768875067887506874467777998887622


Q ss_pred             ----EECC--CCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCH
Q ss_conf             ----5237--6611385328999999999999589985699932588988056799999999999972698499974875
Q gi|254780750|r  700 ----VGSA--DNLASGRSTFMVEMIETASILNQATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFH  773 (920)
Q Consensus       700 ----iGa~--D~l~~g~STF~vEm~e~~~IL~~at~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~  773 (920)
                          .|..  +..+.|.|-|       +-+.+..+..-+-||||--.|-|+.--++++ |++..|.+. |+-.+.|||-+
T Consensus       118 ~e~~~~~~sLh~~SHGEsf~-------~i~~~rf~~~GiYiLDEPEa~LSp~RQlell-a~l~~la~s-GaQ~IiATHSP  188 (233)
T COG3910         118 GEANYGGRSLHHMSHGESFL-------AIFHNRFNGQGIYILDEPEAALSPSRQLELL-AILRDLADS-GAQIIIATHSP  188 (233)
T ss_pred             HHCCCCCCCHHHHCCCHHHH-------HHHHHHHCCCCEEEECCCCCCCCHHHHHHHH-HHHHHHHHC-CCEEEEEECCH
T ss_conf             01025774235541431899-------9999983158418856864447888899999-999998736-78399983681


Q ss_pred             HHHHHHHHCCCEEEEEE
Q ss_conf             79766430688589999
Q gi|254780750|r  774 ELTDLSKSLKRFHNATL  790 (920)
Q Consensus       774 eL~~l~~~~~~v~n~~~  790 (920)
                      -|-.    .|+..-+.+
T Consensus       189 iLlA----iP~A~I~~~  201 (233)
T COG3910         189 ILLA----IPGAEIYEI  201 (233)
T ss_pred             HHEE----CCCCEEEEE
T ss_conf             4200----788479998


No 139
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake.  NatB possess six putative membrane spanning regions at its C-terminus.  In B. subtilus, NatAB is inducible by agents such as ethanol and protonophores, which lower the protonmotive force across the membrane.  The closest sequence similarity to NatA is exhibited by DrrA of the two-component daunomycin- and doxorubicin-efflux system.  Hence, the functional NatAB is presumably assembled with two copies of a single ATP-binding protein and a single intergral membrane protein.
Probab=97.63  E-value=0.0015  Score=45.04  Aligned_cols=131  Identities=24%  Similarity=0.313  Sum_probs=69.1

Q ss_pred             EEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHCC------------------CCCC---
Q ss_conf             4434563587777664399996778440789999999999999719853035320------------------6822---
Q gi|254780750|r  635 IANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAH------------------IGIV---  693 (920)
Q Consensus       635 VpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a~------------------i~~~---  693 (920)
                      +=||+++..    ..+.+.-|-|||-+||||++|.++        |..-| ++-+                  ++.+   
T Consensus        20 al~~vs~~i----~~Gei~gllG~NGaGKSTllk~i~--------Gl~~p-~~G~i~i~G~d~~~~~~~~r~~ig~~~q~   86 (218)
T cd03266          20 AVDGVSFTV----KPGEVTGLLGPNGAGKTTTLRMLA--------GLLEP-DAGFATVDGFDVVKEPAEARRRLGFVSDS   86 (218)
T ss_pred             EEECCEEEE----CCCCEEEEECCCCCCHHHHHHHHH--------CCCCC-CCCEEEECCEECCCCHHHHHCCEEEECCC
T ss_conf             872627898----598299999999984999999997--------79778-97489999999886979896287998077


Q ss_pred             CEEEEEEECCCCCC-----CCCC--------HHHHHHHHH-------------------HHHHHHCCCCCEEEEECCCCC
Q ss_conf             10567652376611-----3853--------289999999-------------------999995899856999325889
Q gi|254780750|r  694 DKLFSRVGSADNLA-----SGRS--------TFMVEMIET-------------------ASILNQATNQSFVILDEIGRG  741 (920)
Q Consensus       694 D~IftRiGa~D~l~-----~g~S--------TF~vEm~e~-------------------~~IL~~at~~SLVllDElGrG  741 (920)
                      +.+|..+-..|++.     .|.+        -.+.|+.+.                   +-..--+..-.++|+||--.|
T Consensus        87 ~~l~~~ltv~e~l~~~~~~~g~~~~~~~~~~~~~l~~~~l~~~~~~~~~~LS~G~kqrv~la~al~~~P~lliLDEPt~g  166 (218)
T cd03266          87 TGLYDRLTARENLEYFAGLYGLKGDELTARLEELADRLGMEELLDRRVGGFSTGMRQKVAIARALVHDPPVLLLDEPTTG  166 (218)
T ss_pred             CCCCCCCCHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHCCCHHHCCCHHHHHHHHHHHHHCCCCEEEEECCCCC
T ss_conf             66799998999999999984999899999999999974995575144322782688999999998669989999798767


Q ss_pred             CCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHH-HHHH
Q ss_conf             88056799999999999972698499974875797-6643
Q gi|254780750|r  742 TATLDGLSIAWATIEYLHETNRCRGLLATHFHELT-DLSK  780 (920)
Q Consensus       742 Tst~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~-~l~~  780 (920)
                      =++. +...-|.++..+.+. +.-.+|+||.-+-. .+.+
T Consensus       167 LD~~-~~~~i~~~l~~l~~~-g~til~~sH~l~e~~~l~d  204 (218)
T cd03266         167 LDVM-ATRALREFIRQLRAL-GKCILFSTHIMQEVERLCD  204 (218)
T ss_pred             CCHH-HHHHHHHHHHHHHHC-CCEEEEECCCHHHHHHHCC
T ss_conf             6999-999999999999857-9999998987899999699


No 140
>PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed
Probab=97.63  E-value=0.00039  Score=49.37  Aligned_cols=125  Identities=24%  Similarity=0.301  Sum_probs=66.8

Q ss_pred             EEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHH--------------------HHHHCCCCCCHHHC---CCC
Q ss_conf             4434563587777664399996778440789999999999--------------------99971985303532---068
Q gi|254780750|r  635 IANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIV--------------------IMAQMGSYVPASYA---HIG  691 (920)
Q Consensus       635 VpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~v--------------------ilAQiG~fVPA~~a---~i~  691 (920)
                      |=+|++|..    ..+.++-|-|||-+||||+||.+.=..                    -+|+.-.|||=+..   .++
T Consensus        17 ~L~~Vsl~I----~~GEi~gLIGPNGAGKSTLLk~I~Gll~P~~G~V~l~G~~i~~~~~~elar~ia~vpQ~~~l~~~~t   92 (409)
T PRK09536         17 ILDGVDLSV----REGHLVGVVGPNGAGKTTLLRAMNGLITPTAGTVLVAGDDVHALSAAAASRQVATVPQDTSLSFEFD   92 (409)
T ss_pred             EEECEEEEE----CCCCEEEEECCCCCHHHHHHHHHHCCCCCCCEEEEECCEECCCCCHHHHHHHHEEECCCCCCCCCCC
T ss_conf             892508898----8998999999987279999999966888896399999999887998999623348433346677877


Q ss_pred             CCCEEEEEEECCCCCCCCCCH----H-------------HHHH---------------------HHHHHHHHHCCCCCEE
Q ss_conf             221056765237661138532----8-------------9999---------------------9999999958998569
Q gi|254780750|r  692 IVDKLFSRVGSADNLASGRST----F-------------MVEM---------------------IETASILNQATNQSFV  733 (920)
Q Consensus       692 ~~D~IftRiGa~D~l~~g~ST----F-------------~vEm---------------------~e~~~IL~~at~~SLV  733 (920)
                      +.          |.+..|..-    |             ..|+                     ..+|..|  |..-.++
T Consensus        93 v~----------e~V~~Gr~p~~~~~~~~~~~d~~~v~~aLe~~~l~~l~dr~~~~LSGGqrQRV~IARAL--aq~P~IL  160 (409)
T PRK09536         93 VR----------QVVEMGRTPHRSRFGTWTETDRAAVERAMERTGVAQFADRPVTSLSGGERQRVLLARAL--AQATPVL  160 (409)
T ss_pred             HH----------HHHHHCCHHHHHCCCCCCHHHHHHHHHHHHHCCCHHHHCCCHHHCCHHHHHHHHHHHHH--HCCCCEE
T ss_conf             99----------99982502333203675789999999999874997685588002899999999999999--6799989


Q ss_pred             EEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHH
Q ss_conf             99325889880567999999999999726984999748757976
Q gi|254780750|r  734 ILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFHELTD  777 (920)
Q Consensus       734 llDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~~  777 (920)
                      ||||--.|=+..--.-+ +.++..|.+. +.-++++||.-++..
T Consensus       161 LLDEPTs~LDi~~q~el-l~lLr~L~~~-G~TVI~vtHDL~lA~  202 (409)
T PRK09536        161 LLDEPTASLDINHQIRT-LELVRDLADD-GKTVVAAIHDLNLAA  202 (409)
T ss_pred             EEECCCCCCCHHHHHHH-HHHHHHHHHC-CCEEEEEECCHHHHH
T ss_conf             99587667999999999-9999999858-999999956899999


No 141
>PRK13536 nodulation factor exporter subunit NodI; Provisional
Probab=97.63  E-value=0.00099  Score=46.30  Aligned_cols=47  Identities=28%  Similarity=0.383  Sum_probs=34.1

Q ss_pred             CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHH
Q ss_conf             9985699932588988056799999999999972698499974875797
Q gi|254780750|r  728 TNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFHELT  776 (920)
Q Consensus       728 t~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~  776 (920)
                      ..-.++++||--.|=++.--. --|.++..|.+. +..++++|||-+-.
T Consensus       155 ~~P~lliLDEPT~GLDp~~r~-~i~~~i~~l~~~-G~TillttH~l~E~  201 (306)
T PRK13536        155 NDPQLLILDEPTTGLDPHARH-LIWERLRSLLAR-GKTILLTTHFMEEA  201 (306)
T ss_pred             CCCCEEEECCCCCCCCHHHHH-HHHHHHHHHHHC-CCEEEEECCCHHHH
T ss_conf             599899975875678999999-999999999968-98999988838999


No 142
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine.  MJ1267 is a branched-chain amino acid transporter with 29% similarity to both the LivF and LivG components of the E. coli  branched-chain amino acid transporter.  MJ1267 contains an insertion from residues 114 to 123 characteristic of LivG (Leucine-Isoleucine-Valine) homologs.  The branched-chain amino acid transporter from E. coli comprises a heterodimer of ABCs (LivF and LivG), a heterodimer of six-helix TM domains (LivM and LivH), and one of two alternative soluble periplasmic substrate binding proteins (LivK or LivJ).
Probab=97.63  E-value=0.0013  Score=45.43  Aligned_cols=137  Identities=27%  Similarity=0.368  Sum_probs=72.7

Q ss_pred             EEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCC------C----CHHHCCCCCC-----CEEEEE
Q ss_conf             443456358777766439999677844078999999999999971985------3----0353206822-----105676
Q gi|254780750|r  635 IANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSY------V----PASYAHIGIV-----DKLFSR  699 (920)
Q Consensus       635 VpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~f------V----PA~~a~i~~~-----D~IftR  699 (920)
                      +=+|++|..    ..+.+.-|.|||-+||||++|.++=+. -..-|.-      +    |.+.++.++.     ..+|..
T Consensus        15 aL~~vsl~i----~~Gei~gliG~nGaGKSTL~~~i~Gl~-~p~~G~I~~~G~~i~~~~~~~~~~~gi~~v~Q~~~l~~~   89 (236)
T cd03219          15 ALDDVSFSV----RPGEIHGLIGPNGAGKTTLFNLISGFL-RPTSGSVLFDGEDITGLPPHEIARLGIGRTFQIPRLFPE   89 (236)
T ss_pred             EECCEEEEE----CCCCEEEEECCCCCCHHHHHHHHHCCC-CCCCEEEEECCEECCCCCHHHHHHCCCEEEECCCCCCCC
T ss_conf             872338998----899899999899973999999996798-788318999999668899999997597676014102655


Q ss_pred             EECCCCCCCC-----CCHHH--------HHHHH-------------------------------HHHHHHHCCCCCEEEE
Q ss_conf             5237661138-----53289--------99999-------------------------------9999995899856999
Q gi|254780750|r  700 VGSADNLASG-----RSTFM--------VEMIE-------------------------------TASILNQATNQSFVIL  735 (920)
Q Consensus       700 iGa~D~l~~g-----~STF~--------vEm~e-------------------------------~~~IL~~at~~SLVll  735 (920)
                      +...||+.-|     ...|.        .++.+                               +|..|  +..-.++|+
T Consensus        90 ltv~enl~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~l~~~~~~~~~~LSGG~~Qrv~iAral--~~~P~lliL  167 (236)
T cd03219          90 LTVLENVMVAAQARTGSGLLLARARREEREARERAEELLERVGLADLADRPAGELSYGQQRRLEIARAL--ATDPKLLLL  167 (236)
T ss_pred             CCHHHHHHHHHHHHCCCCCHHHCCCCCHHHHHHHHHHHHHHCCCCCHHCCCHHHCCHHHHHHHHHHHHH--HCCCCEEEE
T ss_conf             438998988887604543001102358999999999999974998043886266999999999999999--659999999


Q ss_pred             ECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHH-HHHHH
Q ss_conf             3258898805679999999999997269849997487579-76643
Q gi|254780750|r  736 DEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFHEL-TDLSK  780 (920)
Q Consensus       736 DElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~eL-~~l~~  780 (920)
                      ||--+|=++..-.-| |..+..+.+. +.-.+++||.-+. .++.+
T Consensus       168 DEPT~gLD~~~~~~i-~~~l~~l~~~-G~tii~vsHdl~~~~~~~D  211 (236)
T cd03219         168 DEPAAGLNPEETEEL-AELIRELRER-GITVLLVEHDMDVVMSLAD  211 (236)
T ss_pred             ECCCCCCCHHHHHHH-HHHHHHHHHC-CCEEEEECCCHHHHHHHCC
T ss_conf             487658999999999-9999999965-9999999174899999699


No 143
>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=97.63  E-value=0.0015  Score=45.02  Aligned_cols=52  Identities=15%  Similarity=0.153  Sum_probs=36.8

Q ss_pred             CCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHH-HHHH
Q ss_conf             89985699932588988056799999999999972698499974875797-6643
Q gi|254780750|r  727 ATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFHELT-DLSK  780 (920)
Q Consensus       727 at~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~-~l~~  780 (920)
                      |..-.++|+||--.|=++.-...| +.+++.|.+. +..++++||.-+.. .+++
T Consensus       161 a~~P~iLlLDEPTsgLDp~~~~~i-~~ll~~l~~~-G~Tii~vtHd~~~v~~~ad  213 (286)
T PRK13641        161 AYEPEILCLDEPAAGLDPEGRKEM-MQIFKDYQKA-GHTVILVTHNMDDVAEYAD  213 (286)
T ss_pred             HCCCCEEEECCCCCCCCHHHHHHH-HHHHHHHHHC-CCEEEEECCCHHHHHHHCC
T ss_conf             749999997397343899999999-9999999963-9999999159999999799


No 144
>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional
Probab=97.62  E-value=0.0031  Score=42.57  Aligned_cols=141  Identities=23%  Similarity=0.241  Sum_probs=71.1

Q ss_pred             EEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCC---------CCCCHHHCCCCCC---CEEEEEEEC
Q ss_conf             4434563587777664399996778440789999999999999719---------8530353206822---105676523
Q gi|254780750|r  635 IANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMG---------SYVPASYAHIGIV---DKLFSRVGS  702 (920)
Q Consensus       635 VpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG---------~fVPA~~a~i~~~---D~IftRiGa  702 (920)
                      +=+|++|+.    ..+.+.-|-|||-+||||+||.++=+.- ..-|         ..+|...-.++.+   ..+|-.+-.
T Consensus        34 al~~vsl~I----~~GE~~~llGpsGsGKSTllr~i~Gl~~-p~~G~I~i~G~di~~~~~~~r~ig~vfQ~~~L~p~ltV  108 (377)
T PRK11607         34 AVDDVSLTI----YKGEIFALLGASGCGKSTLLRMLAGFEQ-PSAGQIMLDGVDLSHVPPYQRPINMMFQSYALFPHMTV  108 (377)
T ss_pred             EECCCEEEE----CCCCEEEEECCCCCHHHHHHHHHHCCCC-CCCEEEEECCEECCCCCHHHCCEEEEECCCCCCCCCCH
T ss_conf             990518799----9998999999998489999999976999-98659999999988798666650467012655877575


Q ss_pred             CCCCCCCC-----CH-----HHHHHHH---HHHHHH-------------------HCCCCCEEEEECCCCCCCHHHHHHH
Q ss_conf             76611385-----32-----8999999---999999-------------------5899856999325889880567999
Q gi|254780750|r  703 ADNLASGR-----ST-----FMVEMIE---TASILN-------------------QATNQSFVILDEIGRGTATLDGLSI  750 (920)
Q Consensus       703 ~D~l~~g~-----ST-----F~vEm~e---~~~IL~-------------------~at~~SLVllDElGrGTst~DG~ai  750 (920)
                      .||+.-|.     +.     -..|+.+   ....++                   -+.+-.++|+||--.|=++.--..+
T Consensus       109 ~eNi~~~l~~~~~~~~e~~~rv~e~l~~v~L~~~~~~~p~~LSGGqrQRVaiArAL~~~P~lLllDEPts~LD~~~r~~l  188 (377)
T PRK11607        109 EQNIAFGLKQDKLPKAEIASRVNEMLGLVHMQEFAKRKPHQLSGGQRQRVALARSLAKRPKLLLLDEPMGALDKKLRDRM  188 (377)
T ss_pred             HHHHHHHHHHCCCCHHHHHHHHHHHHHCCCCHHHHHCCHHHCCHHHHHHHHHHHHHHCCCCEEEECCCCCCCCHHHHHHH
T ss_conf             45245478665999899999999998544627666589657898687899999987449978996487544799999999


Q ss_pred             HHHHHHHHHHHCCCEEEEECCCHHHHH-HHHH
Q ss_conf             999999999726984999748757976-6430
Q gi|254780750|r  751 AWATIEYLHETNRCRGLLATHFHELTD-LSKS  781 (920)
Q Consensus       751 A~aile~l~~~~~~~~lfaTHy~eL~~-l~~~  781 (920)
                      - .-+..|.+..+..++|+||+.+-+. +++.
T Consensus       189 ~-~~l~~l~~~~g~Tii~VTHD~~eA~~laDr  219 (377)
T PRK11607        189 Q-LEVVDILERVGVTCVMVTHDQEEAMTMAGR  219 (377)
T ss_pred             H-HHHHHHHHHHCCEEEEECCCHHHHHHHCCE
T ss_conf             9-999999997399999999899999986999


No 145
>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=97.61  E-value=0.00076  Score=47.15  Aligned_cols=52  Identities=17%  Similarity=0.156  Sum_probs=34.5

Q ss_pred             CCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHH-HHHH
Q ss_conf             89985699932588988056799999999999972698499974875797-6643
Q gi|254780750|r  727 ATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFHELT-DLSK  780 (920)
Q Consensus       727 at~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~-~l~~  780 (920)
                      |..-.++|+||--.|=++.--..| +..+..+.+. +..++++||.-+.. .+++
T Consensus       192 a~~P~iLilDEPTagLDp~~~~~i-~~li~~l~~~-g~TiilvTHdm~~v~~~aD  244 (320)
T PRK13631        192 AIQPEILIFDEPTAGLDPKGEHEM-MQLILDAKAN-NKTVFVITHTMEHVLEVAD  244 (320)
T ss_pred             HCCCCEEEECCCCCCCCHHHHHHH-HHHHHHHHHC-CCEEEEECCCHHHHHHHCC
T ss_conf             239999997587555998999999-9999999962-9999999478999999799


No 146
>cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function.  Barmotin belongs to the SMC protein family.  SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains.  Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins.  The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases.  The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, w
Probab=97.61  E-value=0.00083  Score=46.88  Aligned_cols=55  Identities=20%  Similarity=0.275  Sum_probs=33.3

Q ss_pred             CCCEEEEECCCCCCCHHHHHH--HHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHCCCEEEEEEE
Q ss_conf             985699932588988056799--999999999972698499974875797664306885899999
Q gi|254780750|r  729 NQSFVILDEIGRGTATLDGLS--IAWATIEYLHETNRCRGLLATHFHELTDLSKSLKRFHNATLQ  791 (920)
Q Consensus       729 ~~SLVllDElGrGTst~DG~a--iA~aile~l~~~~~~~~lfaTHy~eL~~l~~~~~~v~n~~~~  791 (920)
                      +..++|+||-   ||..|-..  .-+..++.|.+  +..+++.||.....+.++.   +.-.+|.
T Consensus       135 p~~iliLDEP---Ts~LD~~~~~~i~~~l~~l~~--~~t~IiITH~~~~i~~AD~---Ii~v~m~  191 (197)
T cd03278         135 PSPFCVLDEV---DAALDDANVERFARLLKEFSK--ETQFIVITHRKGTMEAADR---LYGVTMQ  191 (197)
T ss_pred             CCCEEEECCC---CCCCCHHHHHHHHHHHHHHHC--CCEEEEEECCHHHHHHCCE---EEEEEEC
T ss_conf             9978997178---553898999999999999856--9989999849999985899---9999837


No 147
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup.  This family is comprised of proteins involved in the transport of apparently unrelated solutes and proteins specific for di- and oligosaccharides and polyols.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules.  The nucleotide-binding domain shows the highest similarity between all members of the family.   ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=97.61  E-value=0.00047  Score=48.75  Aligned_cols=139  Identities=26%  Similarity=0.311  Sum_probs=69.9

Q ss_pred             EEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHH-----CCCC---CCHHHCCCCCC---CEEEEEEECC
Q ss_conf             44345635877776643999967784407899999999999997-----1985---30353206822---1056765237
Q gi|254780750|r  635 IANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQ-----MGSY---VPASYAHIGIV---DKLFSRVGSA  703 (920)
Q Consensus       635 VpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQ-----iG~f---VPA~~a~i~~~---D~IftRiGa~  703 (920)
                      |=+|+++..    ..+.+.-|-|||-+||||++|.++=..-...     -|.-   .|...-.++.+   ..+|-.+-..
T Consensus        15 al~~vs~~i----~~Gei~~iiGpnGaGKSTl~~~i~Gl~~p~~G~I~~~g~~i~~~~~~~r~ig~v~Q~~~l~~~ltv~   90 (213)
T cd03259          15 ALDDLSLTV----EPGEFLALLGPSGCGKTTLLRLIAGLERPDSGEILIDGRDVTGVPPERRNIGMVFQDYALFPHLTVA   90 (213)
T ss_pred             EECCCEEEE----CCCCEEEEECCCCCHHHHHHHHHHCCCCCCCEEEEECCEECCCCCHHHCCEEEEECCCCCCCCCCHH
T ss_conf             984617798----8998999999999739999999975999897089999999888997787869990698658898199


Q ss_pred             CCCCCC-----CCHHHHHHHH-HHHHH---------------------------H-HCCCCCEEEEECCCCCCCHHHHHH
Q ss_conf             661138-----5328999999-99999---------------------------9-589985699932588988056799
Q gi|254780750|r  704 DNLASG-----RSTFMVEMIE-TASIL---------------------------N-QATNQSFVILDEIGRGTATLDGLS  749 (920)
Q Consensus       704 D~l~~g-----~STF~vEm~e-~~~IL---------------------------~-~at~~SLVllDElGrGTst~DG~a  749 (920)
                      ||+.-+     .+.  .|..+ +..+|                           + -+.+--++|+||--.|=++.-...
T Consensus        91 enl~~~~~~~~~~~--~~~~~~~~~~l~~~~l~~~~~~~~~~LSGG~kQrv~iAraL~~~P~illlDEPt~gLD~~~~~~  168 (213)
T cd03259          91 ENIAFGLKLRGVPK--AEIRARVRELLELVGLEGLLNRYPHELSGGQQQRVALARALAREPSLLLLDEPLSALDAKLREE  168 (213)
T ss_pred             HHHHHHHHHCCCCH--HHHHHHHHHHHHHCCCHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCEEEECCCCCCCCHHHHHH
T ss_conf             99988998759998--9999999999998699647637703389899999999876227999999839864379999999


Q ss_pred             HHHHHHHHHHHHCCCEEEEECCCHHHH-HHHH
Q ss_conf             999999999972698499974875797-6643
Q gi|254780750|r  750 IAWATIEYLHETNRCRGLLATHFHELT-DLSK  780 (920)
Q Consensus       750 iA~aile~l~~~~~~~~lfaTHy~eL~-~l~~  780 (920)
                      | |..+..+.+..+.-.+++||..+.. .+++
T Consensus       169 i-~~li~~l~~~~g~tii~vtHdl~~~~~~~d  199 (213)
T cd03259         169 L-REELKELQRELGITTIYVTHDQEEALALAD  199 (213)
T ss_pred             H-HHHHHHHHHHCCCEEEEECCCHHHHHHHCC
T ss_conf             9-999999999629999999689999999699


No 148
>PRK11147 ABC transporter ATPase component; Reviewed
Probab=97.60  E-value=0.00048  Score=48.68  Aligned_cols=134  Identities=25%  Similarity=0.254  Sum_probs=66.1

Q ss_pred             EEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHCCCCCCCEEEEEEE----CCCCCCCC
Q ss_conf             44434563587777664399996778440789999999999999719853035320682210567652----37661138
Q gi|254780750|r  634 FIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHIGIVDKLFSRVG----SADNLASG  709 (920)
Q Consensus       634 fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a~i~~~D~IftRiG----a~D~l~~g  709 (920)
                      .|-.|+++..    ..+..+-|.|||-+||||+||.++=. +=...|..--....+++-||+-...+-    .-|++..|
T Consensus       333 ~~l~~vsl~i----~~Ge~ialvG~NGsGKSTLlk~l~G~-l~p~~G~i~~g~~~~i~y~~Q~~~~l~~~~tv~~~l~~~  407 (632)
T PRK11147        333 QLVKDFSAQV----QRGDKIALIGPNGCGKTTLLKLMLGQ-LQADSGRIHCGTKLEVAYFDQYRAELDPEKTVMDNLAEG  407 (632)
T ss_pred             EEEEEECCCC----CCCCEEEEECCCCCCHHHHHHHHHCC-CCCCCCEEEECCCCEEEEEHHHHHHCCCCCCHHHHHHHC
T ss_conf             6776533335----78877999889884277999986066-689987799899870775515476459768699999732


Q ss_pred             CCHHHH-------------------------------HHHHHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             532899-------------------------------9999999999589985699932588988056799999999999
Q gi|254780750|r  710 RSTFMV-------------------------------EMIETASILNQATNQSFVILDEIGRGTATLDGLSIAWATIEYL  758 (920)
Q Consensus       710 ~STF~v-------------------------------Em~e~~~IL~~at~~SLVllDElGrGTst~DG~aiA~aile~l  758 (920)
                      ....+.                               |-..++-..--+++-.|.||||-   |+-.|=.++ .+.-+.|
T Consensus       408 ~~~~~~~~~~r~~~~~L~~f~f~~~~~~~~v~~LSGGEk~Rl~LA~~l~~~pnlLiLDEP---TNhLDi~s~-e~Le~aL  483 (632)
T PRK11147        408 KQEVMVNGKPRHVLGYLQDFLFHPKRAMTPVKALSGGERNRLLLARLFLKPSNLLILDEP---TNDLDVETL-ELLEELL  483 (632)
T ss_pred             CHHCCCCHHHHHHHHHHHHHCCCHHHHCCCCCCCCHHHHHHHHHHHHHCCCCCEEEEECC---CCCCCHHHH-HHHHHHH
T ss_conf             321011558999999999857798896391553999999999999985779978999898---765799999-9999999


Q ss_pred             HHHCCCEEEEECCCHHHHH
Q ss_conf             9726984999748757976
Q gi|254780750|r  759 HETNRCRGLLATHFHELTD  777 (920)
Q Consensus       759 ~~~~~~~~lfaTHy~eL~~  777 (920)
                      .+-.| -.||+||.....+
T Consensus       484 ~~y~G-tvl~VSHDr~fl~  501 (632)
T PRK11147        484 DSYQG-TLLLVSHDRQFVD  501 (632)
T ss_pred             HHCCC-EEEEEECCHHHHH
T ss_conf             85898-3999979899998


No 149
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms]
Probab=97.59  E-value=0.0054  Score=40.80  Aligned_cols=128  Identities=28%  Similarity=0.369  Sum_probs=74.5

Q ss_pred             CEEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHH-CCC-----------------CCC-
Q ss_conf             0444345635877776643999967784407899999999999997198530353-206-----------------822-
Q gi|254780750|r  633 PFIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASY-AHI-----------------GIV-  693 (920)
Q Consensus       633 ~fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~-a~i-----------------~~~-  693 (920)
                      +.|=+|++|..+    .+...-|.|+|.+||||++|-+        .|.|.|-+- -.+                 +.| 
T Consensus       486 ~~vL~~isL~I~----~Ge~vaIvG~SGsGKSTL~KLL--------~gly~p~~G~I~~dg~dl~~i~~~~lR~~ig~V~  553 (709)
T COG2274         486 PPVLEDLSLEIP----PGEKVAIVGRSGSGKSTLLKLL--------LGLYKPQQGRILLDGVDLNDIDLASLRRQVGYVL  553 (709)
T ss_pred             CCHHHCEEEEEC----CCCEEEEECCCCCCHHHHHHHH--------HCCCCCCCCEEEECCEEHHHCCHHHHHHHEEEEC
T ss_conf             441215027767----9988999879999889999998--------3678888855999987278669999986546874


Q ss_pred             --CEEEEEEECCCCCCCCCCHH-HHHHHHHHHH----------------------------------HHH--CCCCCEEE
Q ss_conf             --10567652376611385328-9999999999----------------------------------995--89985699
Q gi|254780750|r  694 --DKLFSRVGSADNLASGRSTF-MVEMIETASI----------------------------------LNQ--ATNQSFVI  734 (920)
Q Consensus       694 --D~IftRiGa~D~l~~g~STF-~vEm~e~~~I----------------------------------L~~--at~~SLVl  734 (920)
                        +.+|++- -.|||..|.-.- +-|..+.+.+                                  |-.  ..+...+|
T Consensus       554 Q~~~Lf~gS-I~eNi~l~~p~~~~e~i~~A~~~ag~~~fI~~lP~gy~t~v~E~G~~LSGGQrQrlalARaLl~~P~ILl  632 (709)
T COG2274         554 QDPFLFSGS-IRENIALGNPEATDEEIIEAAQLAGAHEFIENLPMGYDTPVGEGGANLSGGQRQRLALARALLSKPKILL  632 (709)
T ss_pred             CCCHHHCCC-HHHHHHCCCCCCCHHHHHHHHHHHCCHHHHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCEEE
T ss_conf             665320473-9879746899999799999999837689998360545623204898888889999999998546999899


Q ss_pred             EECCCCCCCHHHHHHHHHHHHHHHHHHC-CCEEEEECCCHHHHH
Q ss_conf             9325889880567999999999999726-984999748757976
Q gi|254780750|r  735 LDEIGRGTATLDGLSIAWATIEYLHETN-RCRGLLATHFHELTD  777 (920)
Q Consensus       735 lDElGrGTst~DG~aiA~aile~l~~~~-~~~~lfaTHy~eL~~  777 (920)
                      +||=   ||..|=.+-+ .|.+.|.+.. ++.+++.||-+....
T Consensus       633 LDEa---TSaLD~~sE~-~I~~~L~~~~~~~T~I~IaHRl~ti~  672 (709)
T COG2274         633 LDEA---TSALDPETEA-IILQNLLQILQGRTVIIIAHRLSTIR  672 (709)
T ss_pred             EECC---CCCCCHHHHH-HHHHHHHHHHCCCEEEEEECCCHHHH
T ss_conf             7074---2236986799-99999999845886999976616864


No 150
>PRK13651 cobalt transporter ATP-binding subunit; Provisional
Probab=97.59  E-value=0.0013  Score=45.49  Aligned_cols=48  Identities=21%  Similarity=0.214  Sum_probs=33.8

Q ss_pred             CCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHH
Q ss_conf             89985699932588988056799999999999972698499974875797
Q gi|254780750|r  727 ATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFHELT  776 (920)
Q Consensus       727 at~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~  776 (920)
                      |.+-.++|+||--.|-++..-.-| +.++..|.+. +-.++++||.-+..
T Consensus       177 a~~P~iLlLDEPTagLDp~~~~~i-~~~l~~L~~~-G~TVI~vTHdm~~v  224 (304)
T PRK13651        177 AMEPDFLVFDEPTAGLDPQGVKEI-LEIFDTLNKK-GKTIILVTHDLDNV  224 (304)
T ss_pred             HCCCCEEEECCCCCCCCHHHHHHH-HHHHHHHHHC-CCEEEEECCCHHHH
T ss_conf             459999997298665898999999-9999999977-99999986789999


No 151
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP.  Probably responsible for the translocation of thiamine across the membrane. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=97.58  E-value=0.0034  Score=42.30  Aligned_cols=129  Identities=23%  Similarity=0.324  Sum_probs=67.0

Q ss_pred             EEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHCCC-----------------CCC---CEEE
Q ss_conf             45635877776643999967784407899999999999997198530353206-----------------822---1056
Q gi|254780750|r  638 DCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHI-----------------GIV---DKLF  697 (920)
Q Consensus       638 di~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a~i-----------------~~~---D~If  697 (920)
                      +++|..    ..+.+..|-|||-+||||+||.++        |...|- +-++                 +.+   ..+|
T Consensus        16 ~i~l~i----~~Ge~~~ilGpSGsGKSTLl~li~--------Gl~~p~-sG~I~i~G~di~~~~~~~r~ig~vfQ~~~L~   82 (211)
T cd03298          16 HFDLTF----AQGEITAIVGPSGSGKSTLLNLIA--------GFETPQ-SGRVLINGVDVTAAPPADRPVSMLFQENNLF   82 (211)
T ss_pred             EEEEEE----CCCCEEEEECCCCCHHHHHHHHHH--------CCCCCC-CEEEEECCEECCCCCHHHCCEEEEECCCCCC
T ss_conf             278898----899899999999955999999997--------699988-5299999999999998898679995388668


Q ss_pred             EEEECCCCCCCCCCH---HHHH-------HHH---HHHHH------------------H-HCCCCCEEEEECCCCCCCHH
Q ss_conf             765237661138532---8999-------999---99999------------------9-58998569993258898805
Q gi|254780750|r  698 SRVGSADNLASGRST---FMVE-------MIE---TASIL------------------N-QATNQSFVILDEIGRGTATL  745 (920)
Q Consensus       698 tRiGa~D~l~~g~ST---F~vE-------m~e---~~~IL------------------~-~at~~SLVllDElGrGTst~  745 (920)
                      ..+-..||+.-|.+-   +-.|       +.+   ....+                  | -+++-.++|+||--.+=++.
T Consensus        83 p~ltV~eNi~~~l~~~~~~~~~~~~~v~~~l~~~gl~~~~~~~p~~LSGGqkQRvaiARAL~~~P~ilLlDEPts~LD~~  162 (211)
T cd03298          83 AHLTVEQNVGLGLSPGLKLTAEDRQAIEVALARVGLAGLEKRLPGELSGGERQRVALARVLVRDKPVLLLDEPFAALDPA  162 (211)
T ss_pred             CCCCHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHHCCHHHCCHHHHHHHHHHHHHHCCCCEEEECCCCCCCCHH
T ss_conf             99949999875886468882999999999998769987872894558989999999999986599999971887655989


Q ss_pred             HHHHHHHHHHHHHHHHCCCEEEEECCCHHHHH-HHH
Q ss_conf             67999999999999726984999748757976-643
Q gi|254780750|r  746 DGLSIAWATIEYLHETNRCRGLLATHFHELTD-LSK  780 (920)
Q Consensus       746 DG~aiA~aile~l~~~~~~~~lfaTHy~eL~~-l~~  780 (920)
                      --.. -+..+..+.+..+..++++||..+.+. +++
T Consensus       163 ~~~~-l~~~l~~l~~~~~~Tvi~vTHd~~ea~~~ad  197 (211)
T cd03298         163 LRAE-MLDLVLDLHAETKMTVLMVTHQPEDAKRLAQ  197 (211)
T ss_pred             HHHH-HHHHHHHHHHHHCCEEEEECCCHHHHHHHCC
T ss_conf             9999-9999999999749989999889999999699


No 152
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional
Probab=97.58  E-value=0.00075  Score=47.22  Aligned_cols=52  Identities=17%  Similarity=0.186  Sum_probs=32.7

Q ss_pred             CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHH-HHHHH
Q ss_conf             9985699932588988056799999999999972698499974875797-66430
Q gi|254780750|r  728 TNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFHELT-DLSKS  781 (920)
Q Consensus       728 t~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~-~l~~~  781 (920)
                      +.-.++|+||--+|=+..--..| +..+..|.+. +.-++|.||..+.. .+.+.
T Consensus       408 ~~p~iLilDEPTsGLD~~~~~~i-~~ll~~l~~~-G~~il~iSHDl~~~~~~~DR  460 (491)
T PRK10982        408 TQPEILMLDEPTRGIDVGAKFEI-YQLIAELAKK-DKGIIIISSEMPELLGITDR  460 (491)
T ss_pred             HCCCEEEEECCCCCCCHHHHHHH-HHHHHHHHHC-CCEEEEEECCHHHHHHHCCE
T ss_conf             49988999787557999999999-9999999968-99999995858999986999


No 153
>PRK10762 D-ribose transporter ATP binding protein; Provisional
Probab=97.58  E-value=0.0003  Score=50.17  Aligned_cols=53  Identities=21%  Similarity=0.191  Sum_probs=36.1

Q ss_pred             CCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHH-HHHHH
Q ss_conf             89985699932588988056799999999999972698499974875797-66430
Q gi|254780750|r  727 ATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFHELT-DLSKS  781 (920)
Q Consensus       727 at~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~-~l~~~  781 (920)
                      ++.-.++|+||--+|=+..--..| |..+..+.+. |.-++|.||.-+.. ++++.
T Consensus       411 ~~~p~lLilDEPT~GLD~~~~~~i-~~ll~~l~~~-G~til~isHDl~~v~~~aDR  464 (501)
T PRK10762        411 MTRPKVLILDEPTRGVDVGAKKEI-YQLINQFKAD-GLSIILVSSEMPEVLGMSDR  464 (501)
T ss_pred             HCCCCEEEEECCCCCCCHHHHHHH-HHHHHHHHHC-CCEEEEEECCHHHHHHHCCE
T ss_conf             729988999798668999999999-9999999967-99999991868999986999


No 154
>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=97.58  E-value=0.0025  Score=43.27  Aligned_cols=50  Identities=16%  Similarity=0.147  Sum_probs=34.2

Q ss_pred             CCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHH
Q ss_conf             899856999325889880567999999999999726984999748757976
Q gi|254780750|r  727 ATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFHELTD  777 (920)
Q Consensus       727 at~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~~  777 (920)
                      |..-.++|+||--.|=++..- .--+..+..|.+..+...+++||.-+...
T Consensus       157 a~~P~iLlLDEPTagLDp~~~-~~i~~ll~~l~~e~g~TiilvtHd~~~v~  206 (285)
T PRK13636        157 VMEPKVLVLDEPTAGLDPMGV-SEIMKLLVEMQKELGLTIIIATHDIDIVP  206 (285)
T ss_pred             HCCCCEEEEECCCCCCCHHHH-HHHHHHHHHHHHHCCCEEEEECCCHHHHH
T ss_conf             749989999787555999999-99999999999844989999948899999


No 155
>PRK11147 ABC transporter ATPase component; Reviewed
Probab=97.58  E-value=0.0041  Score=41.66  Aligned_cols=13  Identities=23%  Similarity=0.470  Sum_probs=5.5

Q ss_pred             CCCCCHHHHHHCC
Q ss_conf             7764127876301
Q gi|254780750|r  308 GSREQSLLKTIDY  320 (920)
Q Consensus       308 g~~~gSL~~~Ln~  320 (920)
                      |+.|.||+.+|+.
T Consensus        39 GsGKSTLl~iL~G   51 (632)
T PRK11147         39 GAGKSTLMKILSG   51 (632)
T ss_pred             CCHHHHHHHHHHC
T ss_conf             9879999999838


No 156
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE).  The NikABCDE system of E. coli belongs to this family and is composed of the periplasmic binding protein NikA, two integral membrane components (NikB and NikC), and two ATPase (NikD and NikE).  The NikABCDE transporter is synthesized under anaerobic conditions to meet the increased demand for nickel resulting from hydrogenase synthesis.  The molecular mechanism of nickel uptake in many bacteria and most archaea is not known.  Many other members of this ABC family are also involved in the uptake of dipeptides and oligopeptides.  The oligopeptide transport system (Opp) is a five-component ABC transport composed of a membrane-anchored substrate binding proteins (SRP), OppA, two transmembrane proteins, OppB and OppC, and two ATP-binding domains, OppD and OppF.
Probab=97.57  E-value=0.0019  Score=44.24  Aligned_cols=53  Identities=21%  Similarity=0.142  Sum_probs=36.6

Q ss_pred             CCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHH-HHH
Q ss_conf             899856999325889880567999999999999726984999748757976-643
Q gi|254780750|r  727 ATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFHELTD-LSK  780 (920)
Q Consensus       727 at~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~~-l~~  780 (920)
                      +..-.++|+||--.|-++.-..-| +.++..|.+..+.-++++||..+... +++
T Consensus       161 ~~~P~iLllDEPTs~LD~~~~~~i-~~~l~~l~~~~~~tii~vtHd~~~~~~~aD  214 (228)
T cd03257         161 ALNPKLLIADEPTSALDVSVQAQI-LDLLKKLQEELGLTLLFITHDLGVVAKIAD  214 (228)
T ss_pred             CCCCCEEEEECCCCCCCHHHHHHH-HHHHHHHHHHCCCEEEEECCCHHHHHHHCC
T ss_conf             479999999488764799999999-999999998509899998689999999699


No 157
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed
Probab=97.57  E-value=0.00076  Score=47.15  Aligned_cols=16  Identities=25%  Similarity=0.530  Sum_probs=9.4

Q ss_pred             EEEEECCCCCCCCCCHHHH
Q ss_conf             6765237661138532899
Q gi|254780750|r  697 FSRVGSADNLASGRSTFMV  715 (920)
Q Consensus       697 ftRiGa~D~l~~g~STF~v  715 (920)
                      ..=+|.+   -.|+|||+-
T Consensus       353 iaivG~N---GsGKSTLlk  368 (556)
T PRK11819        353 VGIIGPN---GAGKSTLFK  368 (556)
T ss_pred             EEEECCC---CCCHHHHHH
T ss_conf             7898898---775889999


No 158
>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=97.57  E-value=0.0022  Score=43.74  Aligned_cols=53  Identities=21%  Similarity=0.188  Sum_probs=33.5

Q ss_pred             CCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHH-HHHH
Q ss_conf             89985699932588988056799999999999972698499974875797-6643
Q gi|254780750|r  727 ATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFHELT-DLSK  780 (920)
Q Consensus       727 at~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~-~l~~  780 (920)
                      |..-.++|+||--.|=++.-... -+.++..|.+..+..++++||.-+.. .+++
T Consensus       148 a~~P~iLllDEPTs~LD~~~~~~-i~~ll~~L~~e~g~Tii~vTHdl~~~~~~aD  201 (276)
T PRK13634        148 AMEPEVLVLDEPTAGLDPKGRKE-IMEMFYKLHKEKGLTTVLVTHSMEDAARYAD  201 (276)
T ss_pred             HCCCCEEEECCCCCCCCHHHHHH-HHHHHHHHHHHCCCEEEEECCCHHHHHHHCC
T ss_conf             72999899769854279999999-9999999999619999998679999999799


No 159
>COG4586 ABC-type uncharacterized transport system, ATPase component [General function prediction only]
Probab=97.56  E-value=0.00068  Score=47.51  Aligned_cols=147  Identities=24%  Similarity=0.334  Sum_probs=77.0

Q ss_pred             EEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHH-HHHHHH---HCCCCCCHH-----HCCCCCC----C---------
Q ss_conf             34563587777664399996778440789999999-999999---719853035-----3206822----1---------
Q gi|254780750|r  637 NDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNA-LIVIMA---QMGSYVPAS-----YAHIGIV----D---------  694 (920)
Q Consensus       637 Ndi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqva-l~vilA---QiG~fVPA~-----~a~i~~~----D---------  694 (920)
                      -|+++..+    .+.+...-|||.+||||.||..- ++.-.+   -+|.++|=.     -..++.|    -         
T Consensus        41 qdisf~IP----~G~ivgflGaNGAGKSTtLKmLTGll~p~~G~v~V~G~~Pf~~~~~~~~~~~~v~gqk~ql~Wdlp~~  116 (325)
T COG4586          41 QDISFEIP----KGEIVGFLGANGAGKSTTLKMLTGLLLPTSGKVRVNGKDPFRRREEYLRSIGLVMGQKLQLWWDLPAL  116 (325)
T ss_pred             HEEEEECC----CCCEEEEECCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCHHHHHHHHHHHHHHHHHHEEEEECHHH
T ss_conf             51145348----98689887588886033398973860368875874586852337999988788763222025623025


Q ss_pred             ------EEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHC-------------------CCCCEEEEECCCCCCCHHHHHH
Q ss_conf             ------056765237661138532899999999999958-------------------9985699932588988056799
Q gi|254780750|r  695 ------KLFSRVGSADNLASGRSTFMVEMIETASILNQA-------------------TNQSFVILDEIGRGTATLDGLS  749 (920)
Q Consensus       695 ------~IftRiGa~D~l~~g~STF~vEm~e~~~IL~~a-------------------t~~SLVllDElGrGTst~DG~a  749 (920)
                            ++.-+||  |+-++..=-|++||.+....|+.-                   -+--.+.|||.-=|-+-.--.+
T Consensus       117 ds~~v~~~Iy~Ip--d~~F~~r~~~l~eiLdl~~~lk~~vr~LSlGqRmraeLaaaLLh~p~VLfLDEpTvgLDV~aq~~  194 (325)
T COG4586         117 DSLEVLKLIYEIP--DDEFAERLDFLTEILDLEGFLKWPVRKLSLGQRMRAELAAALLHPPKVLFLDEPTVGLDVNAQAN  194 (325)
T ss_pred             HHHHHHHHHHHCC--HHHHHHHHHHHHHHHCCHHHHHHHHHHCCCHHHHHHHHHHHHCCCCCEEEECCCCCCCCHHHHHH
T ss_conf             4699999997198--89999999889998632456401356536057889999998568983897448745751438999


Q ss_pred             HHHHHHHHHHHHCCCEEEEECCC-HHHHHHHHHCCCEEEEEE
Q ss_conf             99999999997269849997487-579766430688589999
Q gi|254780750|r  750 IAWATIEYLHETNRCRGLLATHF-HELTDLSKSLKRFHNATL  790 (920)
Q Consensus       750 iA~aile~l~~~~~~~~lfaTHy-~eL~~l~~~~~~v~n~~~  790 (920)
                      |-..+-||=.+ -+|.+|.+||| ..++.+.+..-.+.+..+
T Consensus       195 ir~Flke~n~~-~~aTVllTTH~~~di~~lc~rv~~I~~Gql  235 (325)
T COG4586         195 IREFLKEYNEE-RQATVLLTTHIFDDIATLCDRVLLIDQGQL  235 (325)
T ss_pred             HHHHHHHHHHH-HCCEEEEEECCHHHHHHHHHHEEEEECCCE
T ss_conf             99999998775-373699984112138886343699607828


No 160
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism]
Probab=97.56  E-value=0.00086  Score=46.75  Aligned_cols=129  Identities=26%  Similarity=0.290  Sum_probs=73.7

Q ss_pred             CCEEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHH--------------------HHHHCCCCCCHHH---C
Q ss_conf             7044434563587777664399996778440789999999999--------------------9997198530353---2
Q gi|254780750|r  632 KPFIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIV--------------------IMAQMGSYVPASY---A  688 (920)
Q Consensus       632 ~~fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~v--------------------ilAQiG~fVPA~~---a  688 (920)
                      ...|-+|+++..    ..+.+.-|=|||.+||||+||.++=+.                    -+|+.=+|||-+.   .
T Consensus        14 ~~~il~~ls~~i----~~G~i~~iiGpNG~GKSTLLk~l~~~l~p~~G~V~l~g~~i~~~~~kelAk~ia~vpQ~~~~~~   89 (258)
T COG1120          14 GKPILDDLSFSI----PKGEITGILGPNGSGKSTLLKCLAGLLKPKSGEVLLDGKDIASLSPKELAKKLAYVPQSPSAPF   89 (258)
T ss_pred             CEEEEECCEEEE----CCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCEEEECCCCHHHCCHHHHHHHEEEECCCCCCCC
T ss_conf             916872236886----5997999989988899999999865678888779999972454698887561899356788999


Q ss_pred             CCCCCCEEEEEEECCCCCCCC----CCHHH---------H-HHHHHHHHH----------------------HHCCCCCE
Q ss_conf             068221056765237661138----53289---------9-999999999----------------------95899856
Q gi|254780750|r  689 HIGIVDKLFSRVGSADNLASG----RSTFM---------V-EMIETASIL----------------------NQATNQSF  732 (920)
Q Consensus       689 ~i~~~D~IftRiGa~D~l~~g----~STF~---------v-Em~e~~~IL----------------------~~at~~SL  732 (920)
                      .++++|          -+..|    ++.|.         | +..+.-.+.                      --|.+-.+
T Consensus        90 ~~tV~d----------~V~~GR~p~~~~~~~~~~~D~~~v~~aL~~~~~~~la~r~~~~LSGGerQrv~iAraLaQ~~~i  159 (258)
T COG1120          90 GLTVYE----------LVLLGRYPHLGLFGRPSKEDEEIVEEALELLGLEHLADRPVDELSGGERQRVLIARALAQETPI  159 (258)
T ss_pred             CCEEEE----------HHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCHHHHCCCCCCCCHHHHHHHHHHHHHHCCCCE
T ss_conf             958736----------1742677465533578876899999999982947776685511686688999999998458997


Q ss_pred             EEEECCCCCCCHHHH-HHH-HHHHHHHHHHHCCCEEEEECCCHHHHH
Q ss_conf             999325889880567-999-999999999726984999748757976
Q gi|254780750|r  733 VILDEIGRGTATLDG-LSI-AWATIEYLHETNRCRGLLATHFHELTD  777 (920)
Q Consensus       733 VllDElGrGTst~DG-~ai-A~aile~l~~~~~~~~lfaTHy~eL~~  777 (920)
                      +|+||-   ||..|= -.+ -..++..|.+..+.-+++++|...++.
T Consensus       160 LLLDEP---Ts~LDi~~Q~evl~ll~~l~~~~g~tvv~vlHDln~A~  203 (258)
T COG1120         160 LLLDEP---TSHLDIAHQIEVLELLRDLNREKGLTVVMVLHDLNLAA  203 (258)
T ss_pred             EEECCC---CCCCCHHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHH
T ss_conf             882797---20038777999999999999855978999955988999


No 161
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=97.55  E-value=0.0016  Score=44.69  Aligned_cols=52  Identities=21%  Similarity=0.263  Sum_probs=34.7

Q ss_pred             CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHH-HHH
Q ss_conf             99856999325889880567999999999999726984999748757976-643
Q gi|254780750|r  728 TNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFHELTD-LSK  780 (920)
Q Consensus       728 t~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~~-l~~  780 (920)
                      .+-.++|+||--.|=++..-..| |..+..|.+..+...+++||.-+... +++
T Consensus       154 ~~P~lLlLDEPtagLDp~~~~~i-~~~l~~l~~~~g~Tii~vtHdl~~v~~~aD  206 (277)
T PRK13652        154 MEPQVLVLDEPTAGLDPQGVKEL-FDFLNALPETYGMTVIFSTHQVELVAEMAD  206 (277)
T ss_pred             HCCCEEEECCCCCCCCHHHHHHH-HHHHHHHHHHCCCEEEEECCCHHHHHHHCC
T ss_conf             29999998397454899999999-999999998509899999148999999799


No 162
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=97.55  E-value=0.0013  Score=45.55  Aligned_cols=87  Identities=16%  Similarity=0.228  Sum_probs=48.8

Q ss_pred             CCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHH-HHHHHCCCEEEEEEEEEEECCEEEEEEEE
Q ss_conf             89985699932588988056799999999999972698499974875797-66430688589999999609927787777
Q gi|254780750|r  727 ATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFHELT-DLSKSLKRFHNATLQVSDSNEGIIFLHKV  805 (920)
Q Consensus       727 at~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~-~l~~~~~~v~n~~~~~~~~~~~i~flykl  805 (920)
                      +..-.++|+||--.|=++..-..| +.++..|.+. +..++++||.-+.. .+++.   +..      -.+++|     +
T Consensus       152 ~~~P~lLlLDEPtagLD~~~~~~i-~~ll~~l~~~-G~tiiivsHdl~~v~~~aDr---v~v------l~~G~i-----v  215 (271)
T PRK13638        152 VLQARYLLLDEPTAGLDPAGRTQM-IAIIRRIVAQ-GNHVIISSHDIDLIYEISDA---VYV------LRQGQI-----L  215 (271)
T ss_pred             HCCCCEEEECCCCCCCCHHHHHHH-HHHHHHHHHC-CCEEEEECCCHHHHHHHCCE---EEE------EECCEE-----E
T ss_conf             659998998387545899999999-9999999978-99999984888999996999---999------989989-----9


Q ss_pred             EECCCCCCHH-HHHHHHCCCCHHHH
Q ss_conf             4478988778-99999829998999
Q gi|254780750|r  806 IPGIADHSYG-IQVGKLAGLPNTVI  829 (920)
Q Consensus       806 ~~G~~~~Syg-i~vA~laG~p~~vi  829 (920)
                      ..|.+..=|. -++=+.+|+..+.+
T Consensus       216 a~Gtp~ev~~~~~~~~~~g~~~p~~  240 (271)
T PRK13638        216 THGAPGEVFACTEAMEQAGLTQPWL  240 (271)
T ss_pred             EECCHHHHHCCHHHHHHCCCCCCHH
T ss_conf             9868999968989999769999879


No 163
>PRK10908 cell division protein FtsE; Provisional
Probab=97.54  E-value=0.0024  Score=43.43  Aligned_cols=134  Identities=21%  Similarity=0.192  Sum_probs=69.4

Q ss_pred             EEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCC------CCCC---H-H----HCCCCCC---CEEE
Q ss_conf             4434563587777664399996778440789999999999999719------8530---3-5----3206822---1056
Q gi|254780750|r  635 IANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMG------SYVP---A-S----YAHIGIV---DKLF  697 (920)
Q Consensus       635 VpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG------~fVP---A-~----~a~i~~~---D~If  697 (920)
                      |=+|++|..    ..+.+..|.|||-+||||+||.++=+.-- .-|      --|.   . +    ...++.+   +.+|
T Consensus        17 ~L~~vsl~i----~~Ge~~~liG~nGsGKSTLl~~i~Gl~~p-~~G~i~~~g~~i~~~~~~~~~~~r~~ig~v~Q~~~l~   91 (222)
T PRK10908         17 ALQGVTFHM----RPGEMAFLTGHSGAGKSTLLKLICGIERP-SAGKIWFSGHDITRLKNREVPFLRRQIGMIFQDHHLL   91 (222)
T ss_pred             EEECCEEEE----CCCCEEEEECCCCCHHHHHHHHHHCCCCC-CCEEEEECCEECCCCCHHHHHHHHHCCEEECCCCCCC
T ss_conf             986438799----69989999999980799999999659999-8629999999987566667799873024774683016


Q ss_pred             EEEECCCCCCCC-----CCHHHH-----HHHH------------------------HHHHHHHCCCCCEEEEECCCCCCC
Q ss_conf             765237661138-----532899-----9999------------------------999999589985699932588988
Q gi|254780750|r  698 SRVGSADNLASG-----RSTFMV-----EMIE------------------------TASILNQATNQSFVILDEIGRGTA  743 (920)
Q Consensus       698 tRiGa~D~l~~g-----~STF~v-----Em~e------------------------~~~IL~~at~~SLVllDElGrGTs  743 (920)
                      ..+-..||+.-+     .+.--.     |+.+                        +|..  -+.+-.++|+||--.|=+
T Consensus        92 ~~~tv~eni~~~~~~~~~~~~~~~~~~~~~l~~~gl~~~~~~~p~~LSGGq~QRvaiAra--L~~~P~iLllDEPt~~LD  169 (222)
T PRK10908         92 MDRTVYDNVAIPLIIAGASGDDIRRRVSAALDKVGLLDKAKNFPIQLSGGEQQRVGIARA--VVNKPAVLLADEPTGNLD  169 (222)
T ss_pred             CCCEEEHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHHCCCCCCCHHHHHHHHHHHH--HHCCCCEEEEECCCCCCC
T ss_conf             897700456578988499989999999999987487657648876689689999999999--976999999909876679


Q ss_pred             HHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHH
Q ss_conf             0567999999999999726984999748757976
Q gi|254780750|r  744 TLDGLSIAWATIEYLHETNRCRGLLATHFHELTD  777 (920)
Q Consensus       744 t~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~~  777 (920)
                      +..-..+ +.+++.+.+ .+.-++++||..+...
T Consensus       170 ~~~~~~v-~~~l~~l~~-~g~tvl~vtHd~~~~~  201 (222)
T PRK10908        170 DALSEGI-LRLFEEFNR-VGVTVLMATHDIGLIS  201 (222)
T ss_pred             HHHHHHH-HHHHHHHHH-CCCEEEEECCCHHHHH
T ss_conf             9999999-999999986-1999999947999999


No 164
>PRK13549 xylose transporter ATP-binding subunit; Provisional
Probab=97.53  E-value=0.00056  Score=48.13  Aligned_cols=53  Identities=23%  Similarity=0.196  Sum_probs=35.4

Q ss_pred             CCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHH-HHHHH
Q ss_conf             89985699932588988056799999999999972698499974875797-66430
Q gi|254780750|r  727 ATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFHELT-DLSKS  781 (920)
Q Consensus       727 at~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~-~l~~~  781 (920)
                      ++.-.++|+||--+|=+..--..| |..+..|.+. |.-++|.||.-+.. ++++.
T Consensus       421 ~~~P~iLilDEPT~GLD~~~~~~i-~~ll~~l~~~-G~tvl~iSHDl~~v~~~aDR  474 (513)
T PRK13549        421 LLNPRILILDEPTRGIDVGAKYEI-YKLINQLVQQ-GVAIIVISSELPEVLGLSDR  474 (513)
T ss_pred             HCCCCEEEEECCCCCCCHHHHHHH-HHHHHHHHHC-CCEEEEEECCHHHHHHHCCE
T ss_conf             719989999798668999999999-9999999957-99999991868999986999


No 165
>PRK13633 cobalt transporter ATP-binding subunit; Provisional
Probab=97.53  E-value=0.00063  Score=47.77  Aligned_cols=130  Identities=21%  Similarity=0.279  Sum_probs=67.0

Q ss_pred             EEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHH-C------------------CCCCC-
Q ss_conf             444345635877776643999967784407899999999999997198530353-2------------------06822-
Q gi|254780750|r  634 FIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASY-A------------------HIGIV-  693 (920)
Q Consensus       634 fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~-a------------------~i~~~-  693 (920)
                      .+=+||++..    ..+.+.-|-|||-+||||++|.++        |...|-+- .                  .++.+ 
T Consensus        25 ~al~~Isl~i----~~GE~v~iiG~nGsGKSTL~r~l~--------gl~~P~~G~I~i~G~~~~~~~~~~~~r~~ig~vf   92 (281)
T PRK13633         25 IALDDVNLEV----KKGEFLVILGHNGSGKSTIAKHMN--------ALLLPSEGKVYVDGLDTSDEENLWDIRNKAGMVF   92 (281)
T ss_pred             CEEECEEEEE----CCCCEEEEECCCCCHHHHHHHHHH--------CCCCCCCCEEEECCEECCCHHHHHHHHHCEEEEE
T ss_conf             2673407688----799899999999984999999997--------5887888569999998788566999873608986


Q ss_pred             ----CEEEEEEECCCCCCCCCCHHH---HHHH-HHHHHHH----------------------------HCCCCCEEEEEC
Q ss_conf             ----105676523766113853289---9999-9999999----------------------------589985699932
Q gi|254780750|r  694 ----DKLFSRVGSADNLASGRSTFM---VEMI-ETASILN----------------------------QATNQSFVILDE  737 (920)
Q Consensus       694 ----D~IftRiGa~D~l~~g~STF~---vEm~-e~~~IL~----------------------------~at~~SLVllDE  737 (920)
                          +.+|... ..|++.-|...+.   .|+. .+..+|+                            -|..-.++|+||
T Consensus        93 Q~P~~~l~~~t-V~e~i~fg~~~~g~~~~e~~~rv~~~l~~~gL~~~~~~~p~~LSGGqkQRvaiA~aLa~~P~iLilDE  171 (281)
T PRK13633         93 QNPDNQIVATI-VEEDVAFGPENLGIPPEEIRERVDESLKKVGMYEYRRHAPHLLSGGQKQRVAIAGILAMRPECIIFDE  171 (281)
T ss_pred             ECCCCCCCHHH-HHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHHCCCHHCCHHHHHHHHHHHHHHCCCCEEEEEC
T ss_conf             68864202889-99999988988699999999999999986794876638910089859999999999985999999818


Q ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHH
Q ss_conf             5889880567999999999999726984999748757976
Q gi|254780750|r  738 IGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFHELTD  777 (920)
Q Consensus       738 lGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~~  777 (920)
                      --.|=++.--. --+..+..|.+..+..++|+||+-+...
T Consensus       172 PTs~LDp~~~~-~i~~~l~~l~~e~g~Tii~vTHdl~~~~  210 (281)
T PRK13633        172 PTAMLDPSGRR-EVVNTIKELNKKYGITIILITHYMEEAV  210 (281)
T ss_pred             CCCCCCHHHHH-HHHHHHHHHHHHCCCEEEEECCCHHHHH
T ss_conf             73438989999-9999999999840989999867889997


No 166
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional
Probab=97.52  E-value=0.0034  Score=42.34  Aligned_cols=33  Identities=39%  Similarity=0.650  Sum_probs=24.5

Q ss_pred             EEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHH
Q ss_conf             4434563587777664399996778440789999999
Q gi|254780750|r  635 IANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNA  671 (920)
Q Consensus       635 VpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqva  671 (920)
                      |-+|+++..    ..+.++-|.|||-+||||++|.++
T Consensus       275 vl~~vs~~v----~~GE~~~i~G~nGsGKSTLl~~l~  307 (490)
T PRK10938        275 ILNNLSWQV----NPGEHWQIVGPNGAGKSTLLSLIT  307 (490)
T ss_pred             EEEEEEEEE----CCCCEEEEECCCCCCHHHHHHHHH
T ss_conf             885357898----389889998678887999999980


No 167
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional
Probab=97.52  E-value=0.0031  Score=42.55  Aligned_cols=52  Identities=19%  Similarity=0.155  Sum_probs=33.8

Q ss_pred             CCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHH-HHHH
Q ss_conf             89985699932588988056799999999999972698499974875797-6643
Q gi|254780750|r  727 ATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFHELT-DLSK  780 (920)
Q Consensus       727 at~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~-~l~~  780 (920)
                      +.+--++|+||--.|-++.--..| +.++..|.+. +.-.+++||.-+.. .+++
T Consensus       157 ~~~P~iLllDEPTs~LD~~~~~~i-~~ll~~l~~~-g~tii~vtHdl~~~~~~ad  209 (242)
T PRK11124        157 MMEPQVLLFDEPTAALDPEITAQI-VSIIRELAET-GITQVIVTHEVEVARKTAS  209 (242)
T ss_pred             CCCCCEEEECCCCCCCCHHHHHHH-HHHHHHHHHC-CCEEEEECCCHHHHHHHCC
T ss_conf             379979997688654899999999-9999999842-9989998889999999699


No 168
>PRK10636 putative ABC transporter ATP-binding protein; Provisional
Probab=97.52  E-value=0.00053  Score=48.34  Aligned_cols=134  Identities=20%  Similarity=0.115  Sum_probs=64.3

Q ss_pred             EEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHCCCCCCCEEEEE-EECCCCCCCCCCH
Q ss_conf             444345635877776643999967784407899999999999997198530353206822105676-5237661138532
Q gi|254780750|r  634 FIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHIGIVDKLFSR-VGSADNLASGRST  712 (920)
Q Consensus       634 fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a~i~~~D~IftR-iGa~D~l~~g~ST  712 (920)
                      .|-+|+++..    ..+..+-|.|||-+||||+||.++=. +=..-|...-+...+++-|++-... +-....+......
T Consensus       326 ~vl~~vsl~i----~~GeriaIvG~NGsGKSTLlk~L~G~-l~p~~G~i~~~~~v~igy~~Q~~~~~l~~~~t~l~~~~~  400 (638)
T PRK10636        326 IILDSIKLNL----VPGSRIGLLGRNGAGKSTLIKLLAGE-LAPVSGEIGLAKGIKLGYFAQHQLEFLRADESPLQHLAR  400 (638)
T ss_pred             CCCCCCCCEE----CCCCEEEEECCCCCCHHHHHHHHCCC-CCCCCCEEEECCCCCCCCCHHHHHHHCCCHHHHHHHHHH
T ss_conf             2013775056----37847999747871388999997288-788885699844443341107677650611249999988


Q ss_pred             H---H----------------------------HHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             8---9----------------------------99999999999589985699932588988056799999999999972
Q gi|254780750|r  713 F---M----------------------------VEMIETASILNQATNQSFVILDEIGRGTATLDGLSIAWATIEYLHET  761 (920)
Q Consensus       713 F---~----------------------------vEm~e~~~IL~~at~~SLVllDElGrGTst~DG~aiA~aile~l~~~  761 (920)
                      +   .                            -|-..++-..--+.+-.+.||||-   |+-.|=.++- +.-+.|.+-
T Consensus       401 ~~~~~~~~~~r~~L~~f~f~~~~~~~~v~~LSGGEk~Rl~LA~~l~~~pnlLiLDEP---TNhLDi~s~e-~Le~aL~~y  476 (638)
T PRK10636        401 LAPQELEQKLRDYLGGFGFQGDKVTEETRRFSGGEKARLVLALIVWQRPNLLLLDEP---TNHLDLDMRQ-ALTEALIDF  476 (638)
T ss_pred             HCHHHHHHHHHHHHHHCCCCHHHHCCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECC---CCCCCHHHHH-HHHHHHHHC
T ss_conf             572546999999998668897786391133999999999999998259988998588---7668889999-999999848


Q ss_pred             CCCEEEEECCCHHHHH
Q ss_conf             6984999748757976
Q gi|254780750|r  762 NRCRGLLATHFHELTD  777 (920)
Q Consensus       762 ~~~~~lfaTHy~eL~~  777 (920)
                      .|+ +||++|...+.+
T Consensus       477 ~Gt-vl~VSHDr~fl~  491 (638)
T PRK10636        477 EGA-LVVVSHDRHLLR  491 (638)
T ss_pred             CCE-EEEEECCHHHHH
T ss_conf             983-999978999999


No 169
>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed
Probab=97.51  E-value=0.002  Score=43.95  Aligned_cols=35  Identities=31%  Similarity=0.382  Sum_probs=28.4

Q ss_pred             EEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHH
Q ss_conf             444345635877776643999967784407899999999
Q gi|254780750|r  634 FIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNAL  672 (920)
Q Consensus       634 fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval  672 (920)
                      -|=+|+++..    ..+.++-|.|||-+||||++|.++=
T Consensus        15 ~vL~~isl~i----~~Gei~~iiG~nGaGKSTLl~~i~G   49 (248)
T PRK09580         15 AILRGLNLEV----RPGEVHAIMGPNGSGKSTLSATLAG   49 (248)
T ss_pred             EEEECCEEEE----CCCCEEEEECCCCCCHHHHHHHHHC
T ss_conf             9996518898----4997999999999999999999837


No 170
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=97.51  E-value=0.00073  Score=47.32  Aligned_cols=135  Identities=23%  Similarity=0.277  Sum_probs=69.7

Q ss_pred             EEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCC------CCHH---------HCCCCC-----CC
Q ss_conf             443456358777766439999677844078999999999999971985------3035---------320682-----21
Q gi|254780750|r  635 IANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSY------VPAS---------YAHIGI-----VD  694 (920)
Q Consensus       635 VpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~f------VPA~---------~a~i~~-----~D  694 (920)
                      +=+||+|..    ..+.+.-|-|||-+||||++|.++=+. ..+-|.-      |...         .-.+|.     .+
T Consensus        21 aL~dIsl~I----~~Ge~vaiiG~nGsGKSTLl~~l~Gll-~p~~G~V~~~~~~i~~~~~~~~~~~~~~~vG~VfQ~p~~   95 (288)
T PRK13643         21 ALFDIDLEV----KKGSYTALIGHTGSGKSTLLQHLNGLL-QPTEGKVTVGDIVVSSTSKQKEIKPVRKKVGVVFQFPES   95 (288)
T ss_pred             EEEEEEEEE----CCCCEEEEECCCCCHHHHHHHHHHCCC-CCCCCEEEECCEECCCCCHHHHHHHHHHCEEEEEECCCC
T ss_conf             366336798----599899999999947999999997488-888856999999856877354479877517999977732


Q ss_pred             EEEEEEECCCCCCCCCCHHH---HHHHHH-HHHHH-----------------------------HCCCCCEEEEECCCCC
Q ss_conf             05676523766113853289---999999-99999-----------------------------5899856999325889
Q gi|254780750|r  695 KLFSRVGSADNLASGRSTFM---VEMIET-ASILN-----------------------------QATNQSFVILDEIGRG  741 (920)
Q Consensus       695 ~IftRiGa~D~l~~g~STF~---vEm~e~-~~IL~-----------------------------~at~~SLVllDElGrG  741 (920)
                      .+|... ..|++.-|..-+.   -|+.+. ...|.                             -|..--++|+||--.|
T Consensus        96 ql~~~t-V~e~vafg~~n~g~~~~e~~~~v~~~l~~vgl~d~~~~r~p~~LSGGqkqRvaiA~aLa~~P~vLlLDEPTs~  174 (288)
T PRK13643         96 QLFEET-VLKDVAFGPQNFGIPKEKAEKIAAEKLEMVGLADEFWEKSPFELSGGQMRRVAIAGILAMEPEVLVLDEPTAG  174 (288)
T ss_pred             CCCHHH-HHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHHHCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCC
T ss_conf             024336-9999998999869998999999999999759936675279763999999999999999749999999588555


Q ss_pred             CCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHH
Q ss_conf             880567999999999999726984999748757976
Q gi|254780750|r  742 TATLDGLSIAWATIEYLHETNRCRGLLATHFHELTD  777 (920)
Q Consensus       742 Tst~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~~  777 (920)
                      =++. |..--+.+++.|.+. +..++++||.-+...
T Consensus       175 LDp~-~~~~i~~ll~~l~~~-G~TiI~vtHd~~~v~  208 (288)
T PRK13643        175 LDPK-ARIEMMQLFESIHQS-GQTVVLVTHLMDDVA  208 (288)
T ss_pred             CCHH-HHHHHHHHHHHHHHC-CCEEEEECCCHHHHH
T ss_conf             8999-999999999999953-999999860899999


No 171
>PRK10636 putative ABC transporter ATP-binding protein; Provisional
Probab=97.50  E-value=0.0033  Score=42.45  Aligned_cols=17  Identities=24%  Similarity=0.452  Sum_probs=7.2

Q ss_pred             CCCCCHHHHHHCCCCCC
Q ss_conf             77641278763012343
Q gi|254780750|r  308 GSREQSLLKTIDYSITG  324 (920)
Q Consensus       308 g~~~gSL~~~Ln~t~T~  324 (920)
                      |+.|.||+.+|..-.+|
T Consensus        37 GsGKSTLlklL~G~~~~   53 (638)
T PRK10636         37 GCGKSTLLALLKNEISA   53 (638)
T ss_pred             CCHHHHHHHHHCCCCCC
T ss_conf             98899999998089988


No 172
>PRK11701 phnK phosphonates transport ATP-binding protein; Provisional
Probab=97.50  E-value=0.0013  Score=45.45  Aligned_cols=53  Identities=17%  Similarity=0.120  Sum_probs=34.5

Q ss_pred             CCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHH-HHH
Q ss_conf             899856999325889880567999999999999726984999748757976-643
Q gi|254780750|r  727 ATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFHELTD-LSK  780 (920)
Q Consensus       727 at~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~~-l~~  780 (920)
                      +..-.++|+||--.|=++.--..| +..+..|.+..+.-++|+||.-+... +++
T Consensus       167 ~~~P~llllDEPtsgLD~~~~~~i-~~~l~~l~~~~g~til~vtHdl~~~~~laD  220 (258)
T PRK11701        167 VTHPRLVFMDEPTGGLDVSVQARL-LDLLRGLVVELGLAVVIVTHDLAVARLLAH  220 (258)
T ss_pred             HCCCCEEEECCCCCCCCHHHHHHH-HHHHHHHHHHHCCEEEEECCCHHHHHHHCC
T ss_conf             649999998598656899999999-999999999609899999378899999799


No 173
>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=97.49  E-value=0.0012  Score=45.79  Aligned_cols=129  Identities=23%  Similarity=0.192  Sum_probs=67.6

Q ss_pred             EEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHCCCCCCCEEE---------EEEE----
Q ss_conf             443456358777766439999677844078999999999999971985303532068221056---------7652----
Q gi|254780750|r  635 IANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHIGIVDKLF---------SRVG----  701 (920)
Q Consensus       635 VpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a~i~~~D~If---------tRiG----  701 (920)
                      +=|||++..    ..+.+.-|-|||-+||||++|.+        .|.+-| .+-++.+..+-.         -+||    
T Consensus        22 aL~~is~~i----~~Ge~~aiiG~sGsGKSTL~~~l--------~Gl~~~-~~G~I~~~G~~i~~~~~~~~r~~ig~VfQ   88 (277)
T PRK13642         22 QLNGVSFSI----TKGEWVSIIGQNGSGKSTTARLI--------DGLFEE-FEGIVKIDGERLTAENVWNLRRKIGMVFQ   88 (277)
T ss_pred             EEECEEEEE----CCCCEEEEECCCCCHHHHHHHHH--------HCCCCC-CCCEEEECCEECCCCCHHHHHCCCEEEEE
T ss_conf             644307998----89989999999996899999999--------638998-88489999999985788888517689998


Q ss_pred             ----------CCCCCCCCCCHH---HHHHHH-HHHHHH----------------------------HCCCCCEEEEECCC
Q ss_conf             ----------376611385328---999999-999999----------------------------58998569993258
Q gi|254780750|r  702 ----------SADNLASGRSTF---MVEMIE-TASILN----------------------------QATNQSFVILDEIG  739 (920)
Q Consensus       702 ----------a~D~l~~g~STF---~vEm~e-~~~IL~----------------------------~at~~SLVllDElG  739 (920)
                                -.|++.-|....   --|+.+ +...|.                            -|.+-.++|+||--
T Consensus        89 ~p~~~l~~~tV~e~i~~g~~~~~~~~~e~~~~v~~~l~~~~l~~~~~~~P~~LSGGqrQRvaIA~aLa~~P~ililDEPT  168 (277)
T PRK13642         89 NPDNQFVGATVEDDVAFGMENQGIPREEMIKRVDEALLAVNMLDFKTREPARLSGGQKQRVAVAGIIALRPEIIILDEST  168 (277)
T ss_pred             CCCCCCCCCCHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHHCCHHHCCHHHHHHHHHHHHHHCCCCEEEEECCC
T ss_conf             97632575508888987776669999999999999998779965655791228999999999999996699999995887


Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHH
Q ss_conf             89880567999999999999726984999748757976
Q gi|254780750|r  740 RGTATLDGLSIAWATIEYLHETNRCRGLLATHFHELTD  777 (920)
Q Consensus       740 rGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~~  777 (920)
                      .|=++.-- .--+..+..|.+..+..++|+||.-++..
T Consensus       169 s~LD~~~~-~~i~~ll~~L~~~~~~Tii~iTHdl~~~~  205 (277)
T PRK13642        169 SMLDPTGR-SEIMRVIHEIKDKYHLTVLSITHDLDEAA  205 (277)
T ss_pred             CCCCHHHH-HHHHHHHHHHHHHCCCEEEEEEECHHHHH
T ss_conf             65898999-99999999999816989999945889997


No 174
>COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism]
Probab=97.49  E-value=0.00059  Score=47.96  Aligned_cols=129  Identities=27%  Similarity=0.339  Sum_probs=64.1

Q ss_pred             CCCEEEEEECCCCCCHHHHHHHHHHHHHHHHC-----CCCC---CHH-HCCCCCCC---EEEEEEECCCCCC-----CCC
Q ss_conf             66439999677844078999999999999971-----9853---035-32068221---0567652376611-----385
Q gi|254780750|r  648 NSGKLWLLTGPNMGGKSTFLRQNALIVIMAQM-----GSYV---PAS-YAHIGIVD---KLFSRVGSADNLA-----SGR  710 (920)
Q Consensus       648 ~~~~~~iiTGpNmgGKSt~lRqval~vilAQi-----G~fV---PA~-~a~i~~~D---~IftRiGa~D~l~-----~g~  710 (920)
                      ..+++.=|-|||-+||||.||.+|-..+-.|=     ||-.   |.. .-+||+.-   .+|.|+-+..||.     .|.
T Consensus        26 e~Gei~GlLG~NGAGKTT~LRmiatlL~P~~G~v~idg~d~~~~p~~vrr~IGVl~~e~glY~RlT~rEnl~~Fa~L~~l  105 (245)
T COG4555          26 EEGEITGLLGENGAGKTTLLRMIATLLIPDSGKVTIDGVDTVRDPSFVRRKIGVLFGERGLYARLTARENLKYFARLNGL  105 (245)
T ss_pred             CCCEEEEEECCCCCCCHHHHHHHHHHCCCCCCEEEEEECCCCCCHHHHHHHCCEECCCCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             06649998768988712379999983258886499840021017187752021313776703553089999999999624


Q ss_pred             -----------------------------CHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             -----------------------------328999999999999589985699932588988056799999999999972
Q gi|254780750|r  711 -----------------------------STFMVEMIETASILNQATNQSFVILDEIGRGTATLDGLSIAWATIEYLHET  761 (920)
Q Consensus       711 -----------------------------STF~vEm~e~~~IL~~at~~SLVllDElGrGTst~DG~aiA~aile~l~~~  761 (920)
                                                   ||=|--=.-+|.-|-  -.-|++++||-..|-+-.--- +-.-.+.++-+.
T Consensus       106 ~~~~~kari~~l~k~l~l~~~~~rRv~~~S~G~kqkV~iARAlv--h~P~i~vlDEP~sGLDi~~~r-~~~dfi~q~k~e  182 (245)
T COG4555         106 SRKEIKARIAELSKRLQLLEYLDRRVGEFSTGMKQKVAIARALV--HDPSILVLDEPTSGLDIRTRR-KFHDFIKQLKNE  182 (245)
T ss_pred             HHHHHHHHHHHHHHHHCHHHHHHHHHHHHCHHHHHHHHHHHHHH--CCCCEEEECCCCCCCCHHHHH-HHHHHHHHHHCC
T ss_conf             02678999999998867598998887641400578899999984--398769976898774278799-999999985257


Q ss_pred             CCCEEEEECCC-HHHHHHHH
Q ss_conf             69849997487-57976643
Q gi|254780750|r  762 NRCRGLLATHF-HELTDLSK  780 (920)
Q Consensus       762 ~~~~~lfaTHy-~eL~~l~~  780 (920)
                       +-.++|+||- .|+..+.+
T Consensus       183 -gr~viFSSH~m~EvealCD  201 (245)
T COG4555         183 -GRAVIFSSHIMQEVEALCD  201 (245)
T ss_pred             -CCEEEEECCCHHHHHHHHH
T ss_conf             -9489996131799998613


No 175
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=97.48  E-value=0.00059  Score=47.98  Aligned_cols=53  Identities=15%  Similarity=0.150  Sum_probs=34.9

Q ss_pred             CCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHH-HHHH
Q ss_conf             89985699932588988056799999999999972698499974875797-6643
Q gi|254780750|r  727 ATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFHELT-DLSK  780 (920)
Q Consensus       727 at~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~-~l~~  780 (920)
                      |..-.++|+||--.|=++.- ..--+..+..|....+..++++||.-+.. .+++
T Consensus       161 a~~P~iLilDEPTagLDp~~-~~~i~~ll~~l~~~~g~TiI~iTHdm~~v~~~ad  214 (286)
T PRK13646        161 AMNPDIIVVDEPTAGLDPQS-KRQVMRLLKSLQTDENKAIILISHDMNEVARYAD  214 (286)
T ss_pred             HCCCCEEEEECCCCCCCHHH-HHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCC
T ss_conf             51989999838744389899-9999999999999539899999138999999699


No 176
>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=97.47  E-value=0.0011  Score=45.95  Aligned_cols=133  Identities=23%  Similarity=0.265  Sum_probs=66.5

Q ss_pred             EEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCC-CCC---H-H-------HCCCCCC-----CEEE
Q ss_conf             44345635877776643999967784407899999999999997198-530---3-5-------3206822-----1056
Q gi|254780750|r  635 IANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGS-YVP---A-S-------YAHIGIV-----DKLF  697 (920)
Q Consensus       635 VpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~-fVP---A-~-------~a~i~~~-----D~If  697 (920)
                      +=+|++|..    ..+.+.-|.|||-+||||++|.++=+. -.+-|. +|-   . +       .-.++.+     +.+|
T Consensus        17 aL~~vsl~i----~~Ge~vaiiG~nGsGKSTL~~~l~Gll-~P~~G~I~v~G~d~~~~~~~~~~r~~ig~vfQ~p~~q~~   91 (274)
T PRK13644         17 ALENINLVI----KKGEYIGIIGKNGSGKSTLALHLNGLL-RPQKGKVLVSGIDTGDFSKLQGIRKLVGIVFQNPETQFV   91 (274)
T ss_pred             EEEEEEEEE----CCCCEEEEECCCCCHHHHHHHHHHCCC-CCCCCEEEECCEECCCCHHHHHHHHHEEEEEECCCCCCC
T ss_conf             663117798----489999999999980999999997068-588872999999878705679998731799658211036


Q ss_pred             EEEECCCCCCCCCCHH---HHHHHH-HHHHH----------------------------HHCCCCCEEEEECCCCCCCHH
Q ss_conf             7652376611385328---999999-99999----------------------------958998569993258898805
Q gi|254780750|r  698 SRVGSADNLASGRSTF---MVEMIE-TASIL----------------------------NQATNQSFVILDEIGRGTATL  745 (920)
Q Consensus       698 tRiGa~D~l~~g~STF---~vEm~e-~~~IL----------------------------~~at~~SLVllDElGrGTst~  745 (920)
                      .+ --.|++.-|.-..   -.|+.+ +...|                            --|.+-.++|+||--.|=++.
T Consensus        92 ~~-tV~e~iafg~~~~~l~~~e~~~~v~~aL~~~gl~~~~~~~p~~LSGGqkQRvaiA~aLa~~P~iLiLDEPTs~LD~~  170 (274)
T PRK13644         92 GR-TVEEDLAFGPENLCLPPIEIRKRVDRALAEIGLEKYRHRSPKTLSGGQGQCVALAGILTMEPECLIFDEVTSMLDPD  170 (274)
T ss_pred             CC-CHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHHCCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCHH
T ss_conf             15-19999962197669999999999999999859687762891109976999999999998299999997986678999


Q ss_pred             HHHHHHHHHHHHHHHHCCCEEEEECCCHHH
Q ss_conf             679999999999997269849997487579
Q gi|254780750|r  746 DGLSIAWATIEYLHETNRCRGLLATHFHEL  775 (920)
Q Consensus       746 DG~aiA~aile~l~~~~~~~~lfaTHy~eL  775 (920)
                      -- .--+..+..|.+. +..++++||.-+.
T Consensus       171 ~~-~~i~~~l~~L~~~-g~TvI~itHdl~~  198 (274)
T PRK13644        171 SG-IAVLERIKKLHEK-GKTIVYITHNLEE  198 (274)
T ss_pred             HH-HHHHHHHHHHHHC-CCEEEEEEECHHH
T ss_conf             99-9999999999868-9999998337899


No 177
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=97.46  E-value=0.0021  Score=43.83  Aligned_cols=133  Identities=23%  Similarity=0.281  Sum_probs=70.4

Q ss_pred             EEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHCCCCCC---------------------
Q ss_conf             44345635877776643999967784407899999999999997198530353206822---------------------
Q gi|254780750|r  635 IANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHIGIV---------------------  693 (920)
Q Consensus       635 VpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a~i~~~---------------------  693 (920)
                      |=+||+|..    ..+.+..|-|||-+||||+||.++        |..-| ++-++-+.                     
T Consensus        15 ~L~~isl~i----~~Ge~~~iiG~SGsGKSTll~~i~--------gL~~p-~~G~I~~~g~~i~~~~~~~~~~~r~~ig~   81 (235)
T cd03261          15 VLKGVDLDV----RRGEILAIIGPSGSGKSTLLRLIV--------GLLRP-DSGEVLIDGEDISGLSEAELYRLRRRMGM   81 (235)
T ss_pred             EECCEEEEE----CCCCEEEEECCCCCHHHHHHHHHH--------CCCCC-CCCEEEECCEECCCCCHHHHHHHHCCEEE
T ss_conf             882606488----799899999999972999999997--------59998-98589999999998998899997578299


Q ss_pred             ----CEEEEEEECCCCCCCCCCHH----HHHHHH-HHHHHH----------------------------HCCCCCEEEEE
Q ss_conf             ----10567652376611385328----999999-999999----------------------------58998569993
Q gi|254780750|r  694 ----DKLFSRVGSADNLASGRSTF----MVEMIE-TASILN----------------------------QATNQSFVILD  736 (920)
Q Consensus       694 ----D~IftRiGa~D~l~~g~STF----~vEm~e-~~~IL~----------------------------~at~~SLVllD  736 (920)
                          ..+|.++-..||+.-+.--.    -.|+.+ +..+|+                            -+++-.++|+|
T Consensus        82 vfQ~~~Lf~~lTv~eNv~~~l~~~~~~~~~~~~~r~~~~L~~vgL~~~~~~~p~~LSGGq~QRvaIARALv~~P~illlD  161 (235)
T cd03261          82 LFQSGALFDSLTVFENVAFPLREHTRLSEEEIREIVLEKLEAVGLRGAEDLYPAELSGGMKKRVALARALALDPELLLYD  161 (235)
T ss_pred             EECCCCCCCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCHHHHCCCCCCCHHHHHHHHHHHHHHCCCCEEEEE
T ss_conf             70498658999699999999999579999999999999998679925764784106999999999999985489989980


Q ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHH-HHHHH
Q ss_conf             2588988056799999999999972698499974875797-66430
Q gi|254780750|r  737 EIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFHELT-DLSKS  781 (920)
Q Consensus       737 ElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~-~l~~~  781 (920)
                      |--.|=++.-...| +..+..|.+..+..++|+||.-+.. .+++.
T Consensus       162 EPts~LDp~~~~~i-~~li~~l~~~~g~T~i~vTHd~~~a~~~~Dr  206 (235)
T cd03261         162 EPTAGLDPIASGVI-DDLIRSLKKELGLTSIMVTHDLDTAFAIADR  206 (235)
T ss_pred             CCCCCCCHHHHHHH-HHHHHHHHHHHCCEEEEECCCHHHHHHHCCE
T ss_conf             88664798999999-9999999997299999989898999996998


No 178
>TIGR02673 FtsE cell division ATP-binding protein FtsE; InterPro: IPR005286   ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs.   ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain .    The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , .   The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , .   Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1).     FtsE is an ABC transporter ATP-binding protein. This protein and its permease partner FtsX, localize to the cell division site. In a number of species, the ftsEX gene pair is located next to ftsY, which encodes the signal recognition particle-docki ng protein.; GO: 0005524 ATP binding, 0051301 cell division.
Probab=97.46  E-value=0.0017  Score=44.50  Aligned_cols=132  Identities=26%  Similarity=0.359  Sum_probs=74.5

Q ss_pred             EEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHH-------------HCCCCCCHHHCCCCCC--C-EEEEEE
Q ss_conf             34563587777664399996778440789999999999999-------------7198530353206822--1-056765
Q gi|254780750|r  637 NDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMA-------------QMGSYVPASYAHIGIV--D-KLFSRV  700 (920)
Q Consensus       637 Ndi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilA-------------QiG~fVPA~~a~i~~~--D-~IftRi  700 (920)
                      +||+|..    ..+.|.-||||=-+||||+||-++-.-.-.             .=|..+|+=.=+||++  | ++.-..
T Consensus        19 ~~v~l~i----~kG~F~FLtG~SGAGKttLLKLl~~~~~P~~G~v~~~G~~~~~l~~~~~P~LRR~iGvvFQDf~LL~~r   94 (215)
T TIGR02673        19 HDVSLHI----RKGEFLFLTGPSGAGKTTLLKLLYGALTPSRGQVRVAGEDVSRLRGRQLPLLRRRIGVVFQDFRLLPDR   94 (215)
T ss_pred             CCCCEEE----CCCCEEEEECCCCCCHHHHHHHHHHHCCCCCCEEEECCEECCCCCCCCCHHHHCCCCEEEECCCCCCCC
T ss_conf             2764475----277407887277861789999998526987580888874046677564312213154378422110116


Q ss_pred             ECCCCCC-----CCCC-HHHHHHHHHHHHHH--------HCCCC--------------------CEEEEECCCCCCCHHH
Q ss_conf             2376611-----3853-28999999999999--------58998--------------------5699932588988056
Q gi|254780750|r  701 GSADNLA-----SGRS-TFMVEMIETASILN--------QATNQ--------------------SFVILDEIGRGTATLD  746 (920)
Q Consensus       701 Ga~D~l~-----~g~S-TF~vEm~e~~~IL~--------~at~~--------------------SLVllDElGrGTst~D  746 (920)
                      -..||++     .|.+ ++.-  .++..+|+        ++.+.                    .|+|-||-   |-.-|
T Consensus        95 Tv~eNVAl~L~V~G~~~~~I~--~rV~~~L~~vGL~~K~~~~P~~LSGGEQQRvaIARAiv~~P~lLLADEP---TGNLD  169 (215)
T TIGR02673        95 TVYENVALPLEVRGKKKREIQ--RRVEAALRLVGLEHKADAFPEQLSGGEQQRVAIARAIVNSPELLLADEP---TGNLD  169 (215)
T ss_pred             CHHHHCCHHHHCCCCCCHHHH--HHHHHHHHHCCCHHHHHCCCCCCCCCHHHHHHHHHHHHCCCCEEEEECC---CCCCC
T ss_conf             613411210111388803367--8999999852863254257210047257888887653048967987788---99968


Q ss_pred             HHHHHHHH---HHHHHHHCCCEEEEECCCHHHHHHH
Q ss_conf             79999999---9999972698499974875797664
Q gi|254780750|r  747 GLSIAWAT---IEYLHETNRCRGLLATHFHELTDLS  779 (920)
Q Consensus       747 G~aiA~ai---le~l~~~~~~~~lfaTHy~eL~~l~  779 (920)
                      - .+++.|   ++.++. .|..+++|||.++|.+-.
T Consensus       170 ~-~~~~~iL~ll~~~n~-~GtTV~vATHD~~L~~~~  203 (215)
T TIGR02673       170 P-ALSERILDLLKELNK-RGTTVIVATHDLELVERV  203 (215)
T ss_pred             H-HHHHHHHHHHHHHHH-CCCEEEEECCCHHHHHCC
T ss_conf             7-678999999999841-898799980787998437


No 179
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional
Probab=97.46  E-value=0.0022  Score=43.78  Aligned_cols=35  Identities=31%  Similarity=0.506  Sum_probs=27.4

Q ss_pred             EEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHH
Q ss_conf             444345635877776643999967784407899999999
Q gi|254780750|r  634 FIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNAL  672 (920)
Q Consensus       634 fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval  672 (920)
                      .|=+|+++..    ..+.+.-|.|||-+||||++|.++.
T Consensus        15 ~vl~~vsl~i----~~Ge~~aliG~sGsGKSTLl~~l~g   49 (248)
T PRK11264         15 TVLHGIDLEV----KPGEVVAIIGPSGSGKTTLLRCINL   49 (248)
T ss_pred             EEEECEEEEE----CCCCEEEEECCCCCCHHHHHHHHHC
T ss_conf             9894317798----7998999999999809999999975


No 180
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transport system, ATP-binding protein component. This ABC transporter ATP-binding protein is found in a number of genomes in operon-like contexts strongly suggesting a substrate specificity for 2-aminoethylphosphonate (2-AEP). The characterized PhnSTUV system is absent in the genomes in which this system is found. These genomes encode systems for the catabolism of 2-AEP, making the need for a 2-AEP-specific transporter likely.
Probab=97.46  E-value=0.00017  Score=52.02  Aligned_cols=142  Identities=24%  Similarity=0.274  Sum_probs=77.8

Q ss_pred             EEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHH--------HHHCCCCCCHHHCCCCCC---CEEEEEEECC
Q ss_conf             44345635877776643999967784407899999999999--------997198530353206822---1056765237
Q gi|254780750|r  635 IANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVI--------MAQMGSYVPASYAHIGIV---DKLFSRVGSA  703 (920)
Q Consensus       635 VpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vi--------lAQiG~fVPA~~a~i~~~---D~IftRiGa~  703 (920)
                      +=+|++|..    ..+.++.|-||+-+||||+||.+|=+.-        --+--..+|...-.++.|   -.+|-.|-..
T Consensus        19 al~~v~l~v----~~Ge~~~llGpSG~GKtTlLr~iaGl~~p~~G~I~~~g~~v~~~~p~~R~ig~VfQ~~aLfPh~tV~   94 (353)
T TIGR03265        19 ALKDISLSV----KKGEFVCLLGPSGCGKTTLLRIIAGLERQTAGTIYQGGRDITRLPPQKRDYGIVFQSYALFPNLTVA   94 (353)
T ss_pred             EECCCEEEE----CCCCEEEEECCCCCHHHHHHHHHHCCCCCCCEEEEECCEECCCCCHHHCCEEEEECCCCCCCCCCHH
T ss_conf             886648699----8999999999995359999999976999987399999999999995258859997888546789299


Q ss_pred             CCCCCCC-----CHH--------HHHHHHHHHHHH-------------------HCCCCCEEEEECCCCCCCHHHHHHHH
Q ss_conf             6611385-----328--------999999999999-------------------58998569993258898805679999
Q gi|254780750|r  704 DNLASGR-----STF--------MVEMIETASILN-------------------QATNQSFVILDEIGRGTATLDGLSIA  751 (920)
Q Consensus       704 D~l~~g~-----STF--------~vEm~e~~~IL~-------------------~at~~SLVllDElGrGTst~DG~aiA  751 (920)
                      |||.-|.     +.=        +.|+..+...++                   -+++-.++|+||--..=+..--..+ 
T Consensus        95 eNiafgl~~~~~~~~e~~~rv~~~l~~~~l~~~~~r~p~~LSGGq~QRVAlARAL~~~P~vlLlDEPlsaLD~~lr~~l-  173 (353)
T TIGR03265        95 DNIAYGLKNRGMGRAEVAERVAELLDLVGLPGSERKYPGQLSGGQQQRVALARALATSPGLLLLDEPLSALDARVREHL-  173 (353)
T ss_pred             HHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHHCCHHHCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCHHHHHHH-
T ss_conf             9998899876999999999999999876995576569646898887999999998549989999087653599999999-


Q ss_pred             HHHHHHHHHHCCCEEEEECCCHHHH-HHHHH
Q ss_conf             9999999972698499974875797-66430
Q gi|254780750|r  752 WATIEYLHETNRCRGLLATHFHELT-DLSKS  781 (920)
Q Consensus       752 ~aile~l~~~~~~~~lfaTHy~eL~-~l~~~  781 (920)
                      +..+..|++..+..++|+||..+=+ .+++.
T Consensus       174 ~~~l~~l~~~~~~T~i~VTHD~~EA~~laDr  204 (353)
T TIGR03265       174 RTEIRQLQRRLGVTTIMVTHDQEEALSMADR  204 (353)
T ss_pred             HHHHHHHHHHHCCEEEEECCCHHHHHHHCCE
T ss_conf             9999999998699899999898999986998


No 181
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=97.45  E-value=0.0032  Score=42.50  Aligned_cols=41  Identities=29%  Similarity=0.353  Sum_probs=29.6

Q ss_pred             CEEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCH
Q ss_conf             04443456358777766439999677844078999999999999971985303
Q gi|254780750|r  633 PFIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPA  685 (920)
Q Consensus       633 ~fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA  685 (920)
                      .+|=+|++|..    ..+....|+|||-+||||++|.+        .|.+-|-
T Consensus        15 ~~vL~ninl~i----~~Ge~i~IvG~sGsGKSTLl~ll--------~gl~~p~   55 (234)
T cd03251          15 PPVLRDISLDI----PAGETVALVGPSGSGKSTLVNLI--------PRFYDVD   55 (234)
T ss_pred             CCCEECEEEEE----CCCCEEEEECCCCCHHHHHHHHH--------HCCCCCC
T ss_conf             67353608998----79999999989998299999999--------6676678


No 182
>PRK10744 phosphate transporter subunit; Provisional
Probab=97.43  E-value=0.003  Score=42.68  Aligned_cols=36  Identities=25%  Similarity=0.348  Sum_probs=28.2

Q ss_pred             EEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHH
Q ss_conf             4443456358777766439999677844078999999999
Q gi|254780750|r  634 FIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALI  673 (920)
Q Consensus       634 fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~  673 (920)
                      .+=+|+++..    ..+.+.-|-|||-+||||++|.++-+
T Consensus        24 ~aL~~vsl~i----~~Ge~~~liG~nGaGKSTLlk~i~gl   59 (257)
T PRK10744         24 HALKNINLDI----AKNQVTAFIGPSGCGKSTLLRTFNKM   59 (257)
T ss_pred             EEECCCEEEE----CCCCEEEEECCCCCCHHHHHHHHHHH
T ss_conf             6781428998----89989999999998199999999876


No 183
>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=97.42  E-value=0.00071  Score=47.38  Aligned_cols=48  Identities=23%  Similarity=0.272  Sum_probs=34.0

Q ss_pred             CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHH
Q ss_conf             99856999325889880567999999999999726984999748757976
Q gi|254780750|r  728 TNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFHELTD  777 (920)
Q Consensus       728 t~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~~  777 (920)
                      ..-.++|+||--.|=++. |..--+.++..|.+. +...+++||.-++..
T Consensus       154 ~~P~iliLDEPTagLDp~-~~~~i~~ll~~l~~~-G~Tii~iTHdm~~~~  201 (275)
T PRK13639        154 MNPEIMVLDEPTSGLDPM-GASQIMKLLYDLNKE-GITIIISTHDVDLVP  201 (275)
T ss_pred             CCCCEEEECCCCCCCCHH-HHHHHHHHHHHHHHC-CCEEEEECCCHHHHH
T ss_conf             699899977975548999-999999999999976-999999938999999


No 184
>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT. This ATP-binding component of an ABC transport system is found in Salmonella and Burkholderia lineages in the vicinity of enzymes for the breakdown of 2-aminoethylphosphonate.
Probab=97.41  E-value=0.0017  Score=44.54  Aligned_cols=137  Identities=24%  Similarity=0.266  Sum_probs=70.7

Q ss_pred             EEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHH-HCCC---------CCCHHHCCCCCC---CEEEEEEE
Q ss_conf             4434563587777664399996778440789999999999999-7198---------530353206822---10567652
Q gi|254780750|r  635 IANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMA-QMGS---------YVPASYAHIGIV---DKLFSRVG  701 (920)
Q Consensus       635 VpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilA-QiG~---------fVPA~~a~i~~~---D~IftRiG  701 (920)
                      |=+|++|..    ..+.+..|-||+-+||||+||.+|=+.--. --|.         .+|...-.++.+   ..+|-.+-
T Consensus        20 al~dvsl~i----~~GE~~~llGpSG~GKTTlLr~iaGL~~p~~~~G~I~~~g~~v~~~~~~~R~ig~VFQ~~aLfPhlt   95 (362)
T TIGR03258        20 VLDDLSLEI----EAGELLALIGKSGCGKTTLLRAIAGFVKAAGLTGRIAIADRDLTHAPPHKRGLALLFQNYALFPHLK   95 (362)
T ss_pred             EECCCEEEE----CCCCEEEEECCCCCHHHHHHHHHHCCCCCCCCCEEEEECCEECCCCCHHHCCEEEECCCCCCCCCCC
T ss_conf             993767199----9998999999997459999999977767778817999999999989988899489717985368980


Q ss_pred             CCCCCCCC-----CCHH-----HHHHHH---HHHHH------------------H-HCCCCCEEEEECCCCCCCHHHHHH
Q ss_conf             37661138-----5328-----999999---99999------------------9-589985699932588988056799
Q gi|254780750|r  702 SADNLASG-----RSTF-----MVEMIE---TASIL------------------N-QATNQSFVILDEIGRGTATLDGLS  749 (920)
Q Consensus       702 a~D~l~~g-----~STF-----~vEm~e---~~~IL------------------~-~at~~SLVllDElGrGTst~DG~a  749 (920)
                      ..|||.-|     .+.=     ..|+.+   +...+                  | -+.+-.++|+||--.+=++.--..
T Consensus        96 V~eNia~~L~~~~~~~~e~~~rv~e~l~~vgL~~~~~r~P~~LSGGq~QRVAlARAL~~~P~ilLlDEP~saLD~~~r~~  175 (362)
T TIGR03258        96 VEDNVAFGLRAQKMPKADIAERVADALKLVGLGDAAAHLPAQLSGGMQQRIAIARAIAIEPDVLLLDEPLSALDANIRAN  175 (362)
T ss_pred             HHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHHCCHHHCCHHHHHHHHHHHHHHCCCCEEEECCCCCCCCHHHHHH
T ss_conf             99999899986599999999999999877899678626966789989999999999755999899818876559999999


Q ss_pred             HHHHHHHHHHHHC-CCEEEEECCCHHHH
Q ss_conf             9999999999726-98499974875797
Q gi|254780750|r  750 IAWATIEYLHETN-RCRGLLATHFHELT  776 (920)
Q Consensus       750 iA~aile~l~~~~-~~~~lfaTHy~eL~  776 (920)
                      + +.-+..|++.. +..++|.||..+=+
T Consensus       176 l-~~~l~~l~~~l~~~T~i~VTHD~~EA  202 (362)
T TIGR03258       176 M-REEIAALHEELPELTILCVTHDQDDA  202 (362)
T ss_pred             H-HHHHHHHHHHCCCCEEEEECCCHHHH
T ss_conf             9-99999999976798899989998999


No 185
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules.  Loaded MHC I leave the ER and display their antigenic cargo on the cell surface to cytotoxic T cells.  Subsequently, virus-infected or malignantly transformed cells can be eliminated.  TAP belongs to the large family of ATP-binding cassette (ABC) transporters, which translocate a vast variety of solutes across membranes.
Probab=97.41  E-value=0.0032  Score=42.51  Aligned_cols=131  Identities=27%  Similarity=0.331  Sum_probs=69.1

Q ss_pred             CEEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHC------------------CCCCCC
Q ss_conf             04443456358777766439999677844078999999999999971985303532------------------068221
Q gi|254780750|r  633 PFIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYA------------------HIGIVD  694 (920)
Q Consensus       633 ~fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a------------------~i~~~D  694 (920)
                      ..|=+|+++..    ..+.+.-|.|||-+||||++|.+.        |.+-|-+-.                  .++.+.
T Consensus        27 ~~vL~~is~~i----~~Ge~vaIvG~sGsGKSTL~~ll~--------gl~~p~~G~I~idg~~i~~~~~~~lr~~i~~v~   94 (226)
T cd03248          27 TLVLQDVSFTL----HPGEVTALVGPSGSGKSTVVALLE--------NFYQPQGGQVLLDGKPISQYEHKYLHSKVSLVG   94 (226)
T ss_pred             CEEEECEEEEE----CCCCEEEEECCCCCHHHHHHHHHH--------CCCCCCCCEEEECCEEHHHCCHHHHHHCEEEEE
T ss_conf             94374538998----299999999999984999999996--------454678878999999934489999973269992


Q ss_pred             ---EEEEEEECCCCCCCCCCHHH-HHHHHHHH-----------------------------------HHH-HCCCCCEEE
Q ss_conf             ---05676523766113853289-99999999-----------------------------------999-589985699
Q gi|254780750|r  695 ---KLFSRVGSADNLASGRSTFM-VEMIETAS-----------------------------------ILN-QATNQSFVI  734 (920)
Q Consensus       695 ---~IftRiGa~D~l~~g~STF~-vEm~e~~~-----------------------------------IL~-~at~~SLVl  734 (920)
                         .+|.. --.|||.-|....- -++.+...                                   |.| -..+..++|
T Consensus        95 Q~~~lf~~-ti~eNi~~g~~~~~~~~i~~~~~~~~~~~~i~~l~~gl~t~i~~~g~~LSgGqkQRialARal~~~p~ili  173 (226)
T cd03248          95 QEPVLFAR-SLQDNIAYGLQSCSFECVKEAAQKAHAHSFISELASGYDTEVGEKGSQLSGGQKQRVAIARALIRNPQVLI  173 (226)
T ss_pred             CCCEECCC-CHHHHHHCCCCCCCHHHHHHHHHHHCHHHHHHHCCCCCCCEECCCCCCCCHHHHHHHHHHHHHHCCCCEEE
T ss_conf             47957677-35666632789999999999999966146776263666406168488769999999999999975999999


Q ss_pred             EECCCCCCCHHHHHHHHHHHHHHHHHHC-CCEEEEECCCHHHHHHHH
Q ss_conf             9325889880567999999999999726-984999748757976643
Q gi|254780750|r  735 LDEIGRGTATLDGLSIAWATIEYLHETN-RCRGLLATHFHELTDLSK  780 (920)
Q Consensus       735 lDElGrGTst~DG~aiA~aile~l~~~~-~~~~lfaTHy~eL~~l~~  780 (920)
                      +||-   ||..|-.+ ...+.+.|.+.. +..+++.||-.++...++
T Consensus       174 lDEp---tSaLD~~t-e~~i~~~l~~~~~~~Tvi~ItH~l~~~~~~D  216 (226)
T cd03248         174 LDEA---TSALDAES-EQQVQQALYDWPERRTVLVIAHRLSTVERAD  216 (226)
T ss_pred             EECC---CCCCCHHH-HHHHHHHHHHHCCCCEEEEEECCHHHHHHCC
T ss_conf             9797---66889999-9999999998669999999937999998499


No 186
>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2.  The cystic fibrosis transmembrane regulator (CFTR), the product of the gene mutated in patients with cystic fibrosis, has adapted the ABC transporter structural motif to form a tightly regulated anion channel at the apical surface of many epithelia.  Use of the term assembly of a functional ion channel implies the coming together of subunits or at least smaller not-yet functional components of the active whole.  In fact, on the basis of current knowledge only the CFTR polypeptide itself is required to form an ATP- and protein kinase A-dependent low-conductance chloride channel of the type present in the apical membrane of many epithelial cells.  CFTR displays the typical organization (IM-ABC)2 and carries a characteristic hydrophilic R-domain that separates IM1-ABC1 from IM2-ABC2.
Probab=97.40  E-value=0.0042  Score=41.65  Aligned_cols=34  Identities=26%  Similarity=0.266  Sum_probs=26.3

Q ss_pred             EEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHH
Q ss_conf             44434563587777664399996778440789999999
Q gi|254780750|r  634 FIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNA  671 (920)
Q Consensus       634 fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqva  671 (920)
                      .|=+|+++..    ..+.+.-|.|||-+||||+++.+.
T Consensus        18 ~vL~~isf~I----~~Ge~vaIvG~sGsGKSTLl~lL~   51 (275)
T cd03289          18 AVLENISFSI----SPGQRVGLLGRTGSGKSTLLSAFL   51 (275)
T ss_pred             CCEECEEEEE----CCCCEEEEECCCCCCHHHHHHHHH
T ss_conf             6242507998----799999999999997999999996


No 187
>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism]
Probab=97.39  E-value=0.0022  Score=43.67  Aligned_cols=138  Identities=27%  Similarity=0.314  Sum_probs=76.0

Q ss_pred             EEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHH------------HHHCCCCCCHHHCCCCCCC---EEEEEEE
Q ss_conf             345635877776643999967784407899999999999------------9971985303532068221---0567652
Q gi|254780750|r  637 NDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVI------------MAQMGSYVPASYAHIGIVD---KLFSRVG  701 (920)
Q Consensus       637 Ndi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vi------------lAQiG~fVPA~~a~i~~~D---~IftRiG  701 (920)
                      +||+|..    .++.+.-++|||.+||||+||-+|=+--            |... .-+|....++|.+=   ..|--|-
T Consensus        19 ~di~l~i----~~Ge~vaLlGpSGaGKsTlLRiIAGLe~p~~G~I~~~~~~l~D~-~~~~~~~R~VGfvFQ~YALF~Hmt   93 (345)
T COG1118          19 DDISLDI----KSGELVALLGPSGAGKSTLLRIIAGLETPDAGRIRLNGRVLFDV-SNLAVRDRKVGFVFQHYALFPHMT   93 (345)
T ss_pred             CCCEEEE----CCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCEEEECCEECCCH-HCCCHHHCCEEEEEECHHHCCCCH
T ss_conf             4631550----68868999778987678899998575778875699999861000-003234402148972166556452


Q ss_pred             CCCCCCCCC------------CHHHHHHHHHHHH--------------------HH--HCCCCCEEEEECCCCCCCHHHH
Q ss_conf             376611385------------3289999999999--------------------99--5899856999325889880567
Q gi|254780750|r  702 SADNLASGR------------STFMVEMIETASI--------------------LN--QATNQSFVILDEIGRGTATLDG  747 (920)
Q Consensus       702 a~D~l~~g~------------STF~vEm~e~~~I--------------------L~--~at~~SLVllDElGrGTst~DG  747 (920)
                      -.|||+=|.            .+=..|+.++-..                    |-  -|-+-.+.||||-.+.-++.=-
T Consensus        94 Va~NIAFGl~~~~~~p~~~~~r~rv~elL~lvqL~~la~ryP~qLSGGQrQRVALARALA~eP~vLLLDEPf~ALDa~vr  173 (345)
T COG1118          94 VADNIAFGLKVRKERPSEAEIRARVEELLRLVQLEGLADRYPAQLSGGQRQRVALARALAVEPKVLLLDEPFGALDAKVR  173 (345)
T ss_pred             HHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHCCCCHHHCCCHHCCHHHHHHHHHHHHHHCCCCEEEECCCCHHHHHHHH
T ss_conf             87654210000355887356789999999986401443439421271788999999875349986863587214519999


Q ss_pred             HHHHHHHHHHHHHHCCCEEEEECCCHHHH-HHHH
Q ss_conf             99999999999972698499974875797-6643
Q gi|254780750|r  748 LSIAWATIEYLHETNRCRGLLATHFHELT-DLSK  780 (920)
Q Consensus       748 ~aiA~aile~l~~~~~~~~lfaTHy~eL~-~l~~  780 (920)
                      .- -.+-|..+++..++.++|.||..+=+ ++++
T Consensus       174 ~~-lr~wLr~~~~~~~~ttvfVTHD~eea~~lad  206 (345)
T COG1118         174 KE-LRRWLRKLHDRLGVTTVFVTHDQEEALELAD  206 (345)
T ss_pred             HH-HHHHHHHHHHHHCCEEEEEECCHHHHHHHCC
T ss_conf             99-9999999998609639999589999986416


No 188
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient.  The Pst system of E. coli comprises four distinct subunits encoded by the pstS, pstA, pstB, and pstC genes.  The PstS protein is a phosphate-binding protein located in the periplasmic space. P stA and PstC are hydrophobic and they form the transmembrane portion of the Pst system.  PstB is the catalytic subunit, which couples the energy of ATP hydrolysis to the import of phosphate across cellular membranes through the Pst system, often referred as ABC-protein.  PstB belongs to one of the largest superfamilies of proteins characterized by a highly conserved adenosine triphosphate (ATP) binding cassette (ABC), which is also a nucleotide binding domain (NBD).
Probab=97.38  E-value=0.0064  Score=40.27  Aligned_cols=37  Identities=32%  Similarity=0.389  Sum_probs=28.5

Q ss_pred             EEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             44434563587777664399996778440789999999999
Q gi|254780750|r  634 FIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIV  674 (920)
Q Consensus       634 fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~v  674 (920)
                      .|=+|++|..    ..+.+.-|.|||-+||||++|.++-+.
T Consensus        14 ~~L~~isl~i----~~Ge~~~iiG~SGsGKSTll~~i~gL~   50 (227)
T cd03260          14 HALKDISLDI----PKGEITALIGPSGCGKSTLLRLLNRLN   50 (227)
T ss_pred             EEEECEEEEE----CCCCEEEEECCCCCCHHHHHHHHHHHH
T ss_conf             8883406788----799899999999981999999997445


No 189
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD. Members of this protein family are ABC transporter ATP-binding subunits associated with urea transport and metabolism. This protein is found in a conserved five-gene transport operon typically found adjacent to urease genes. It was shown in Cyanobacteria that disruption leads to the loss of high-affinity urea transport activity.
Probab=97.38  E-value=0.0028  Score=42.92  Aligned_cols=132  Identities=23%  Similarity=0.306  Sum_probs=68.5

Q ss_pred             EEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCC------CC----CHHHCCCCC-----CCEEEEE
Q ss_conf             44345635877776643999967784407899999999999997198------53----035320682-----2105676
Q gi|254780750|r  635 IANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGS------YV----PASYAHIGI-----VDKLFSR  699 (920)
Q Consensus       635 VpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~------fV----PA~~a~i~~-----~D~IftR  699 (920)
                      +=+|++|..    ..+.+.-|-|||-+||||++|.++=+.- ..-|.      -+    |.+.++.++     ...+|-.
T Consensus        17 al~~vsl~v----~~Gei~~liGpNGaGKSTLl~~i~Gl~~-p~~G~I~~~G~~i~~~~~~~~~~~gIg~~~Q~~~l~~~   91 (242)
T TIGR03411        17 ALNDLSLYV----DPGELRVIIGPNGAGKTTMMDVITGKTR-PDEGSVLFGGTDLTGLPEHQIARAGIGRKFQKPTVFEN   91 (242)
T ss_pred             EECCCEEEE----CCCCEEEEECCCCCCHHHHHHHHHCCCC-CCCEEEEECCEECCCCCHHHHHHCCCCEECCCCCCCCC
T ss_conf             874507898----8998999998999759999999967957-88559999999888999999997488545266676766


Q ss_pred             EECCCCCCCC----CCHH--------------------------------------HHHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             5237661138----5328--------------------------------------999999999999589985699932
Q gi|254780750|r  700 VGSADNLASG----RSTF--------------------------------------MVEMIETASILNQATNQSFVILDE  737 (920)
Q Consensus       700 iGa~D~l~~g----~STF--------------------------------------~vEm~e~~~IL~~at~~SLVllDE  737 (920)
                      +-..||+.-+    .+-|                                      +--...++..|  +++-.++|+||
T Consensus        92 ltv~enl~~~~~~~~~~~~~l~~~~~~~~~~~v~~~l~~~~L~~~~~~~~~~LSgGqkqrv~iA~aL--~~~P~lllLDE  169 (242)
T TIGR03411        92 LTVFENLELALPRDKSVFASLFFRLSAEEKDRIEEVLETIGLADEADRLAGLLSHGQKQWLEIGMLL--MQDPKLLLLDE  169 (242)
T ss_pred             CCHHHHHHHHHHCCCCHHHHHCCCCHHHHHHHHHHHHHHCCCCHHHCCCHHHCCHHHHHHHHHHHHH--HHCCCEEEEEC
T ss_conf             9799999998751555024430366499999999999877997265586345997899999999999--73899899918


Q ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHH
Q ss_conf             588988056799999999999972698499974875797
Q gi|254780750|r  738 IGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFHELT  776 (920)
Q Consensus       738 lGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~  776 (920)
                      --+|=++..-..| |.+++.|.+  +.-++++||.-+..
T Consensus       170 Pt~gLD~~~~~~i-~~ll~~l~~--~~tvi~isHdl~~~  205 (242)
T TIGR03411       170 PVAGMTDEETEKT-AELLKSLAG--KHSVVVVEHDMEFV  205 (242)
T ss_pred             CCCCCCHHHHHHH-HHHHHHHHC--CCEEEEEECCHHHH
T ss_conf             6436998999999-999999857--99799997859999


No 190
>PRK13409 putative ATPase RIL; Provisional
Probab=97.35  E-value=0.0057  Score=40.63  Aligned_cols=157  Identities=24%  Similarity=0.251  Sum_probs=80.7

Q ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHH-----CCCCCCCEEEEE---EECCCCCCC-----CCCHHHH
Q ss_conf             643999967784407899999999999997198530353-----206822105676---523766113-----8532899
Q gi|254780750|r  649 SGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASY-----AHIGIVDKLFSR---VGSADNLAS-----GRSTFMV  715 (920)
Q Consensus       649 ~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~-----a~i~~~D~IftR---iGa~D~l~~-----g~STF~v  715 (920)
                      .+.++-|.|||-+||||++|.++        |..=|-+-     .+++-+++-...   .-..|-+.+     +.+.|-.
T Consensus       364 ~GEiigIvG~NGaGKTTLlKiLa--------G~lkPd~G~V~~~~~isY~pQ~i~~d~~~tV~~~L~~~~~~~~~~~~~~  435 (590)
T PRK13409        364 KGEVIGIVGPNGIGKTTFVKLLA--------GVLKPDEGEVDTDLKISYKPQYIKPDYDGTVEDLLRSITDDLGSSYYKS  435 (590)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHH--------CCCCCCCCEEEECCEEEECCHHCCCCCCCCHHHHHHHHCCCCCHHHHHH
T ss_conf             47489998888887899999982--------8877887447547748733600146868819999986244225389999


Q ss_pred             HH----------------------HHHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCH
Q ss_conf             99----------------------99999999589985699932588988056799999999999972698499974875
Q gi|254780750|r  716 EM----------------------IETASILNQATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFH  773 (920)
Q Consensus       716 Em----------------------~e~~~IL~~at~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~  773 (920)
                      |+                      ..++-..--+.+-.+.||||---+=+-..-+++|-+|-+++.+. +.-+++.+|.-
T Consensus       436 ell~~L~l~~lldk~v~~LSGGEkQRvaLA~~L~~~anvLLLDEPTn~LDvE~R~~~~k~i~~~~~~~-~~t~~vV~HD~  514 (590)
T PRK13409        436 EIIKPLNLEKLLDRNVKDLSGGELQRVAIAACLSRDADLYLLDEPSAYLDVEQRLAVARAIRRIAEEK-EKAALVVDHDI  514 (590)
T ss_pred             HHHHHHCCHHHHCCCHHHCCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHC-CCEEEEEECCH
T ss_conf             99988788867649624409899999999998667999999948988778899999999999999866-97599994709


Q ss_pred             HHHHHHHHCCCEEEEEEEEEEECCEEEEEEEEEECCCCCCHHHHHHHHCCCCHHHHHHHHHHHHHHH
Q ss_conf             7976643068858999999960992778777744789887789999982999899999999999998
Q gi|254780750|r  774 ELTDLSKSLKRFHNATLQVSDSNEGIIFLHKVIPGIADHSYGIQVGKLAGLPNTVISRAYDILKTFE  840 (920)
Q Consensus       774 eL~~l~~~~~~v~n~~~~~~~~~~~i~flykl~~G~~~~Sygi~vA~laG~p~~vi~~A~~~~~~le  840 (920)
                      .+.++...  ++             ++|  .=.||+-+         .|.=|.+..+--...++.|+
T Consensus       515 ~~~d~lsd--rv-------------~vf--~G~p~~~~---------~a~~p~~~~~gmn~fl~~~~  555 (590)
T PRK13409        515 YMIDYISD--RL-------------MVF--EGEPGKHG---------HASGPLDMREGMNRFLKELG  555 (590)
T ss_pred             HHHHHHCC--EE-------------EEE--CCCCCCCC---------EECCCCCHHHHHHHHHHHCC
T ss_conf             99987616--69-------------998--17887651---------40598447899999998779


No 191
>cd03290 ABCC_SUR1_N The SUR domain 1.  The sulfonylurea receptor SUR is an ATP transporter of the ABCC/MRP family with tandem ATPase binding domains.  Unlike other ABC proteins, it has no intrinsic transport function, neither active nor passive, but associates with the potassium channel proteins Kir6.1 or Kir6.2 to form the ATP-sensitive potassium (K(ATP)) channel.  Within the channel complex, SUR serves as a regulatory subunit that fine-tunes the gating of Kir6.x in response to alterations in cellular metabolism.  It constitutes a major pharmaceutical target as it binds numerous drugs, K(ATP) channel openers and blockers, capable of up- or down-regulating channel activity.
Probab=97.35  E-value=0.0031  Score=42.55  Aligned_cols=33  Identities=21%  Similarity=0.310  Sum_probs=25.5

Q ss_pred             EEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHH
Q ss_conf             4434563587777664399996778440789999999
Q gi|254780750|r  635 IANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNA  671 (920)
Q Consensus       635 VpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqva  671 (920)
                      |=+|+++..    ..+.+..|.|||-+||||+|+.+.
T Consensus        16 vL~~inl~i----~~Ge~~~IvG~sGsGKSTLl~~l~   48 (218)
T cd03290          16 TLSNINIRI----PTGQLTMIVGQVGCGKSSLLLAIL   48 (218)
T ss_pred             EEECEEEEE----CCCCEEEEECCCCCCHHHHHHHHH
T ss_conf             564769998----699999999999980999999985


No 192
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein.  In A. tumefaciens cyclic beta-1, 2-glucan must be transported into the periplasmic space to exert its action as a virluence factor.  This subfamily belongs to the MRP-like family and is involved in drug, peptide, and lipid export.  The MRP-like family, similar to all ABC proteins, have a common four-domain core structure constituted by two membrane-spanning domains each composed of six transmembrane (TM) helices and two nucleotide-binding domains (NBD).  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=97.35  E-value=0.0028  Score=42.99  Aligned_cols=34  Identities=24%  Similarity=0.391  Sum_probs=26.0

Q ss_pred             EEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHH
Q ss_conf             44434563587777664399996778440789999999
Q gi|254780750|r  634 FIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNA  671 (920)
Q Consensus       634 fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqva  671 (920)
                      +|=++++|..    ..+.+..|+|||-+||||++|-+.
T Consensus        17 ~vL~~inl~i----~~Ge~vaivG~sGsGKSTLl~ll~   50 (229)
T cd03254          17 PVLKDINFSI----KPGETVAIVGPTGAGKTTLINLLM   50 (229)
T ss_pred             EEEECEEEEE----CCCCEEEEECCCCCHHHHHHHHHH
T ss_conf             0874629998----799999999999980999999996


No 193
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=97.34  E-value=0.0057  Score=40.62  Aligned_cols=141  Identities=22%  Similarity=0.280  Sum_probs=68.3

Q ss_pred             CEEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCC---------------CCCCHHHCCCCCCC---
Q ss_conf             044434563587777664399996778440789999999999999719---------------85303532068221---
Q gi|254780750|r  633 PFIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMG---------------SYVPASYAHIGIVD---  694 (920)
Q Consensus       633 ~fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG---------------~fVPA~~a~i~~~D---  694 (920)
                      .|.- ++++..     ++.+.-|-||+-+||||+||.++-+. -...|               ..+|...-.++.+=   
T Consensus        12 ~f~l-~i~f~i-----~ge~~~iiGpSGsGKSTll~~i~GL~-~p~sG~I~~~G~~~~~~~~~~~~~~~~r~ig~VfQ~~   84 (214)
T cd03297          12 DFTL-KIDFDL-----NEEVTGIFGASGAGKSTLLRCIAGLE-KPDGGTIVLNGTVLFDSRKKINLPPQQRKIGLVFQQY   84 (214)
T ss_pred             CEEE-EEEEEC-----CCCEEEEECCCCCHHHHHHHHHHCCC-CCCCEEEEECCEECCCCCCCCCCCCCCCCEEEEECCC
T ss_conf             9999-999862-----99799999999735999999998499-9996499999999766541246771348758976787


Q ss_pred             EEEEEEECCCCCCCC---CCHH--------HHHHHHHHHHHH-------------------HCCCCCEEEEECCCCCCCH
Q ss_conf             056765237661138---5328--------999999999999-------------------5899856999325889880
Q gi|254780750|r  695 KLFSRVGSADNLASG---RSTF--------MVEMIETASILN-------------------QATNQSFVILDEIGRGTAT  744 (920)
Q Consensus       695 ~IftRiGa~D~l~~g---~STF--------~vEm~e~~~IL~-------------------~at~~SLVllDElGrGTst  744 (920)
                      .+|-.+-..||+.-+   .+.=        +.|+.+...+++                   -+.+-.++|+||--.+=++
T Consensus        85 ~Lfp~ltV~eNi~~~l~~~~~~~~~~~v~e~l~~~gl~~~~~~~P~~LSGGq~QRVaiARAL~~~P~llLlDEP~saLD~  164 (214)
T cd03297          85 ALFPHLNVRENLAFGLKRKRNREDRISVDELLDLLGLDHLLNRYPAQLSGGEKQRVALARALAAQPELLLLDEPFSALDR  164 (214)
T ss_pred             CCCCCCCHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHHCCHHHCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCH
T ss_conf             65788919999988876798689999999999877997786089777992999999999998719999998088766699


Q ss_pred             HHHHHHHHHHHHHHHHHCCCEEEEECCCHHHH-HHHHH
Q ss_conf             56799999999999972698499974875797-66430
Q gi|254780750|r  745 LDGLSIAWATIEYLHETNRCRGLLATHFHELT-DLSKS  781 (920)
Q Consensus       745 ~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~-~l~~~  781 (920)
                      .-...| ...+..+.+..+..++++||..+-. .+++.
T Consensus       165 ~~~~~i-~~~l~~l~~~~~~t~i~VTHd~~e~~~ladr  201 (214)
T cd03297         165 ALRLQL-LPELKQIKKNLNIPVIFVTHDLSEAEYLADR  201 (214)
T ss_pred             HHHHHH-HHHHHHHHHHHCCEEEEECCCHHHHHHHCCE
T ss_conf             999999-9999999998599899998999999996999


No 194
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1).  NFT1 belongs to the MRP (mulrtidrug resisitance-associated protein) family of ABC transporters.  Some of the MRP members have five additional transmembrane segments in their N-terminas, but the function of these additional membrane-spanning domains is not clear.  The MRP was found in the multidrug-resisting lung cancer cell in which p-glycoprotein was not overexpressed.  MRP exports glutathione by drug stimulation, as well as, certain substrates in conjugated forms with anions such as glutathione, glucuronate, and sulfate.
Probab=97.34  E-value=0.0055  Score=40.75  Aligned_cols=34  Identities=18%  Similarity=0.224  Sum_probs=26.8

Q ss_pred             EEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHH
Q ss_conf             44434563587777664399996778440789999999
Q gi|254780750|r  634 FIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNA  671 (920)
Q Consensus       634 fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqva  671 (920)
                      .|=+|++|..    ..+...-|.|||-+||||++|.++
T Consensus        22 ~iL~~isl~i----~~Ge~v~ivG~sGsGKSTLl~ll~   55 (207)
T cd03369          22 PVLKNVSFKV----KAGEKIGIVGRTGAGKSTLILALF   55 (207)
T ss_pred             CCEEEEEEEE----CCCCEEEEECCCCCCHHHHHHHHH
T ss_conf             7240258898----699999999999987999999999


No 195
>PRK13549 xylose transporter ATP-binding subunit; Provisional
Probab=97.32  E-value=0.0052  Score=40.94  Aligned_cols=33  Identities=15%  Similarity=0.246  Sum_probs=24.9

Q ss_pred             EEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHH
Q ss_conf             4434563587777664399996778440789999999
Q gi|254780750|r  635 IANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNA  671 (920)
Q Consensus       635 VpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqva  671 (920)
                      +=+|+++..    ..+.++-|+|||-+||||++|.++
T Consensus       277 ~l~~vsf~v----~~GEi~gi~G~nGsGKsTLl~~L~  309 (513)
T PRK13549        277 RVDDVSFSL----RRGEILGIAGLVGAGRTELVQCLF  309 (513)
T ss_pred             EEECCEEEE----CCCCEEEEECCCCCCHHHHHHHHH
T ss_conf             652335788----688489974798865899999983


No 196
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria.  Although the specific function of ATM1 is unknown, its disruption results in the accumulation of excess mitochondrial iron, loss of mitochondrial cytochromes, oxidative damage to mitochondrial DNA, and decreased levels of cytosolic heme proteins.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=97.32  E-value=0.0088  Score=39.21  Aligned_cols=41  Identities=32%  Similarity=0.401  Sum_probs=29.5

Q ss_pred             EEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHH
Q ss_conf             44434563587777664399996778440789999999999999719853035
Q gi|254780750|r  634 FIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPAS  686 (920)
Q Consensus       634 fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~  686 (920)
                      .|=+|+++..    ..+.+.-|.|||-+||||++|-+        .|.+-|.+
T Consensus        15 ~iL~~isl~i----~~Ge~v~ivG~sGsGKSTLl~ll--------~gl~~p~~   55 (236)
T cd03253          15 PVLKDVSFTI----PAGKKVAIVGPSGSGKSTILRLL--------FRFYDVSS   55 (236)
T ss_pred             CEEECEEEEE----CCCCEEEEECCCCCCHHHHHHHH--------CCCCCCCC
T ss_conf             6330568998----69999999999999899999997--------43854887


No 197
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional
Probab=97.31  E-value=0.0042  Score=41.65  Aligned_cols=33  Identities=12%  Similarity=0.200  Sum_probs=25.2

Q ss_pred             EEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHH
Q ss_conf             4434563587777664399996778440789999999
Q gi|254780750|r  635 IANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNA  671 (920)
Q Consensus       635 VpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqva  671 (920)
                      +.+|++|..    ..+.++-|.|||-+||||++|.++
T Consensus       268 ~~~~vsl~v----~~GEivgivG~nGsGKSTL~k~L~  300 (501)
T PRK11288        268 LREPISFAV----RRGEIVGFFGLVGAGRSELMKLLY  300 (501)
T ss_pred             CCCCEEEEE----ECCEEEEEECCCCCCHHHHHHHHC
T ss_conf             456634787----088399975688864879999843


No 198
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only]
Probab=97.29  E-value=0.0058  Score=40.58  Aligned_cols=133  Identities=29%  Similarity=0.344  Sum_probs=67.0

Q ss_pred             CEEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHH-----CCCCC-----CHH----------HCCC--
Q ss_conf             0444345635877776643999967784407899999999999997-----19853-----035----------3206--
Q gi|254780750|r  633 PFIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQ-----MGSYV-----PAS----------YAHI--  690 (920)
Q Consensus       633 ~fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQ-----iG~fV-----PA~----------~a~i--  690 (920)
                      .-+-|.++|..    ..+-+..||||-.+||||++|++|.+.=.--     =|-.|     ||=          .+-+  
T Consensus        16 a~il~~isl~v----~~Ge~iaitGPSG~GKStllk~va~Lisp~~G~l~f~Ge~vs~~~pea~Rq~VsY~~Q~paLfg~   91 (223)
T COG4619          16 AKILNNISLSV----RAGEFIAITGPSGCGKSTLLKIVASLISPTSGTLLFEGEDVSTLKPEAYRQQVSYCAQTPALFGD   91 (223)
T ss_pred             CEEECCEEEEE----CCCCEEEEECCCCCCHHHHHHHHHHCCCCCCCEEEECCCCCCCCCHHHHHHHHHHHHCCCCCCCC
T ss_conf             74432413665----38854887678876688999999813699885288747334434859999999999728421466


Q ss_pred             CCCCEE-E------------------EEEECCCCCCCCCCHHH--HHHHHHHHHHHHC-CCCCEEEEECCCCCCCHHH--
Q ss_conf             822105-6------------------76523766113853289--9999999999958-9985699932588988056--
Q gi|254780750|r  691 GIVDKL-F------------------SRVGSADNLASGRSTFM--VEMIETASILNQA-TNQSFVILDEIGRGTATLD--  746 (920)
Q Consensus       691 ~~~D~I-f------------------tRiGa~D~l~~g~STF~--vEm~e~~~IL~~a-t~~SLVllDElGrGTst~D--  746 (920)
                      ++.|++ |                  .|.+-.|.+....-|=|  -|-... .+.++- +---..|+||+   ||..|  
T Consensus        92 tVeDNlifP~~~r~rr~dr~aa~~llar~~l~~~~L~k~it~lSGGE~Qri-AliR~Lq~~P~ILLLDE~---TsALD~~  167 (223)
T COG4619          92 TVEDNLIFPWQIRNRRPDRAAALDLLARFALPDSILTKNITELSGGEKQRI-ALIRNLQFMPKILLLDEI---TSALDES  167 (223)
T ss_pred             CHHHCCCCCHHHHCCCCCHHHHHHHHHHCCCCHHHHCCHHHHCCCHHHHHH-HHHHHHHCCCCEEEECCC---HHHCCHH
T ss_conf             332231142577536888679999998707964664140233166078999-999986307746873371---4333825


Q ss_pred             -HHHHHHHHHHHHHHHCCCEEEEECCCHH
Q ss_conf             -7999999999999726984999748757
Q gi|254780750|r  747 -GLSIAWATIEYLHETNRCRGLLATHFHE  774 (920)
Q Consensus       747 -G~aiA~aile~l~~~~~~~~lfaTHy~e  774 (920)
                       --+|-.-+..|+.+. .--.+..||...
T Consensus       168 nkr~ie~mi~~~v~~q-~vAv~WiTHd~d  195 (223)
T COG4619         168 NKRNIEEMIHRYVREQ-NVAVLWITHDKD  195 (223)
T ss_pred             HHHHHHHHHHHHHHHH-CEEEEEEECCHH
T ss_conf             6888999999970042-458999953858


No 199
>COG4152 ABC-type uncharacterized transport system, ATPase component [General function prediction only]
Probab=97.28  E-value=0.0017  Score=44.63  Aligned_cols=121  Identities=19%  Similarity=0.268  Sum_probs=73.8

Q ss_pred             EEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHCCCCCCC-----EEEEEEECCC---CC
Q ss_conf             443456358777766439999677844078999999999999971985303532068221-----0567652376---61
Q gi|254780750|r  635 IANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHIGIVD-----KLFSRVGSAD---NL  706 (920)
Q Consensus       635 VpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a~i~~~D-----~IftRiGa~D---~l  706 (920)
                      +-||+++..    ..++++=+-|||-+||+|.+|.+.=         |.++.+-+|++..     .+.-|||-=-   -|
T Consensus        17 av~~isf~v----~~G~i~GllG~NGAGKTTtfRmILg---------lle~~~G~I~~~g~~~~~~~~~rIGyLPEERGL   83 (300)
T COG4152          17 AVDNISFEV----PPGEIFGLLGPNGAGKTTTFRMILG---------LLEPTEGEITWNGGPLSQEIKNRIGYLPEERGL   83 (300)
T ss_pred             EECCEEEEE----CCCEEEEEECCCCCCCCCHHHHHHC---------CCCCCCCEEEECCCCHHHHHHHHCCCCHHHHCC
T ss_conf             662413665----4871787665888973233999864---------578667668985851005556540658154066


Q ss_pred             CC-----CCCHHHHHHH----------------------------------------HHHHHHHHCCCCCEEEEECCCCC
Q ss_conf             13-----8532899999----------------------------------------99999995899856999325889
Q gi|254780750|r  707 AS-----GRSTFMVEMI----------------------------------------ETASILNQATNQSFVILDEIGRG  741 (920)
Q Consensus       707 ~~-----g~STF~vEm~----------------------------------------e~~~IL~~at~~SLVllDElGrG  741 (920)
                      ..     .+=-|..++.                                        =++.+++   +--||||||-..|
T Consensus        84 y~k~tv~dql~yla~LkGm~~~e~~~~~~~wLer~~i~~~~~~kIk~LSKGnqQKIQfisaviH---ePeLlILDEPFSG  160 (300)
T COG4152          84 YPKMTVEDQLKYLAELKGMPKAEIQKKLQAWLERLEIVGKKTKKIKELSKGNQQKIQFISAVIH---EPELLILDEPFSG  160 (300)
T ss_pred             CCCCCHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHC---CCCEEEECCCCCC
T ss_conf             7567199999999986499689999999999996065654442477753011678999999852---8877996688668


Q ss_pred             CCHHHHHHHHHHHHHHHHHHCCCEEEEECCCH
Q ss_conf             88056799999999999972698499974875
Q gi|254780750|r  742 TATLDGLSIAWATIEYLHETNRCRGLLATHFH  773 (920)
Q Consensus       742 Tst~DG~aiA~aile~l~~~~~~~~lfaTHy~  773 (920)
                      -+|-.--++--+|.+.= + .|+..+|+||--
T Consensus       161 LDPVN~elLk~~I~~lk-~-~GatIifSsH~M  190 (300)
T COG4152         161 LDPVNVELLKDAIFELK-E-EGATIIFSSHRM  190 (300)
T ss_pred             CCHHHHHHHHHHHHHHH-H-CCCEEEEECCHH
T ss_conf             87232999999999987-3-587799853337


No 200
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment.  ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition, to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=97.27  E-value=0.0073  Score=39.81  Aligned_cols=139  Identities=20%  Similarity=0.273  Sum_probs=69.5

Q ss_pred             EEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCC------CC---CHHH--CCCCCC---CEEEEEE
Q ss_conf             44345635877776643999967784407899999999999997198------53---0353--206822---1056765
Q gi|254780750|r  635 IANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGS------YV---PASY--AHIGIV---DKLFSRV  700 (920)
Q Consensus       635 VpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~------fV---PA~~--a~i~~~---D~IftRi  700 (920)
                      +=+|++|..    ..+.+..|-|||-+||||+||.++-+.= ..-|.      -|   +...  -.++.+   ..+|-.+
T Consensus        16 al~~vsl~i----~~Ge~~~ilGpSG~GKSTllr~i~gl~~-p~~G~I~i~g~~i~~~~~~~lrr~ig~vfQ~~~Lfp~l   90 (242)
T cd03295          16 AVNNLNLEI----AKGEFLVLIGPSGSGKTTTMKMINRLIE-PTSGEIFIDGEDIREQDPVELRRKIGYVIQQIGLFPHM   90 (242)
T ss_pred             EEEEEEEEE----CCCCEEEEECCCCCHHHHHHHHHHCCCC-CCCEEEEECCEECCCCCHHHHHCCCEEEECCCCCCCCC
T ss_conf             983027688----6998999999999569999999975999-98159999999999999789738867991799758888


Q ss_pred             ECCCCCC-----CCCCHHH-----HHHHHH-----HHHHH-------------------HCCCCCEEEEECCCCCCCHHH
Q ss_conf             2376611-----3853289-----999999-----99999-------------------589985699932588988056
Q gi|254780750|r  701 GSADNLA-----SGRSTFM-----VEMIET-----ASILN-------------------QATNQSFVILDEIGRGTATLD  746 (920)
Q Consensus       701 Ga~D~l~-----~g~STF~-----vEm~e~-----~~IL~-------------------~at~~SLVllDElGrGTst~D  746 (920)
                      -..||+.     .|.|.--     .|+.+.     +.+++                   -|..-.++|+||-   ||..|
T Consensus        91 tV~eNi~~~~~~~~~~~~~~~~rv~ell~~v~L~~~~~~~~~p~~LSGGqkQRvaiARAl~~~P~ilLlDEP---~saLD  167 (242)
T cd03295          91 TVEENIALVPKLLKWPKEKIRERADELLALVGLDPAEFADRYPHELSGGQQQRVGVARALAADPPLLLMDEP---FGALD  167 (242)
T ss_pred             CHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCCHHHCCCCHHHCCHHHHHHHHHHHHHHCCCCEEEECCC---CCCCC
T ss_conf             299999999997599999999999999987499930110079566899999999999999629999998187---65469


Q ss_pred             HHH--HHHHHHHHHHHHCCCEEEEECCCHHHH-HHHHH
Q ss_conf             799--999999999972698499974875797-66430
Q gi|254780750|r  747 GLS--IAWATIEYLHETNRCRGLLATHFHELT-DLSKS  781 (920)
Q Consensus       747 G~a--iA~aile~l~~~~~~~~lfaTHy~eL~-~l~~~  781 (920)
                      -..  --|..+..|.+..+-.++|+||.-+.+ .+++.
T Consensus       168 ~~~~~~i~~~l~~l~~~~~~T~i~vTHd~~ea~~~aDr  205 (242)
T cd03295         168 PITRDQLQEEFKRLQQELGKTIVFVTHDIDEAFRLADR  205 (242)
T ss_pred             HHHHHHHHHHHHHHHHHHCCEEEEECCCHHHHHHHCCE
T ss_conf             89999999999999997599999999899999996998


No 201
>PRK10762 D-ribose transporter ATP binding protein; Provisional
Probab=97.26  E-value=0.0063  Score=40.28  Aligned_cols=31  Identities=16%  Similarity=0.333  Sum_probs=23.9

Q ss_pred             EEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHH
Q ss_conf             34563587777664399996778440789999999
Q gi|254780750|r  637 NDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNA  671 (920)
Q Consensus       637 Ndi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqva  671 (920)
                      +|++|..    ..+.++-|.|||-+||||++|.++
T Consensus       269 ~~vs~~v----~~GEi~gi~G~nGsGKsTL~~~l~  299 (501)
T PRK10762        269 NDVSFTL----RKGEILGVSGLMGAGRTELMKVLY  299 (501)
T ss_pred             CCEEEEE----CCCCEEEEECCCCCCHHHHHHHHH
T ss_conf             6344476----688189966788876889999981


No 202
>cd03291 ABCC_CFTR1 The CFTR subfamily domain 1.  The cystic fibrosis transmembrane regulator (CFTR), the product of the gene mutated in patients with cystic fibrosis, has adapted the ABC transporter structural motif to form a tightly regulated anion channel at the apical surface of many epithelia.  Use of the term assembly of a functional ion channel implies the coming together of subunits, or at least smaller not-yet functional components of the active whole.  In fact, on the basis of current knowledge only the CFTR polypeptide itself is required to form an ATP- and protein kinase A-dependent low-conductance chloride channel of the type present in the apical membrane of many epithelial cells.  CFTR displays the typical organization (IM-ABC)2 and carries a characteristic hydrophilic R-domain that separates IM1-ABC1 from IM2-ABC2.
Probab=97.25  E-value=0.0089  Score=39.18  Aligned_cols=124  Identities=18%  Similarity=0.218  Sum_probs=63.1

Q ss_pred             EEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHC-----CCCCCCE---EEEEEECCCCC
Q ss_conf             443456358777766439999677844078999999999999971985303532-----0682210---56765237661
Q gi|254780750|r  635 IANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYA-----HIGIVDK---LFSRVGSADNL  706 (920)
Q Consensus       635 VpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a-----~i~~~D~---IftRiGa~D~l  706 (920)
                      |=+|+++..    ..+...-|.|||-+||||+++.+.        |.+-|-+-.     +++.+.+   +|.. --.|||
T Consensus        52 VLk~Isf~I----~~Ge~vaIVG~sGSGKSTLl~lL~--------gl~~p~~G~I~~~g~i~~v~Q~~~lf~~-TireNI  118 (282)
T cd03291          52 VLKNINLKI----EKGEMLAITGSTGSGKTSLLMLIL--------GELEPSEGKIKHSGRISFSSQFSWIMPG-TIKENI  118 (282)
T ss_pred             EEECEEEEE----CCCCEEEEECCCCCHHHHHHHHHH--------CCCCCCCCEEEECCEEEEECCCCCCCCC-CHHHHH
T ss_conf             141648998----499999999999981999999995--------7872786589999999986574422671-099997


Q ss_pred             CCCCCHH---HHHHHHHH---HHHH------------------------------HCCCCCEEEEECCCCCCCHHHHH--
Q ss_conf             1385328---99999999---9999------------------------------58998569993258898805679--
Q gi|254780750|r  707 ASGRSTF---MVEMIETA---SILN------------------------------QATNQSFVILDEIGRGTATLDGL--  748 (920)
Q Consensus       707 ~~g~STF---~vEm~e~~---~IL~------------------------------~at~~SLVllDElGrGTst~DG~--  748 (920)
                      .-|.+.=   +.+..+.+   ..+.                              -.....++|+||-   ||..|-.  
T Consensus       119 ~~g~~~~~~~~~~~~~~~~l~~~i~~lp~g~~t~vge~G~~LSGGQkQRlaiARALl~~p~IliLDEp---TS~LD~~tE  195 (282)
T cd03291         119 IFGVSYDEYRYKSVVKACQLEEDITKFPEKDNTVLGEGGITLSGGQRARISLARAVYKDADLYLLDSP---FGYLDVFTE  195 (282)
T ss_pred             HCCCCCCHHHHHHHHHHHCCHHHHHHCCCCCCCEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECC---CCCCCHHHH
T ss_conf             51688688999999998514999984634255230036775899999999999998428998998687---766898789


Q ss_pred             -HHHHHHHHHHHHHCCCEEEEECCCHHHH
Q ss_conf             -9999999999972698499974875797
Q gi|254780750|r  749 -SIAWATIEYLHETNRCRGLLATHFHELT  776 (920)
Q Consensus       749 -aiA~aile~l~~~~~~~~lfaTHy~eL~  776 (920)
                       .|-.+++..+.  .+..+++.||-.+..
T Consensus       196 ~~I~~~~l~~~~--~~kTvI~ItHrL~~i  222 (282)
T cd03291         196 KEIFESCVCKLM--ANKTRILVTSKMEHL  222 (282)
T ss_pred             HHHHHHHHHHHH--CCCEEEEEECCHHHH
T ss_conf             999999999986--899899993788889


No 203
>PRK09700 D-allose transporter ATP-binding protein; Provisional
Probab=97.25  E-value=0.013  Score=37.85  Aligned_cols=31  Identities=16%  Similarity=0.236  Sum_probs=25.2

Q ss_pred             EEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHH
Q ss_conf             34563587777664399996778440789999999
Q gi|254780750|r  637 NDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNA  671 (920)
Q Consensus       637 Ndi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqva  671 (920)
                      +|+++..    ..+.++-|.|||-+||||++|.++
T Consensus       280 ~~vsf~v----~~GEi~gl~G~nGsGKsTL~~~l~  310 (510)
T PRK09700        280 RDISFSV----CRGEILGFAGLVGSGRTELMNCLF  310 (510)
T ss_pred             EEEEEEE----CCCCEEEEECCCCCCHHHHHHHHH
T ss_conf             4335787----488189997688862889999981


No 204
>pfam01695 IstB IstB-like ATP binding protein. This protein contains an ATP/GTP binding P-loop motif. It is found associated with IS21 family insertion sequences. The function of this protein is unknown, but it may perform a transposase function.
Probab=97.22  E-value=0.015  Score=37.57  Aligned_cols=101  Identities=24%  Similarity=0.298  Sum_probs=65.3

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHCCCCCCCEEEEEEEC-CCCCCCCCCHHHHHHHHHHHHHHHCCCC
Q ss_conf             999967784407899999999999997198530353206822105676523-7661138532899999999999958998
Q gi|254780750|r  652 LWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHIGIVDKLFSRVGS-ADNLASGRSTFMVEMIETASILNQATNQ  730 (920)
Q Consensus       652 ~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a~i~~~D~IftRiGa-~D~l~~g~STF~vEm~e~~~IL~~at~~  730 (920)
                      =++++||...|||-+.-.+|.-.+.  -|.-|            +|.++.. -+.+....+.     .+....++.-.+-
T Consensus        49 Nlll~G~~GtGKThLA~Ai~~~~~~--~g~~v------------~f~~~~~L~~~l~~~~~~-----~~~~~~l~~~~~~  109 (178)
T pfam01695        49 NLLLLGPPGVGKTHLACALGHQACR--AGYSV------------LFTRTPDLVEQLKRARGD-----GRLARTLQRLAKA  109 (178)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHHHH--CCCEE------------EEEECHHHHHHHHHHHHC-----CCHHHHHHHHHCC
T ss_conf             6899899998789999999999998--69859------------999616799999987526-----7499999996258


Q ss_pred             CEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCH
Q ss_conf             5699932588988056799999999999972698499974875
Q gi|254780750|r  731 SFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFH  773 (920)
Q Consensus       731 SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~  773 (920)
                      .|+|+||+|.-..+..+..+-+-++++-.++ + .++|+|.++
T Consensus       110 dlLIiDDlG~~~~s~~~~~~lf~li~~Rye~-~-stIiTSN~~  150 (178)
T pfam01695       110 DLLILDDIGYLPLSQEAAHLLFELISDRYER-R-STILTSNLP  150 (178)
T ss_pred             CEEEEEHHCCCCCCHHHHHHHHHHHHHHHCC-C-CEEEECCCC
T ss_conf             9788720016568989999999999999756-8-868776899


No 205
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA; InterPro: IPR005895   ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs.   ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain .    The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , .   The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , .   Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1).     This family contains the cytochrome c biogenesis protein encoded by ccmA in bacteria and one arabidopsis protein, possibly encoded by an organelle. Bacterial c-type cytochromes are located on the periplasmic side of the cytoplasmic membrane. Several gene products encoded in a locus designated as 'ccm' are implicated in the transport and assembly of the functional cytochrome C. This cluster includes genes: ccmA;B;C;D;E;F;G and H. The post-translational pathway includes the transport of a heme moiety, the secretion of the apoprotein and the covalent attachment of the heme with the apoprotein. The proteins ccmA and B represent an ABC transporter; ccmC and D participate in heme transfer to ccmE, which functions as a periplasmic heme chaperone. The presence of ccmF, G and H is suggested to be obligatory for the final functional assembly of cytochrome c.; GO: 0005215 transporter activity, 0017004 cytochrome complex assembly, 0030288 outer membrane-bounded periplasmic space.
Probab=97.21  E-value=0.00036  Score=49.57  Aligned_cols=124  Identities=27%  Similarity=0.280  Sum_probs=64.6

Q ss_pred             CEEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHH-----------CCCCCCHHH-CCCCCCCEEEEEE
Q ss_conf             0444345635877776643999967784407899999999999997-----------198530353-2068221056765
Q gi|254780750|r  633 PFIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQ-----------MGSYVPASY-AHIGIVDKLFSRV  700 (920)
Q Consensus       633 ~fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQ-----------iG~fVPA~~-a~i~~~D~IftRi  700 (920)
                      -|-+-+++++      .+.+++|+|||-+||||+||.+|=+..-..           -.-.-|.+. +-+|=-|.|=...
T Consensus        15 ~f~~l~F~l~------aGe~l~v~GpNG~GKTtLLR~LAGL~~P~~G~v~~~~~~~~~~~~~~~~~~~YlGH~~GlK~~L   88 (204)
T TIGR01189        15 LFEGLSFTLN------AGEALQVEGPNGIGKTTLLRILAGLLRPESGEVRLNGTALAEQRDEPHENLLYLGHLDGLKPEL   88 (204)
T ss_pred             EECCCEEEEE------CCCEEEEEECCCCCHHHHHHHHHHCCCCCCCEEEECCCCCHHHCCCHHHHHHHHHHHCCCCCCC
T ss_conf             3011234540------7827898606987357899999850588665575288224211564778788885100345013


Q ss_pred             ECCCCCCCCCCHHHHHHHH---------------------HHHHHH----------------HCCCCCEEEEECCCCCCC
Q ss_conf             2376611385328999999---------------------999999----------------589985699932588988
Q gi|254780750|r  701 GSADNLASGRSTFMVEMIE---------------------TASILN----------------QATNQSFVILDEIGRGTA  743 (920)
Q Consensus       701 Ga~D~l~~g~STF~vEm~e---------------------~~~IL~----------------~at~~SLVllDElGrGTs  743 (920)
                      -+..||     +|..+...                     .+.+.-                --|.+-|=||||-   |-
T Consensus        89 sa~ENL-----~F~~~~~~stCs~~~~~~~~AL~~vgL~g~e~~p~~~LSAGQqRRlaLARL~l~~~PlWiLDEP---~t  160 (204)
T TIGR01189        89 SALENL-----QFWAAIHGSTCSSEQLTIEDALAAVGLTGLEDLPAAQLSAGQQRRLALARLWLSRAPLWILDEP---TT  160 (204)
T ss_pred             CHHHHH-----HHHHHHHHCCCCCCCCCHHHHHHHCCCCCHHHHHHHHCCCHHHHHHHHHHHHHCCCCEEEECCC---HH
T ss_conf             778879-----9999985201683124779999760843314589874061468999999886337972220365---14


Q ss_pred             HHH--HHHHHHHH-HHHHHHHCCCEEEEECCC
Q ss_conf             056--79999999-999997269849997487
Q gi|254780750|r  744 TLD--GLSIAWAT-IEYLHETNRCRGLLATHF  772 (920)
Q Consensus       744 t~D--G~aiA~ai-le~l~~~~~~~~lfaTHy  772 (920)
                      ..|  |+++-.++ -.|+ .+ |=.+|.|||-
T Consensus       161 ALD~~Gv~~l~~~~~~H~-~r-GG~vlltTH~  190 (204)
T TIGR01189       161 ALDKAGVALLAALLAAHL-AR-GGIVLLTTHQ  190 (204)
T ss_pred             HCCHHHHHHHHHHHHHHH-HC-CCCEEEECCC
T ss_conf             306899999999999998-60-0513663475


No 206
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=97.16  E-value=0.0035  Score=42.19  Aligned_cols=53  Identities=19%  Similarity=0.178  Sum_probs=34.9

Q ss_pred             CCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHH-HHHH
Q ss_conf             89985699932588988056799999999999972698499974875797-6643
Q gi|254780750|r  727 ATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFHELT-DLSK  780 (920)
Q Consensus       727 at~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~-~l~~  780 (920)
                      |..-.++|+||--.|=++.- ..--+..++.|.+..+..++++||.-+.. .+++
T Consensus       166 a~~P~iLilDEPTagLDp~~-~~~i~~ll~~L~~~~g~Tvi~vtHdm~~v~~~aD  219 (289)
T PRK13645        166 AMDGNTLVLDEPTGGLDPKG-EEDFINLFERLNKEYKKRIIMVTHNMDQVLRIAD  219 (289)
T ss_pred             HCCCCEEEEECCCCCCCHHH-HHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCC
T ss_conf             63999999958876489899-9999999999999569999999159999999799


No 207
>KOG0927 consensus
Probab=97.16  E-value=0.025  Score=35.79  Aligned_cols=144  Identities=21%  Similarity=0.209  Sum_probs=83.1

Q ss_pred             EEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHCCCCCCCEEEEEEECCCCCCCCCCHHH
Q ss_conf             44345635877776643999967784407899999999999997198530353206822105676523766113853289
Q gi|254780750|r  635 IANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHIGIVDKLFSRVGSADNLASGRSTFM  714 (920)
Q Consensus       635 VpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a~i~~~D~IftRiGa~D~l~~g~STF~  714 (920)
                      +-+++.+|.+-   +.|+. +-|||..||||+||.+-- -+.-.+|.-.|-..+.++.|.+=   .+-.=++...-++||
T Consensus       405 iy~~l~fgid~---~srvA-lVGPNG~GKsTLlKl~~g-dl~p~~G~vs~~~H~~~~~y~Qh---~~e~ldl~~s~le~~  476 (614)
T KOG0927         405 IYKKLNFGIDL---DSRVA-LVGPNGAGKSTLLKLITG-DLQPTIGMVSRHSHNKLPRYNQH---LAEQLDLDKSSLEFM  476 (614)
T ss_pred             HHHHHHCCCCC---CCCEE-EECCCCCCHHHHHHHHHH-CCCCCCCCCCCCCCCCCHHHHHH---HHHHCCCCHHHHHHH
T ss_conf             55420114575---54224-766898764666788750-34666551242223320023355---676417515478989


Q ss_pred             HH-------HHHHHHHHHHC-----------------------------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             99-------99999999958-----------------------------9985699932588988056799999999999
Q gi|254780750|r  715 VE-------MIETASILNQA-----------------------------TNQSFVILDEIGRGTATLDGLSIAWATIEYL  758 (920)
Q Consensus       715 vE-------m~e~~~IL~~a-----------------------------t~~SLVllDElGrGTst~DG~aiA~aile~l  758 (920)
                      .+       ..+...||...                             +.--|+||||---|-++.-=.++|-|+=   
T Consensus       477 ~~~~~~~~~~e~~r~ilgrfgLtgd~q~~p~~~LS~Gqr~rVlFa~l~~kqP~lLlLDEPtnhLDi~tid~laeaiN---  553 (614)
T KOG0927         477 MPKFPDEKELEEMRSILGRFGLTGDAQVVPMSQLSDGQRRRVLFARLAVKQPHLLLLDEPTNHLDIETIDALAEAIN---  553 (614)
T ss_pred             HHHCCCCCHHHHHHHHHHHHCCCCCCCCCCHHHCCCCCCHHHHHHHHHHCCCCEEEECCCCCCCCCHHHHHHHHHHH---
T ss_conf             97625646299999999871877521013364426100014789998843884798548876788506999999985---


Q ss_pred             HHHCCCEEEEECCCHHH-HHHHHHCCCEEEEEEE
Q ss_conf             97269849997487579-7664306885899999
Q gi|254780750|r  759 HETNRCRGLLATHFHEL-TDLSKSLKRFHNATLQ  791 (920)
Q Consensus       759 ~~~~~~~~lfaTHy~eL-~~l~~~~~~v~n~~~~  791 (920)
                       +..| -+++.+|..-| ...+++.+-+.|+.+.
T Consensus       554 -e~~G-gvv~vSHDfrlI~qVaeEi~~c~~~~~~  585 (614)
T KOG0927         554 -EFPG-GVVLVSHDFRLISQVAEEIWVCENGTVT  585 (614)
T ss_pred             -CCCC-CEEEEECHHHHHHHHHHHHHHHCCCCEE
T ss_conf             -2678-5155321234899887776701058366


No 208
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1.  In fact, the yeast MDL1 (multidrug resistance-like protein 1) and MDL2 (multidrug resistance-like protein 2) transporters are also included in this CD.  MDL1 is an ATP-dependent permease that acts as a high-copy suppressor of ATM1 and is thought to have a role in resistance to oxidative stress. Interestingly, subfamily B is more closely related to the carboxyl-terminal component of subfamily C than the two halves of ABCC molecules are with one another.
Probab=97.15  E-value=0.009  Score=39.14  Aligned_cols=34  Identities=29%  Similarity=0.252  Sum_probs=25.4

Q ss_pred             EEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHH
Q ss_conf             44434563587777664399996778440789999999
Q gi|254780750|r  634 FIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNA  671 (920)
Q Consensus       634 fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqva  671 (920)
                      .|=+|++|..    ..+...-|.||+-+||||+++.+.
T Consensus        17 ~vL~~isl~i----~~G~~iaIvG~sGsGKSTLl~ll~   50 (238)
T cd03249          17 PILKGLSLTI----PPGKTVALVGSSGCGKSTVVSLLE   50 (238)
T ss_pred             EEECCEEEEE----CCCCEEEEECCCCCCHHHHHHHHH
T ss_conf             5222558997----699999999999998999999982


No 209
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism]
Probab=97.10  E-value=0.0035  Score=42.17  Aligned_cols=49  Identities=22%  Similarity=0.192  Sum_probs=31.1

Q ss_pred             CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHH
Q ss_conf             99856999325889880567999999999999726984999748757976
Q gi|254780750|r  728 TNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFHELTD  777 (920)
Q Consensus       728 t~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~~  777 (920)
                      ..-.++|+||-..|=++. |..-....+..|....+...+.+||..+...
T Consensus       155 ~~P~iliLDEPta~LD~~-~~~~l~~~l~~L~~~~~~tiii~tHd~~~~~  203 (235)
T COG1122         155 MGPEILLLDEPTAGLDPK-GRRELLELLKKLKEEGGKTIIIVTHDLELVL  203 (235)
T ss_pred             CCCCEEEECCCCCCCCHH-HHHHHHHHHHHHHHCCCCEEEEEECCHHHHH
T ss_conf             189899974998898978-9999999999988607976999947478988


No 210
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E. coli.  The hemolysin A (HlyA) transport machinery is composed of the ATP-binding cassette (ABC) transporter HlyB located in the inner membrane, hemolysin D (HlyD), also anchored in the inner membrane, and TolC, which resides in the outer membrane.  HlyD apparently forms a continuous channel that bridges the entire periplasm, interacting with TolC and HlyB.  This arrangement prevents the appearance of periplasmic intermediates of HlyA during substrate transport.  Little is known about the molecular details of HlyA transport, but it is evident that ATP-hydrolysis by the ABC-transporter HlyB is a necessary source of energy.
Probab=97.10  E-value=0.015  Score=37.57  Aligned_cols=36  Identities=25%  Similarity=0.365  Sum_probs=27.4

Q ss_pred             CCEEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHH
Q ss_conf             7044434563587777664399996778440789999999
Q gi|254780750|r  632 KPFIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNA  671 (920)
Q Consensus       632 ~~fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqva  671 (920)
                      .++|=+++++..    ..+.+.-|.||+-+||||++|.+.
T Consensus        14 ~~~~L~~is~~i----~~G~~vaivG~sGsGKSTll~ll~   49 (237)
T cd03252          14 GPVILDNISLRI----KPGEVVGIVGRSGSGKSTLTKLIQ   49 (237)
T ss_pred             CCCCEECCEEEE----CCCCEEEEECCCCCHHHHHHHHHH
T ss_conf             957251508998----799999999999985999999996


No 211
>pfam00154 RecA recA bacterial DNA recombination protein. RecA is a DNA-dependent ATPase and functions in DNA repair systems. RecA protein catalyses an ATP-dependent DNA strand-exchange reaction that is the central step in the repair of dsDNA breaks by homologous recombination.
Probab=97.09  E-value=0.0069  Score=40.01  Aligned_cols=130  Identities=20%  Similarity=0.260  Sum_probs=71.5

Q ss_pred             EEEEECCCCCCCCCEEEEEECCCCCCHHHH-HHHHHHHHHHHH-CCC---CCCHHHCCCCCCCEEEEEEEC-CCCCCCCC
Q ss_conf             345635877776643999967784407899-999999999997-198---530353206822105676523-76611385
Q gi|254780750|r  637 NDCDLSCPNDKNSGKLWLLTGPNMGGKSTF-LRQNALIVIMAQ-MGS---YVPASYAHIGIVDKLFSRVGS-ADNLASGR  710 (920)
Q Consensus       637 Ndi~l~~~~~~~~~~~~iiTGpNmgGKSt~-lRqval~vilAQ-iG~---fVPA~~a~i~~~D~IftRiGa-~D~l~~g~  710 (920)
                      -|.-||..+ -..+|+..|.||..+||||+ +..++-    || .|.   |+-|+.|-=+   .-...+|- .|++.--+
T Consensus        40 lD~aLg~GG-lP~GRi~ei~G~essGKTtlal~~ia~----aQk~gg~~~~iD~E~a~d~---~~a~~lGVD~~~l~~~q  111 (322)
T pfam00154        40 LDIALGIGG-LPKGRIIEIYGPESSGKTTLALHAIAE----AQKAGGTAAFIDAEHALDP---VYAKKLGVDIDNLLVSQ  111 (322)
T ss_pred             HHHHHCCCC-CCCCEEEEEECCCCCCHHHHHHHHHHH----HHHCCCEEEEEEHHHHCCH---HHHHHCCCCHHHEEEEC
T ss_conf             999875899-778708999889877789999999999----9734993899853660598---89998098802538977


Q ss_pred             CHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHH----------H-----HHHHHHHHHHHHHHCCCEEEEECCCHH
Q ss_conf             328999999999999589985699932588988056----------7-----999999999999726984999748757
Q gi|254780750|r  711 STFMVEMIETASILNQATNQSFVILDEIGRGTATLD----------G-----LSIAWATIEYLHETNRCRGLLATHFHE  774 (920)
Q Consensus       711 STF~vEm~e~~~IL~~at~~SLVllDElGrGTst~D----------G-----~aiA~aile~l~~~~~~~~lfaTHy~e  774 (920)
                      ....-++.++..-|-+...-.||++|=+|-=....+          |     ++-|+-.+...+.+.+|..+|..|..+
T Consensus       112 pd~~Eqal~i~~~li~~~~~~liViDSvaal~p~~E~e~~~~d~~~g~~Ar~ms~alRklt~~l~k~~~~~IfiNQ~R~  190 (322)
T pfam00154       112 PDTGEQALEIADMLVRSGAVDLIVVDSVAALVPKAEIEGEMGDSHVGLQARLMSQALRKLTGNISKSNTTVIFINQIRM  190 (322)
T ss_pred             CCHHHHHHHHHHHHHCCCCCCEEEEECCCCCCCHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHCCCCEEEEEEEEHH
T ss_conf             8839999999999853799765998253456768887524322321357999999999999997305854999765511


No 212
>COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only]
Probab=97.03  E-value=0.012  Score=38.14  Aligned_cols=54  Identities=20%  Similarity=0.258  Sum_probs=33.7

Q ss_pred             CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHH---HCCCEEEEECCCHHHHHHHHHCCCE
Q ss_conf             998569993258898805679999999999997---2698499974875797664306885
Q gi|254780750|r  728 TNQSFVILDEIGRGTATLDGLSIAWATIEYLHE---TNRCRGLLATHFHELTDLSKSLKRF  785 (920)
Q Consensus       728 t~~SLVllDElGrGTst~DG~aiA~aile~l~~---~~~~~~lfaTHy~eL~~l~~~~~~v  785 (920)
                      ....|+|...--||-+--   |++ .|-+.|.+   ..++-.|+++-..|+-.+++...-+
T Consensus       420 ~~p~lLI~~qPTrGLDvg---A~~-~I~~~l~e~r~~G~AVLLiS~dLDEil~lsDrIaVi  476 (501)
T COG3845         420 RRPDLLIAAQPTRGLDVG---AIE-FIHERLLELRDAGKAVLLISEDLDEILELSDRIAVI  476 (501)
T ss_pred             CCCCEEEECCCCCCCCHH---HHH-HHHHHHHHHHHCCCEEEEEEHHHHHHHHHHHEEEEE
T ss_conf             599889986878664689---999-999999999866987999961078999752144100


No 213
>PRK06526 transposase; Provisional
Probab=97.01  E-value=0.023  Score=36.12  Aligned_cols=95  Identities=16%  Similarity=0.206  Sum_probs=65.5

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHCCCCCCCEEEEEEECCCCCCCCCCHHHHHHHH------HHHHHHH
Q ss_conf             9996778440789999999999999719853035320682210567652376611385328999999------9999995
Q gi|254780750|r  653 WLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHIGIVDKLFSRVGSADNLASGRSTFMVEMIE------TASILNQ  726 (920)
Q Consensus       653 ~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a~i~~~D~IftRiGa~D~l~~g~STF~vEm~e------~~~IL~~  726 (920)
                      +||+||-..|||-+.-.+|.-++.+  |.-|            .|+++.   +|       +-++.+      ....++.
T Consensus       101 vil~G~~GtGKThLA~Alg~~A~~~--G~~v------------~f~~~~---~L-------~~~L~~a~~~g~~~~~~~~  156 (254)
T PRK06526        101 VVFLGPPGTGKTHLAIGLGIRACQA--GHRV------------LFATAA---QW-------VARLAAAHHAGRLQDELVK  156 (254)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHHHC--CCCE------------EEEEHH---HH-------HHHHHHHHHCCCHHHHHHH
T ss_conf             8998999986899999999999986--9967------------998779---99-------9999998855809999998


Q ss_pred             CCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCH
Q ss_conf             89985699932588988056799999999999972698499974875
Q gi|254780750|r  727 ATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFH  773 (920)
Q Consensus       727 at~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~  773 (920)
                      -.+-.|+|+||+|----+.+|..+-+.+++.-.++ ++ ++++|.++
T Consensus       157 l~~~dLLIiDe~g~~~~~~~~a~~lf~li~~Rye~-~S-~IiTSn~~  201 (254)
T PRK06526        157 LGRIPLLIVDEVGYIPFEAEAANLFFQLVSSRYER-AS-LIVTSNKP  201 (254)
T ss_pred             HHCCCEEEEECCCCCCCCHHHHHHHHHHHHHHHCC-CC-EEEECCCC
T ss_conf             51368776502136447889999999999999745-88-67665898


No 214
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively.  Histidine permease is a multisubunit complex containing the HisQ and HisM integral membrane subunits and two copies of HisP.  HisP has properties intermediate between those of integral and peripheral membrane proteins and is accessible from both sides of the membrane, presumably by its interaction with HisQ and HisM.  The two HisP subunits form a homodimer within the complex.  The domain structure of the amino acid uptake systems is typical for prokaryote extracellular solute binding protein-dependent uptake systems.  All of the amino acid uptake systems also have at least one, and in a few cases, two extracellular solute binding proteins located in the periplasm of Gram-negative bacteria, or attached to the cell membrane of Gram-positive bacteria.  The best-studied member of the PAAT (polar amino acid transport) family is the HisJQM
Probab=97.00  E-value=0.014  Score=37.71  Aligned_cols=138  Identities=23%  Similarity=0.294  Sum_probs=70.1

Q ss_pred             EEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHH-----CCCCCCHHHC-------CCCCC---CEEEEE
Q ss_conf             44345635877776643999967784407899999999999997-----1985303532-------06822---105676
Q gi|254780750|r  635 IANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQ-----MGSYVPASYA-------HIGIV---DKLFSR  699 (920)
Q Consensus       635 VpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQ-----iG~fVPA~~a-------~i~~~---D~IftR  699 (920)
                      |=+|++|..    ..+.+..|.||.-+||||+||.++-+.--..     -|--|.....       ++|.+   -.+|-.
T Consensus        15 vL~~vsl~i----~~Ge~~~ivGpSGsGKSTLL~~i~gL~~p~~G~i~i~g~~i~~~~~~~~~~rr~iG~VFQ~~~L~p~   90 (213)
T cd03262          15 VLKGIDLTV----KKGEVVVIIGPSGSGKSTLLRCINLLEEPDSGTIIIDGLKLTDDKKNINELRQKVGMVFQQFNLFPH   90 (213)
T ss_pred             EECCEEEEE----CCCCEEEEECCCCCHHHHHHHHHHCCCCCCCEEEEECCEECCCCHHHHHHHHCCCEEEECCCCCCCC
T ss_conf             886707598----8998999999998449999999981999986499999999999815699986782799679875899


Q ss_pred             EECCCCCCC------CCCHHHHHHHHHH----------------------------HHHH-HCCCCCEEEEECCCCCCCH
Q ss_conf             523766113------8532899999999----------------------------9999-5899856999325889880
Q gi|254780750|r  700 VGSADNLAS------GRSTFMVEMIETA----------------------------SILN-QATNQSFVILDEIGRGTAT  744 (920)
Q Consensus       700 iGa~D~l~~------g~STF~vEm~e~~----------------------------~IL~-~at~~SLVllDElGrGTst  744 (920)
                      +-+.||+.-      |.|.  .|..+.+                            .|-| -|++-.++|+||--.+=++
T Consensus        91 ltv~eNV~~~l~~~~~~~~--~e~~~~a~~~L~~vgL~~~~~~~P~~LSGGqqQRVAIARALa~~P~ilL~DEPts~LD~  168 (213)
T cd03262          91 LTVLENITLAPIKVKGMSK--AEAEERALELLEKVGLADKADAYPAQLSGGQQQRVAIARALAMNPKVMLFDEPTSALDP  168 (213)
T ss_pred             CCHHHHHHHHHHHHCCCCH--HHHHHHHHHHHHHCCCHHHHCCCHHHCCCHHHHHHHHHHHHCCCCCEEEECCCCCCCCH
T ss_conf             9199999999999769999--99999999999868997887499444692999999999996379999997088887798


Q ss_pred             HHHHHHHHHHHHHHHHHCCCEEEEECCCHHHH-HHHH
Q ss_conf             56799999999999972698499974875797-6643
Q gi|254780750|r  745 LDGLSIAWATIEYLHETNRCRGLLATHFHELT-DLSK  780 (920)
Q Consensus       745 ~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~-~l~~  780 (920)
                      .-...| ...+..|.+. +..++++||..+.+ .+++
T Consensus       169 ~~~~~i-~~ll~~l~~~-g~T~i~VTHD~~~a~~~aD  203 (213)
T cd03262         169 ELVGEV-LDVMKDLAEE-GMTMVVVTHEMGFAREVAD  203 (213)
T ss_pred             HHHHHH-HHHHHHHHHC-CCEEEEECCCHHHHHHHCC
T ss_conf             999999-9999999862-9999999989999999689


No 215
>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family; InterPro: IPR014324   ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs.   ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain .    The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , .   The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , .   Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1).    This entry represents the ATP-binding subunit DevA, found mostly in the Cyanobacteria, but also in the Planctomycetes. Cyanobacterial examples are involved in heterocyst formation, by which some fraction of members of the colony undergo a developmental change and become capable of nitrogen fixation. The ABC transporter encoded by the devBCA operon is induced by nitrogen deficiency and is necessary for the formation of the laminated layer which envelops heterocysts , . It is thought to be involved in the export of either the heterocyst-specific glycolipids found in the laminated layer, or an enzyme essential for their formation..
Probab=96.98  E-value=0.0069  Score=40.01  Aligned_cols=134  Identities=23%  Similarity=0.358  Sum_probs=83.1

Q ss_pred             CCEEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHCCCCCCCEEEE-------------
Q ss_conf             7044434563587777664399996778440789999999999999719853035320682210567-------------
Q gi|254780750|r  632 KPFIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHIGIVDKLFS-------------  698 (920)
Q Consensus       632 ~~fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a~i~~~D~Ift-------------  698 (920)
                      ..=|=.||+|..    +.+-+-|+|||=-|||||+|--         ||+-=-+.+-.+.++++=..             
T Consensus        17 rkQvL~di~L~i----~~GEiViltGPSGSGKTTLLtL---------iG~LR~~Q~G~L~vlg~~L~ga~~~~l~~~RR~   83 (220)
T TIGR02982        17 RKQVLFDINLEI----NPGEIVILTGPSGSGKTTLLTL---------IGGLRSVQEGSLKVLGQELKGASKKELVQVRRN   83 (220)
T ss_pred             CCEEECCCCEEE----CCCEEEEEECCCCCCHHHHHHH---------HHHHCCCCCCEEEEECCHHCCCCHHHHHHHHHH
T ss_conf             210012763177----1764798437889846889998---------876256555604782201026788899999876


Q ss_pred             ------------EEECCCCCCCCC----CHHHHHHHHH-HHHHHH----------------------------CCCCCEE
Q ss_conf             ------------652376611385----3289999999-999995----------------------------8998569
Q gi|254780750|r  699 ------------RVGSADNLASGR----STFMVEMIET-ASILNQ----------------------------ATNQSFV  733 (920)
Q Consensus       699 ------------RiGa~D~l~~g~----STF~vEm~e~-~~IL~~----------------------------at~~SLV  733 (920)
                                  -+-|..|+..+.    .....|+.+. ..+|..                            ...-.||
T Consensus        84 iGyIFQ~HNLl~~LTA~QNVqM~~eL~~~~~~~~~~~~a~~~L~~VGL~~~~~y~P~~LSGGQKQRVAIARALv~~P~Lv  163 (220)
T TIGR02982        84 IGYIFQAHNLLGFLTARQNVQMALELQPNLSAQEAREKARAMLEAVGLGDRLDYYPENLSGGQKQRVAIARALVARPKLV  163 (220)
T ss_pred             CCCEECCCHHCHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHCHHHHHHHCCCCCCCCCHHHHHHHHHHHCCCCEE
T ss_conf             39144120001000177888648988761168899999999998606012554052436786168999999973389767


Q ss_pred             EEECCCCCCCHHHH---HHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHC
Q ss_conf             99325889880567---99999999999972698499974875797664306
Q gi|254780750|r  734 ILDEIGRGTATLDG---LSIAWATIEYLHETNRCRGLLATHFHELTDLSKSL  782 (920)
Q Consensus       734 llDElGrGTst~DG---~aiA~aile~l~~~~~~~~lfaTHy~eL~~l~~~~  782 (920)
                      |=||-   |+.-|.   -.+ .-++..|...-+|-.|..||.+.+-++++..
T Consensus       164 LADEP---TAALD~~SGr~V-V~Lm~~lA~eqGc~iL~VTHD~RIlDvADRI  211 (220)
T TIGR02982       164 LADEP---TAALDSKSGRDV-VELMQKLAREQGCTILLVTHDNRILDVADRI  211 (220)
T ss_pred             ECCCC---CHHHHHCCCHHH-HHHHHHHHHHHCCEEEEEECCCCHHHHHHHH
T ss_conf             62577---233221133899-9999998877198899983673120065444


No 216
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional
Probab=96.97  E-value=0.025  Score=35.88  Aligned_cols=32  Identities=25%  Similarity=0.436  Sum_probs=24.3

Q ss_pred             EEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHH
Q ss_conf             443456358777766439999677844078999999
Q gi|254780750|r  635 IANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQN  670 (920)
Q Consensus       635 VpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqv  670 (920)
                      |=+|+++..    ..+...-|.||+-+||||+++-+
T Consensus       350 vL~~isl~i----~~Ge~vaiVG~SGsGKSTL~~LL  381 (585)
T PRK13657        350 AVEDVSFEA----KPGQTVAIVGPTGAGKSTLINLL  381 (585)
T ss_pred             CCCCCEEEE----CCCCEEEEECCCCCCHHHHHHHH
T ss_conf             536703897----59988999889898699999998


No 217
>pfam03266 DUF265 Protein of unknown function, DUF265.
Probab=96.97  E-value=0.019  Score=36.75  Aligned_cols=134  Identities=25%  Similarity=0.340  Sum_probs=69.5

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHHHHH----C-CCCCC---HHHCCCC--CCC------EEEEEEECCCCCCCCC-CHHHH
Q ss_conf             99967784407899999999999997----1-98530---3532068--221------0567652376611385-32899
Q gi|254780750|r  653 WLLTGPNMGGKSTFLRQNALIVIMAQ----M-GSYVP---ASYAHIG--IVD------KLFSRVGSADNLASGR-STFMV  715 (920)
Q Consensus       653 ~iiTGpNmgGKSt~lRqval~vilAQ----i-G~fVP---A~~a~i~--~~D------~IftRiGa~D~l~~g~-STF~v  715 (920)
                      .+||||--.||||+++-++=  .|..    + |.+.|   -..-++|  ++|      .+++|++..-..--|+ ..+.-
T Consensus         2 i~ITG~pGvGKTTli~kv~~--~l~~~~~~v~GF~T~evre~g~R~GF~iv~l~~g~~~~la~~~~~~~~~vGky~v~~~   79 (168)
T pfam03266         2 IFITGPPGVGKTTLVKKVIE--LLKSEGVKVGGFYTPEVREGGRRIGFDIVDLASGERGPLARVGGVSGPRVGKYVVNLE   79 (168)
T ss_pred             EEEECCCCCCHHHHHHHHHH--HHHHCCCEEEEEEECCEECCCCEEEEEEEECCCCCEEEEEEECCCCCCCCCCCEECHH
T ss_conf             89978999889999999999--9986797074899302125893789999990478267744406887754577166689


Q ss_pred             HHHHH-HHHHHHC-CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCC---HHHHHHHHHCCCEEEEEE
Q ss_conf             99999-9999958-998569993258898805679999999999997269849997487---579766430688589999
Q gi|254780750|r  716 EMIET-ASILNQA-TNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHF---HELTDLSKSLKRFHNATL  790 (920)
Q Consensus       716 Em~e~-~~IL~~a-t~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy---~eL~~l~~~~~~v~n~~~  790 (920)
                      +..+. ..+|++| ....|+++||+|+=--.  .-....+|.+-| +..+ .+|.+=|.   |.+.+--...+.+.-+++
T Consensus        80 ~fe~~~~~~L~~a~~~~dlivIDEIG~mEl~--s~~F~~~v~~~l-~~~~-~vl~ti~~~~~~~~v~~i~~~~d~~i~~v  155 (168)
T pfam03266        80 EFEEIALPALRRALEEADLIIIDEIGPMELK--SPKFREAIEEVL-SSNK-PVLAVVHRRSDSPLVERIRRRPDVKIFVV  155 (168)
T ss_pred             HHHHHHHHHHHHCCCCCCEEEEECCCHHHHH--HHHHHHHHHHHH-CCCC-CEEEEEEECCCCHHHHHHHCCCCCEEEEE
T ss_conf             9999999999840668989999763145331--499999999996-6999-79999972589838999741799389997


Q ss_pred             EE
Q ss_conf             99
Q gi|254780750|r  791 QV  792 (920)
Q Consensus       791 ~~  792 (920)
                      ..
T Consensus       156 t~  157 (168)
T pfam03266       156 TE  157 (168)
T ss_pred             CH
T ss_conf             86


No 218
>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional
Probab=96.94  E-value=0.019  Score=36.65  Aligned_cols=49  Identities=20%  Similarity=0.178  Sum_probs=32.5

Q ss_pred             CCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHH
Q ss_conf             89985699932588988056799999999999972698499974875797
Q gi|254780750|r  727 ATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFHELT  776 (920)
Q Consensus       727 at~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~  776 (920)
                      |+.-.++|+||--.|=++.--..| +..+..|.+..+-..+|.||.-+..
T Consensus       156 a~~P~iLl~DEPTsaLDp~t~~~I-l~lL~~l~~e~g~TivlITHdm~~v  204 (343)
T PRK11153        156 ASNPKVLLCDEATSALDPATTRSI-LELLKDINRRLGLTILLITHEMDVV  204 (343)
T ss_pred             HCCCCEEEEECCCCCCCHHHHHHH-HHHHHHHHHHHCCEEEEECCCHHHH
T ss_conf             669999999288765899999999-9999999996198999988899999


No 219
>cd03288 ABCC_SUR2 The SUR domain 2.  The sulfonylurea receptor SUR is an ATP binding cassette (ABC) protein of the ABCC/MRP family.  Unlike other ABC proteins, it has no intrinsic transport function, neither active nor passive, but associates with the potassium channel proteins Kir6.1 or Kir6.2 to form the ATP-sensitive potassium (K(ATP)) channel.  Within the channel complex, SUR serves as a regulatory subunit that fine-tunes the gating of Kir6.x in response to alterations in cellular metabolism.  It constitutes a major pharmaceutical target as it binds numerous drugs, K(ATP) channel openers and blockers, capable of up- or down-regulating channel activity.
Probab=96.94  E-value=0.029  Score=35.40  Aligned_cols=35  Identities=14%  Similarity=0.061  Sum_probs=27.0

Q ss_pred             CEEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHH
Q ss_conf             044434563587777664399996778440789999999
Q gi|254780750|r  633 PFIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNA  671 (920)
Q Consensus       633 ~fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqva  671 (920)
                      .+|=++++|..    ..+....|.|||-+||||++|.+.
T Consensus        34 ~~vL~~inl~I----~~Ge~vaIvG~sGsGKSTL~~ll~   68 (257)
T cd03288          34 KPVLKHVKAYI----KPGQKVGICGRTGSGKSSLSLAFF   68 (257)
T ss_pred             CCCEECEEEEE----CCCCEEEEECCCCCCHHHHHHHHH
T ss_conf             57310538998----799999999999981999999996


No 220
>PRK09354 recA recombinase A; Provisional
Probab=96.91  E-value=0.017  Score=37.06  Aligned_cols=137  Identities=18%  Similarity=0.216  Sum_probs=79.8

Q ss_pred             EEEEEEECCCCCCCCCEEEEEECCCCCCHHHH-HHHHHHHHHHHHCCCCCCHHHCCCCCCCEEEEEEEC-CCCCCCCCCH
Q ss_conf             44345635877776643999967784407899-999999999997198530353206822105676523-7661138532
Q gi|254780750|r  635 IANDCDLSCPNDKNSGKLWLLTGPNMGGKSTF-LRQNALIVIMAQMGSYVPASYAHIGIVDKLFSRVGS-ADNLASGRST  712 (920)
Q Consensus       635 VpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~-lRqval~vilAQiG~fVPA~~a~i~~~D~IftRiGa-~D~l~~g~ST  712 (920)
                      ..-|+-||..+ -..+|+.-|.||..+||||+ |..+|-.+=+--+-.|+-|+.|-=+-+   ..++|- .|++.--+..
T Consensus        46 l~LD~aLGiGG-~P~GRivEi~G~esSGKTtlal~~iaeaQk~Gg~~a~iDaE~ald~~~---a~~lGVd~d~llv~qpd  121 (350)
T PRK09354         46 LALDIALGIGG-LPKGRIVEIYGPESSGKTTLALHAIAEAQKAGGTAAFIDAEHALDPVY---AKKLGVDIDNLLVSQPD  121 (350)
T ss_pred             HHHHHHHCCCC-CCCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEEECCCCCHHH---HHHCCCCHHHEEEECCC
T ss_conf             78999875899-678708999889877799999999999997599479996000279889---99849771571785686


Q ss_pred             HHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHH----------H-----HHHHHHHHHHHHHHCCCEEEEECCCHHH
Q ss_conf             8999999999999589985699932588988056----------7-----9999999999997269849997487579
Q gi|254780750|r  713 FMVEMIETASILNQATNQSFVILDEIGRGTATLD----------G-----LSIAWATIEYLHETNRCRGLLATHFHEL  775 (920)
Q Consensus       713 F~vEm~e~~~IL~~at~~SLVllDElGrGTst~D----------G-----~aiA~aile~l~~~~~~~~lfaTHy~eL  775 (920)
                      ..-++.|+..-|-..+.-.+|++|=++-=+...+          |     ++-|.-.+...+.+.+|.++|..|..+=
T Consensus       122 ~~Eqal~i~e~Lvrsg~vd~IVvDSVaAL~pk~Eieg~mgd~~vG~qARlmSqalRKlt~~i~ks~t~~IfINQlR~k  199 (350)
T PRK09354        122 TGEQALEIADALVRSGAVDLIVVDSVAALVPKAEIEGEMGDSHVGLQARLMSQALRKLTGNINKSNTTVIFINQIRMK  199 (350)
T ss_pred             HHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEEHHH
T ss_conf             799999999999854884189982533457688873133542263899999999999999985578289997432321


No 221
>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed
Probab=96.91  E-value=0.011  Score=38.64  Aligned_cols=34  Identities=26%  Similarity=0.260  Sum_probs=25.0

Q ss_pred             EEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHH
Q ss_conf             44434563587777664399996778440789999999
Q gi|254780750|r  634 FIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNA  671 (920)
Q Consensus       634 fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqva  671 (920)
                      .|=+|+++..    ..+...-|+||.-+||||+++-++
T Consensus       355 ~vL~~isl~i----~~Ge~vaiVG~SGsGKSTL~~LL~  388 (575)
T PRK11160        355 PVLKGLSLQI----KAGEKVALLGRTGCGKSTLLQLLT  388 (575)
T ss_pred             CCCCCEEEEE----CCCCEEEEECCCCCCHHHHHHHHH
T ss_conf             7636715897----699889998899975999999986


No 222
>PRK10261 glutathione transporter ATP-binding protein; Provisional
Probab=96.86  E-value=0.013  Score=37.99  Aligned_cols=32  Identities=25%  Similarity=0.206  Sum_probs=25.0

Q ss_pred             EEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHH
Q ss_conf             434563587777664399996778440789999999
Q gi|254780750|r  636 ANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNA  671 (920)
Q Consensus       636 pNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqva  671 (920)
                      =+|+++..    ..+.++-|-|+|-+||||++|.++
T Consensus       340 v~~vsf~i----~~GE~l~lvG~sGsGKSTl~r~l~  371 (623)
T PRK10261        340 VEKVSFDL----WPGETLSLVGESGSGKSTTGRALL  371 (623)
T ss_pred             EECCCCCC----CCCCEEEEECCCCCCHHHHHHHHH
T ss_conf             52340035----899589997678766899999985


No 223
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC, RecA-like, VirD4-like, PilT-like, and SF1/2 helicases. Members of the AAA+ ATPases function as molecular chaperons, ATPase subunits of proteases, helicases, or nucleic-acid stimulated ATPases. The AAA+ proteins contain several distinct features in addition to the conserved alpha-beta-alpha core domain structure and the Walker A and B motifs of the P-loop NTPases.
Probab=96.86  E-value=0.016  Score=37.24  Aligned_cols=108  Identities=23%  Similarity=0.189  Sum_probs=54.6

Q ss_pred             CEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHCCCCCCCEEEEEEECCCCC--CCCCCHHHHHHHHHHHHHHHC
Q ss_conf             439999677844078999999999999971985303532068221056765237661--138532899999999999958
Q gi|254780750|r  650 GKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHIGIVDKLFSRVGSADNL--ASGRSTFMVEMIETASILNQA  727 (920)
Q Consensus       650 ~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a~i~~~D~IftRiGa~D~l--~~g~STF~vEm~e~~~IL~~a  727 (920)
                      .+-++|+||--.|||++.|.+|-..-  .-|              .-|..+.++|..  ..+.+-+.........-....
T Consensus        19 ~~~ill~GppGtGKT~la~~ia~~~~--~~~--------------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   82 (151)
T cd00009          19 PKNLLLYGPPGTGKTTLARAIANELF--RPG--------------APFLYLNASDLLEGLVVAELFGHFLVRLLFELAEK   82 (151)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHC--CCC--------------CCEEEEEHHHCCHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             98089989999886599999999712--137--------------98278547770467777576057788989999997


Q ss_pred             CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHH----HCCCEEEEECCCHHH
Q ss_conf             998569993258898805679999999999997----269849997487579
Q gi|254780750|r  728 TNQSFVILDEIGRGTATLDGLSIAWATIEYLHE----TNRCRGLLATHFHEL  775 (920)
Q Consensus       728 t~~SLVllDElGrGTst~DG~aiA~aile~l~~----~~~~~~lfaTHy~eL  775 (920)
                      ++.+.+++||+.+=.. ...-+ ...+++.+..    ...+.++++|+..+.
T Consensus        83 ~~~~vl~iDEi~~l~~-~~~~~-~~~~l~~~~~~~~~~~~~~vI~~tn~~~~  132 (151)
T cd00009          83 AKPGVLFIDEIDSLSR-GAQNA-LLRVLETLNDLRIDRENVRVIGATNRPLL  132 (151)
T ss_pred             CCCCEEEEECHHHCCH-HHHHH-HHHHHHHHCCCCCCCCCEEEEEEECCCCC
T ss_conf             6998698201665599-99999-99999871575406788899995289988


No 224
>PRK10418 nikD nickel transporter ATP-binding protein; Provisional
Probab=96.83  E-value=0.038  Score=34.47  Aligned_cols=34  Identities=21%  Similarity=0.258  Sum_probs=26.9

Q ss_pred             EEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHH
Q ss_conf             44434563587777664399996778440789999999
Q gi|254780750|r  634 FIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNA  671 (920)
Q Consensus       634 fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqva  671 (920)
                      .|=+||++..    ..+.+.-|-|||-+||||++|++.
T Consensus        17 ~vL~~Isl~v----~~Ge~~aiiG~SGsGKStl~k~ll   50 (254)
T PRK10418         17 PLVHGVSLTL----QRGRVLALVGGSGSGKSLTCAAAL   50 (254)
T ss_pred             EEEECEEEEE----CCCCEEEEECCCCCHHHHHHHHHH
T ss_conf             0886607289----899999999999878999999995


No 225
>KOG0064 consensus
Probab=96.81  E-value=0.011  Score=38.61  Aligned_cols=44  Identities=30%  Similarity=0.332  Sum_probs=30.1

Q ss_pred             CCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHCCCCCCCEEEE
Q ss_conf             664399996778440789999999999999719853035320682210567
Q gi|254780750|r  648 NSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHIGIVDKLFS  698 (920)
Q Consensus       648 ~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a~i~~~D~Ift  698 (920)
                      +.+.-++|||||.+|||++-|-.|=+       -+|-.....+|.-++||-
T Consensus       506 ~~G~hLLItGPNGCGKSSLfRILggL-------WPvy~g~L~~P~~~~mFY  549 (728)
T KOG0064         506 EPGMHLLITGPNGCGKSSLFRILGGL-------WPVYNGLLSIPRPNNIFY  549 (728)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCC-------CCCCCCEEECCCCCCEEE
T ss_conf             58826998789976588999998644-------723277563489763685


No 226
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional
Probab=96.79  E-value=0.014  Score=37.67  Aligned_cols=31  Identities=10%  Similarity=0.183  Sum_probs=24.1

Q ss_pred             EEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHH
Q ss_conf             34563587777664399996778440789999999
Q gi|254780750|r  637 NDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNA  671 (920)
Q Consensus       637 Ndi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqva  671 (920)
                      +|+++..    ..+.++-|.|||-+||||++|.++
T Consensus       265 ~~vsf~v----~~GEivgl~G~nGsGKsTL~~~l~  295 (491)
T PRK10982        265 RDVSFDL----HKGEILGIAGLVGAKRTDIVETLF  295 (491)
T ss_pred             EEEEEEE----ECCCEEEEECCCCCCHHHHHHHHH
T ss_conf             0267999----689689977899997889999981


No 227
>COG2401 ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only]
Probab=96.75  E-value=0.017  Score=37.05  Aligned_cols=137  Identities=23%  Similarity=0.332  Sum_probs=83.3

Q ss_pred             CEEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCC-------------------CCCHHH-CCCC-
Q ss_conf             0444345635877776643999967784407899999999999997198-------------------530353-2068-
Q gi|254780750|r  633 PFIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGS-------------------YVPASY-AHIG-  691 (920)
Q Consensus       633 ~fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~-------------------fVPA~~-a~i~-  691 (920)
                      .|+--|++|..    ..+.+-+|+|+-.+||||++|.+.=...-  .|-                   .+|-+. .+++ 
T Consensus       396 ryvlr~vNL~i----kpGdvvaVvGqSGaGKttllRmi~G~~~~--~~ee~y~p~sg~v~~p~nt~~a~iPge~Ep~f~~  469 (593)
T COG2401         396 RYVLRNLNLEI----KPGDVVAVVGQSGAGKTTLLRMILGAQKG--RGEEKYRPDSGKVEVPKNTVSALIPGEYEPEFGE  469 (593)
T ss_pred             EEEEECEEEEE----CCCCEEEEEECCCCCCCHHHHHHHHHHHC--CCCCCCCCCCCCEECCCCCHHHCCCCCCCCCCCC
T ss_conf             66640203686----47876899924887731199999877643--5620247877721034431321067655544573


Q ss_pred             --CCCE-------------EEEEEECCCCC-----CCCCCHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHH
Q ss_conf             --2210-------------56765237661-----138532899999999999958998569993258898805679999
Q gi|254780750|r  692 --IVDK-------------LFSRVGSADNL-----ASGRSTFMVEMIETASILNQATNQSFVILDEIGRGTATLDGLSIA  751 (920)
Q Consensus       692 --~~D~-------------IftRiGa~D~l-----~~g~STF~vEm~e~~~IL~~at~~SLVllDElGrGTst~DG~aiA  751 (920)
                        +.++             |..|.|.+|-.     +...||=.-|=.-+|..+.  ..-++.++||++.--++....-+|
T Consensus       470 ~tilehl~s~tGD~~~AveILnraGlsDAvlyRr~f~ELStGQKeR~KLAklla--erpn~~~iDEF~AhLD~~TA~rVA  547 (593)
T COG2401         470 VTILEHLRSKTGDLNAAVEILNRAGLSDAVLYRRKFSELSTGQKERAKLAKLLA--ERPNVLLIDEFAAHLDELTAVRVA  547 (593)
T ss_pred             HHHHHHHHHCCCCHHHHHHHHHHHCCCHHHHHHCCHHHCCCCHHHHHHHHHHHH--CCCCCEEHHHHHHHCCHHHHHHHH
T ss_conf             118998752368636789999760453054300467553854577789999973--489817735666431779999999


Q ss_pred             HHHHHHHHHHCCCEEEEECCCHHHHHH
Q ss_conf             999999997269849997487579766
Q gi|254780750|r  752 WATIEYLHETNRCRGLLATHFHELTDL  778 (920)
Q Consensus       752 ~aile~l~~~~~~~~lfaTHy~eL~~l  778 (920)
                      ..+-+ |....+...+.+||-.|+.+-
T Consensus       548 rkise-lARe~giTlivvThrpEv~~A  573 (593)
T COG2401         548 RKISE-LAREAGITLIVVTHRPEVGNA  573 (593)
T ss_pred             HHHHH-HHHHHCCEEEEEECCHHHHHC
T ss_conf             99999-999709739999648777744


No 228
>PRK10419 nikE nickel transporter ATP-binding protein; Provisional
Probab=96.74  E-value=0.054  Score=33.33  Aligned_cols=51  Identities=24%  Similarity=0.260  Sum_probs=33.9

Q ss_pred             CCCCCEEEEECCCCCCCHHHHHH--HHHHHHHHHHHHCCCEEEEECCCHHHHH-HHH
Q ss_conf             89985699932588988056799--9999999999726984999748757976-643
Q gi|254780750|r  727 ATNQSFVILDEIGRGTATLDGLS--IAWATIEYLHETNRCRGLLATHFHELTD-LSK  780 (920)
Q Consensus       727 at~~SLVllDElGrGTst~DG~a--iA~aile~l~~~~~~~~lfaTHy~eL~~-l~~  780 (920)
                      +.+-.|+|+||-   ||..|-..  --...+..|.+..++-.+|.||.-.+.. +++
T Consensus       167 ~~~P~lLi~DEP---tsaLD~~~q~~il~ll~~l~~~~g~t~i~ITHDl~~a~~~ad  220 (266)
T PRK10419        167 AVEPKLLILDEA---VSNLDLVLQAGVIRLLKKLQQQFGTACLFITHDLRLVERFCQ  220 (266)
T ss_pred             CCCCCEEEEECC---CCCCCHHHHHHHHHHHHHHHHHHCCEEEEECCCHHHHHHHCC
T ss_conf             069878999688---653699999999999999999759899998899999999689


No 229
>PRK08116 hypothetical protein; Validated
Probab=96.73  E-value=0.058  Score=33.10  Aligned_cols=113  Identities=22%  Similarity=0.227  Sum_probs=64.9

Q ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHCCCCCCCEEEEEEECCCCCCCCCCHHHH--HHHHHHHHHHH
Q ss_conf             6439999677844078999999999999971985303532068221056765237661138532899--99999999995
Q gi|254780750|r  649 SGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHIGIVDKLFSRVGSADNLASGRSTFMV--EMIETASILNQ  726 (920)
Q Consensus       649 ~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a~i~~~D~IftRiGa~D~l~~g~STF~v--Em~e~~~IL~~  726 (920)
                      .++-++++||-..|||-+.=.+|--. +. -|-.|            +|+.+.  |=+..=+++|--  +..+ ..+++.
T Consensus       107 ~~~GLll~G~~GtGKThLa~aIa~~l-~~-~g~~V------------~~~~~~--~ll~~lk~~~~~~~~~~~-~e~l~~  169 (262)
T PRK08116        107 ESVGLLLWGSPGNGKTYLAAAIANEL-IE-KGVPV------------VFVNVP--ELLNRIKSTYNSEGKEDE-NEIIRA  169 (262)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHH-HH-CCCEE------------EEEEHH--HHHHHHHHHHHCCCCHHH-HHHHHH
T ss_conf             68618998989998999999999999-98-79939------------998899--999999999863561019-999998


Q ss_pred             CCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHH
Q ss_conf             899856999325889880567999999999999726984999748757976643
Q gi|254780750|r  727 ATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFHELTDLSK  780 (920)
Q Consensus       727 at~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~~l~~  780 (920)
                      ...-.|+|||+||..-.|.-+....+.|+.+-.... -.|+|+|-+. +.+|.+
T Consensus       170 l~~~dLLIiDDlG~e~~t~w~~e~lf~IIn~Ry~~~-kptIiTTNl~-~~eL~~  221 (262)
T PRK08116        170 LDNADLLILDDLGAEKDTEWVREKLYNIIDSRYRKG-LPTIFTTNLS-LEELKN  221 (262)
T ss_pred             HHCCCEEEEEHHCCCCCCHHHHHHHHHHHHHHHHCC-CCEEEECCCC-HHHHHH
T ss_conf             612998998322145698789999999999999769-9989987999-999999


No 230
>TIGR00954 3a01203 Peroxysomal long chain fatty acyl transporter; InterPro: IPR005283   ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs.   ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain .    The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , .   The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , .   Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1).     The members of this family are integral membrane proteins and they are involved in the import of activated long-chain fatty acids from the cytosol to the peroxisomal matrix. ; GO: 0005524 ATP binding, 0006810 transport, 0016021 integral to membrane.
Probab=96.70  E-value=0.0014  Score=45.19  Aligned_cols=50  Identities=36%  Similarity=0.423  Sum_probs=36.4

Q ss_pred             EEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHH-HHH----------HCC-CCCCHHH
Q ss_conf             434563587777664399996778440789999999999-999----------719-8530353
Q gi|254780750|r  636 ANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIV-IMA----------QMG-SYVPASY  687 (920)
Q Consensus       636 pNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~v-ilA----------QiG-~fVPA~~  687 (920)
                      +|||.|.  .-.++++=+||+|||.+|||++=|-+|=+= +++          -|| ..+|++.
T Consensus       544 andiklP--flqGsG~~lLi~GPNGCGKSSLFRiLGeLWP~~g~~nknhqsklimG~Lt~P~~~  605 (788)
T TIGR00954       544 ANDIKLP--FLQGSGNHLLICGPNGCGKSSLFRILGELWPVYGKNNKNHQSKLIMGRLTKPAKG  605 (788)
T ss_pred             HCCCCCC--CCCCCCCEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCCCEEECCEECCCCCC
T ss_conf             3024355--1215887668768899864789999864302357897443320344410558888


No 231
>PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional
Probab=96.68  E-value=0.0073  Score=39.83  Aligned_cols=24  Identities=13%  Similarity=0.116  Sum_probs=12.9

Q ss_pred             EEEEEECCCHHHHHHHHHHHHHHH
Q ss_conf             999980882220079999999861
Q gi|254780750|r   43 LVFYRMGDFYELFFDDALLASRCL   66 (920)
Q Consensus        43 il~fr~G~FYE~f~~DA~~aa~~L   66 (920)
                      |-|=-+.+.|.+|.....-.-.+|
T Consensus         5 V~~~nVsK~y~ly~~~~drLk~~f   28 (549)
T PRK13545          5 VKFEHVTKKYKLYNKPFDKLKDLF   28 (549)
T ss_pred             EEEEECCEEEECCCCHHHHHHHHH
T ss_conf             999852325665689678999996


No 232
>COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones]
Probab=96.68  E-value=0.0023  Score=43.59  Aligned_cols=34  Identities=38%  Similarity=0.467  Sum_probs=25.9

Q ss_pred             CEEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHH
Q ss_conf             0444345635877776643999967784407899999999
Q gi|254780750|r  633 PFIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNAL  672 (920)
Q Consensus       633 ~fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval  672 (920)
                      .|-+-++.++      .+.+..|||||-+||||+||.+|=
T Consensus        17 lf~~L~f~l~------~Ge~~~i~G~NG~GKTtLLRilaG   50 (209)
T COG4133          17 LFSDLSFTLN------AGEALQITGPNGAGKTTLLRILAG   50 (209)
T ss_pred             EECCEEEEEC------CCCEEEEECCCCCCHHHHHHHHHC
T ss_conf             2123047874------887799989998758899999971


No 233
>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones]
Probab=96.66  E-value=0.064  Score=32.80  Aligned_cols=81  Identities=22%  Similarity=0.197  Sum_probs=45.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHC-CC-CCEECCCCCCEEEC--C--CCCHHHHHHHHHCCCCCEEEEEEEECCCCCCCC
Q ss_conf             988889998677887788877525-88-51210478714000--0--468058876310287704443456358777766
Q gi|254780750|r  576 LDNASQVIAIIDISIALAILAKEQ-NY-CRPIIDNSTNFIVK--D--GRHPIVEKTLKQQSSKPFIANDCDLSCPNDKNS  649 (920)
Q Consensus       576 l~~~~~~ia~lD~l~SlA~~a~~~-~y-~rP~i~~~~~l~i~--~--gRHPviE~~l~~~~~~~fVpNdi~l~~~~~~~~  649 (920)
                      +....+..|-.|.+.+|-.--... +. ..+.....+.+++.  +  -++|          .++.+++|++++.    ..
T Consensus       281 fH~~~~g~aa~d~i~~~l~~~~~~~~~~~~~~~~~~~~~ei~~~~l~~~y~----------~g~~~l~~l~~t~----~~  346 (559)
T COG4988         281 FHAAAAGEAAADKLFTLLESPVATPGSGEKAEVANEPPIEISLENLSFRYP----------DGKPALSDLNLTI----KA  346 (559)
T ss_pred             HHHHHHCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCEEEECCEEEECC----------CCCCCCCCCEEEE----CC
T ss_conf             999850366898999972598777887643213568974666021478558----------9985566710675----48


Q ss_pred             CEEEEEECCCCCCHHHHHHHH
Q ss_conf             439999677844078999999
Q gi|254780750|r  650 GKLWLLTGPNMGGKSTFLRQN  670 (920)
Q Consensus       650 ~~~~iiTGpNmgGKSt~lRqv  670 (920)
                      ++...|.||+-+||||++.-+
T Consensus       347 g~~talvG~SGaGKSTLl~lL  367 (559)
T COG4988         347 GQLTALVGASGAGKSTLLNLL  367 (559)
T ss_pred             CCEEEEECCCCCCHHHHHHHH
T ss_conf             967999889999789999998


No 234
>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein. Members of this protein family are the ATP-binding subunit of a three-protein transporter. This family belongs, more broadly, to the family of proline and glycine-betaine transporters, but members have been identified by direct characterization and by bioinformatic means as choline transporters. Many species have several closely-related members of this family, probably with variable abilities to act additionally on related quaternary amines.
Probab=96.66  E-value=0.013  Score=38.07  Aligned_cols=34  Identities=26%  Similarity=0.435  Sum_probs=26.8

Q ss_pred             EEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHH
Q ss_conf             43456358777766439999677844078999999999
Q gi|254780750|r  636 ANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALI  673 (920)
Q Consensus       636 pNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~  673 (920)
                      =+|++|..    ..+-+..|-||.-+||||+||.++=+
T Consensus        40 V~dvsl~I----~~GEi~~lvGpSGsGKSTLLr~i~GL   73 (382)
T TIGR03415        40 VANASLDI----EEGEICVLMGLSGSGKSSLLRAVNGL   73 (382)
T ss_pred             EECCEEEE----CCCCEEEEECCCCCHHHHHHHHHHCC
T ss_conf             96517488----79989999999973499999999759


No 235
>COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only]
Probab=96.59  E-value=0.03  Score=35.28  Aligned_cols=197  Identities=19%  Similarity=0.257  Sum_probs=87.5

Q ss_pred             HHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHH--HCCCCCEEC-------CC--CCCEEECC--CCCHHHHHHHH
Q ss_conf             7888765430112579888899986778877888775--258851210-------47--87140000--46805887631
Q gi|254780750|r  561 SFEILSNAIIEQSESLDNASQVIAIIDISIALAILAK--EQNYCRPII-------DN--STNFIVKD--GRHPIVEKTLK  627 (920)
Q Consensus       561 ~~~~l~~~i~~~~~~l~~~~~~ia~lD~l~SlA~~a~--~~~y~rP~i-------~~--~~~l~i~~--gRHPviE~~l~  627 (920)
                      .|..+...+.-+......+++.-|.++=+.+|...=.  +.+.++|.-       ++  ...+.+++  .++|       
T Consensus       331 aF~~v~sslswfi~~~~~ia~~rA~~~Rl~~f~~ai~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~nl~l~~p-------  403 (604)
T COG4178         331 AFGQVHSSLSWFIDNYDAIADWRATLLRLAEFRQALEAAQMDTEKPARTGRRIDFDDNADHGITLENLSLRTP-------  403 (604)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCEEEEEEEEEECC-------
T ss_conf             9999998878999876889999999999999999998514760125765431000124565058854367779-------


Q ss_pred             HCCCCCEE-EEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHH------CC---CCCCHH-HCCCCCC-CE
Q ss_conf             02877044-4345635877776643999967784407899999999999997------19---853035-3206822-10
Q gi|254780750|r  628 QQSSKPFI-ANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQ------MG---SYVPAS-YAHIGIV-DK  695 (920)
Q Consensus       628 ~~~~~~fV-pNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQ------iG---~fVPA~-~a~i~~~-D~  695 (920)
                        .+...| +.++.+++      +.=++|+||+-+||||++|.+|=+==-++      -|   .|+|=. ++.-|-. |.
T Consensus       404 --~~~~ll~~l~~~v~~------G~~llI~G~SG~GKTsLlRaiaGLWP~g~G~I~~P~~~~~lflpQ~PY~p~GtLre~  475 (604)
T COG4178         404 --DGQTLLSELNFEVRP------GERLLITGESGAGKTSLLRALAGLWPWGSGRISMPADSALLFLPQRPYLPQGTLREA  475 (604)
T ss_pred             --CCCEEECCCEEEECC------CCEEEEECCCCCCHHHHHHHHHCCCCCCCCCEECCCCCCEEEECCCCCCCCCCHHHH
T ss_conf             --987421465265479------987998789998788999999645856787441689875577148877787658999


Q ss_pred             EE-----EEEECCC-CCC-----CCCCHHHHHHHH-----------------HHHHHHHCCCCCEEEEECCCCCCCHHHH
Q ss_conf             56-----7652376-611-----385328999999-----------------9999995899856999325889880567
Q gi|254780750|r  696 LF-----SRVGSAD-NLA-----SGRSTFMVEMIE-----------------TASILNQATNQSFVILDEIGRGTATLDG  747 (920)
Q Consensus       696 If-----tRiGa~D-~l~-----~g~STF~vEm~e-----------------~~~IL~~at~~SLVllDElGrGTst~DG  747 (920)
                      |.     .+++  | .+.     -|.--+.-.|.+                 .|.||=  ++-..|+|||-   ||..|.
T Consensus       476 l~YP~~~~~~~--d~~l~~vL~~vgL~~L~~rl~~~~~W~~vLS~GEqQRlafARilL--~kP~~v~LDEA---TsALDe  548 (604)
T COG4178         476 LCYPNAAPDFS--DAELVAVLHKVGLGDLAERLDEEDRWDRVLSGGEQQRLAFARLLL--HKPKWVFLDEA---TSALDE  548 (604)
T ss_pred             HHCCCCCCCCC--HHHHHHHHHHCCCHHHHHHHHCCCCHHHHCCHHHHHHHHHHHHHH--CCCCEEEEECC---HHCCCH
T ss_conf             80899977799--599999999819198999873327576645852789999999997--09998998060---112595


Q ss_pred             HHHHHHHHHHHHHH-CCCEEEEECCCHHHHHHHH
Q ss_conf             99999999999972-6984999748757976643
Q gi|254780750|r  748 LSIAWATIEYLHET-NRCRGLLATHFHELTDLSK  780 (920)
Q Consensus       748 ~aiA~aile~l~~~-~~~~~lfaTHy~eL~~l~~  780 (920)
                      -+-. ...+-|-+. .++-.+...|=+.|..+..
T Consensus       549 ~~e~-~l~q~l~~~lp~~tvISV~Hr~tl~~~h~  581 (604)
T COG4178         549 ETED-RLYQLLKEELPDATVISVGHRPTLWNFHS  581 (604)
T ss_pred             HHHH-HHHHHHHHHCCCCEEEEECCCHHHHHHHH
T ss_conf             7899-99999985489978999556000578875


No 236
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms]
Probab=96.59  E-value=0.031  Score=35.13  Aligned_cols=51  Identities=22%  Similarity=0.289  Sum_probs=34.1

Q ss_pred             CCCCCEEEEECCCCCCCHHH---HHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHH
Q ss_conf             89985699932588988056---79999999999997269849997487579766430
Q gi|254780750|r  727 ATNQSFVILDEIGRGTATLD---GLSIAWATIEYLHETNRCRGLLATHFHELTDLSKS  781 (920)
Q Consensus       727 at~~SLVllDElGrGTst~D---G~aiA~aile~l~~~~~~~~lfaTHy~eL~~l~~~  781 (920)
                      +.+-.++|.||-   |...|   |-.+ ...+..+.+..+.-++++||.++++..++.
T Consensus       158 ~~~P~iilADEP---TgnLD~~t~~~V-~~ll~~~~~~~g~tii~VTHD~~lA~~~dr  211 (226)
T COG1136         158 INNPKIILADEP---TGNLDSKTAKEV-LELLRELNKERGKTIIMVTHDPELAKYADR  211 (226)
T ss_pred             HCCCCEEEEECC---CCCCCHHHHHHH-HHHHHHHHHHCCCEEEEECCCHHHHHHCCE
T ss_conf             249986996076---665886789999-999999987469899999089899974898


No 237
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea.  This transport system belong to the larger ATP-Binding Cassette (ABC) transporter superfamily.  The characteristic feature of these transporters is the obligatory coupling of ATP hydrolysis to substrate translocation.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=96.54  E-value=0.025  Score=35.82  Aligned_cols=138  Identities=21%  Similarity=0.267  Sum_probs=69.5

Q ss_pred             EEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCC------C---CHHH------CCCCCC---CE
Q ss_conf             4443456358777766439999677844078999999999999971985------3---0353------206822---10
Q gi|254780750|r  634 FIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSY------V---PASY------AHIGIV---DK  695 (920)
Q Consensus       634 fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~f------V---PA~~------a~i~~~---D~  695 (920)
                      -+=+|++|..    ..+.+..|-||.-+||||+||.++-+.- ..-|.-      |   |.+.      -.++.+   ..
T Consensus        38 ~aL~~vsl~i----~~GE~~~ivG~SGsGKSTLLr~i~GL~~-p~~G~I~~~G~~i~~~~~~~l~~~r~~~igmVFQ~~a  112 (269)
T cd03294          38 VGVNDVSLDV----REGEIFVIMGLSGSGKSTLLRCINRLIE-PTSGKVLIDGQDIAAMSRKELRELRRKKISMVFQSFA  112 (269)
T ss_pred             EEECCCEEEE----CCCCEEEEECCCCCHHHHHHHHHHCCCC-CCCEEEEECCEECCCCCHHHHHHHHCCCEEEEEECCC
T ss_conf             7977747588----8999999998998489999999975999-9975999999999999989998852564699961575


Q ss_pred             EEEEEECCCCCCCC-----CCHH-----HHHHHHH---HH------------------HH-HHCCCCCEEEEECCCCCCC
Q ss_conf             56765237661138-----5328-----9999999---99------------------99-9589985699932588988
Q gi|254780750|r  696 LFSRVGSADNLASG-----RSTF-----MVEMIET---AS------------------IL-NQATNQSFVILDEIGRGTA  743 (920)
Q Consensus       696 IftRiGa~D~l~~g-----~STF-----~vEm~e~---~~------------------IL-~~at~~SLVllDElGrGTs  743 (920)
                      +|-.+-..||+.-|     .|.=     ..|+.+.   +.                  |- --|.+-.++|+||-   ||
T Consensus       113 L~P~ltV~eNV~~~L~~~~~~~~e~~~rv~e~L~~vgL~~~~~~~P~qLSGGq~QRVaIARALa~~P~iLLlDEP---ts  189 (269)
T cd03294         113 LLPHRTVLENVAFGLEVQGVPRAEREERAAEALELVGLEGWEHKYPDELSGGMQQRVGLARALAVDPDILLMDEA---FS  189 (269)
T ss_pred             CCCCCCHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHHCCHHHHCHHHHHHHHHHHHHHCCCCEEEECCC---CC
T ss_conf             476787999986888852899789999999999867986777569678494888899999998639989997587---54


Q ss_pred             HHHH---HHHHHHHHHHHHHHCCCEEEEECCCHHHH-HHHH
Q ss_conf             0567---99999999999972698499974875797-6643
Q gi|254780750|r  744 TLDG---LSIAWATIEYLHETNRCRGLLATHFHELT-DLSK  780 (920)
Q Consensus       744 t~DG---~aiA~aile~l~~~~~~~~lfaTHy~eL~-~l~~  780 (920)
                      ..|-   ..| ...+..|.+..+..++|.||..+.+ .+++
T Consensus       190 aLD~~~~~~i-~~~l~~l~~~~~~T~i~VTHD~~eA~~laD  229 (269)
T cd03294         190 ALDPLIRREM-QDELLRLQAELQKTIVFITHDLDEALRLGD  229 (269)
T ss_pred             CCCHHHHHHH-HHHHHHHHHHHCCEEEEECCCHHHHHHHCC
T ss_conf             2599999999-999999999749999999998999999799


No 238
>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism]
Probab=96.50  E-value=0.081  Score=32.03  Aligned_cols=54  Identities=26%  Similarity=0.313  Sum_probs=40.8

Q ss_pred             CCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHH
Q ss_conf             8998569993258898805679999999999997269849997487579766430
Q gi|254780750|r  727 ATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFHELTDLSKS  781 (920)
Q Consensus       727 at~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~~l~~~  781 (920)
                      ++.-.++|+||--||-+---=.- -|.++..|.....+..++++-.+||..+.+.
T Consensus       417 ~~~p~vLilDEPTRGIDVGAK~e-Iy~li~~lA~~G~ail~iSSElpEll~~~DR  470 (500)
T COG1129         417 ATDPKVLILDEPTRGIDVGAKAE-IYRLIRELAAEGKAILMISSELPELLGLSDR  470 (500)
T ss_pred             HHCCCEEEECCCCCCCCCCHHHH-HHHHHHHHHHCCCEEEEEECCHHHHHHHCCE
T ss_conf             75899999889987754145899-9999999997799899994975998840977


No 239
>KOG0927 consensus
Probab=96.49  E-value=0.021  Score=36.43  Aligned_cols=38  Identities=18%  Similarity=0.155  Sum_probs=25.2

Q ss_pred             CEEEEEC-------CCCCCCCHHHHHHCCCCCCHHHHHHHHHHHH
Q ss_conf             1545412-------7877641278763012343378999986310
Q gi|254780750|r  299 NLEILRT-------LSGSREQSLLKTIDYSITGAGGRLFAERIAS  336 (920)
Q Consensus       299 nLEI~~~-------~~g~~~gSL~~~Ln~t~T~~G~RlLr~wL~~  336 (920)
                      .|||...       .+|+.+.+++..+-.|-+|.-.++--.-+.+
T Consensus        95 ~~El~~g~rygLiG~nG~Gkst~L~~i~~~e~P~p~~~d~y~ls~  139 (614)
T KOG0927          95 TLELNRGRRYGLIGPNGSGKSTFLRAIAGREVPIPEHIDFYLLSR  139 (614)
T ss_pred             EEEECCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCCCCHHHHCC
T ss_conf             478627864899767997376899887537789984201333136


No 240
>TIGR02858 spore_III_AA stage III sporulation protein AA; InterPro: IPR014217   Proteins in this entry include the stage III sporulation protein AA that is encoded by one of several genes in the spoIIIA locus. This protein is only found in species that are capable of endospore formation..
Probab=96.48  E-value=0.016  Score=37.21  Aligned_cols=129  Identities=28%  Similarity=0.426  Sum_probs=75.4

Q ss_pred             ECCCCCHHHHHHHHHCCCCCEEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHH--HHHCCCCCCHHHCCCC
Q ss_conf             00046805887631028770444345635877776643999967784407899999999999--9971985303532068
Q gi|254780750|r  614 VKDGRHPIVEKTLKQQSSKPFIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVI--MAQMGSYVPASYAHIG  691 (920)
Q Consensus       614 i~~gRHPviE~~l~~~~~~~fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vi--lAQiG~fVPA~~a~i~  691 (920)
                      +.++=-++++.+...+.   .+-|               .||=||=-+||||+||=+|=+.=  .+|+|.    ...+.+
T Consensus       105 ~~G~A~~~~~yL~d~~~---~~~N---------------TLiIsPPq~GKTTlLRDlaR~~StG~~~~~~----~g~KVg  162 (282)
T TIGR02858       105 VLGAADKILPYLVDRNG---RVLN---------------TLIISPPQCGKTTLLRDLARILSTGISKLGL----KGKKVG  162 (282)
T ss_pred             CCCCCHHHHHHHHCCCC---CEEE---------------EEEECCCCCCCCCHHHHHHHHHHCCCCCCCC----CCCCEE
T ss_conf             05775666887730589---4467---------------8888688988510488898886078542468----997469


Q ss_pred             CCCE---EEE--------EEECCCCCCCC--CCHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             2210---567--------65237661138--5328999999999999589985699932588988056799999999999
Q gi|254780750|r  692 IVDK---LFS--------RVGSADNLASG--RSTFMVEMIETASILNQATNQSFVILDEIGRGTATLDGLSIAWATIEYL  758 (920)
Q Consensus       692 ~~D~---Ift--------RiGa~D~l~~g--~STF~vEm~e~~~IL~~at~~SLVllDElGrGTst~DG~aiA~aile~l  758 (920)
                      ++|-   |=.        .+|..=|++-+  +|==|  |    -++|..+|. .|+.|||||   +.|    ..|++|.+
T Consensus       163 ivDERSEIAgC~~GvPQ~~vG~RtDVLD~CPKAEGm--M----M~iRSMSP~-Viv~DEIGr---~ED----~~Al~eA~  228 (282)
T TIGR02858       163 IVDERSEIAGCVNGVPQLDVGIRTDVLDGCPKAEGM--M----MLIRSMSPD-VIVVDEIGR---EED----VEALLEAL  228 (282)
T ss_pred             EEECCHHHHHHCCCCCCCCCCCCEEECCCCCHHHHH--H----HHHHCCCCC-EEEEECCCC---HHH----HHHHHHHH
T ss_conf             984324656545882414467606751788537899--9----999706985-799814889---533----89999986


Q ss_pred             HHHCCCEEEEECCCHHHHHHHH
Q ss_conf             9726984999748757976643
Q gi|254780750|r  759 HETNRCRGLLATHFHELTDLSK  780 (920)
Q Consensus       759 ~~~~~~~~lfaTHy~eL~~l~~  780 (920)
                      |.  |-..+.+-|=+.+-++.+
T Consensus       229 na--GV~~I~TaHg~~~~Dl~k  248 (282)
T TIGR02858       229 NA--GVSVIATAHGRDLEDLKK  248 (282)
T ss_pred             CC--CCEEEEEECCCCHHHHHC
T ss_conf             16--756887640488126650


No 241
>TIGR01842 type_I_sec_PrtD type I secretion system ATPase; InterPro: IPR010128   Type I protein secretion is a system in some Gram-negative bacteria to export proteins (often proteases) across both inner and outer membranes to the extracellular medium. This is one of three proteins of the type I secretion apparatus. Targeted proteins are not cleaved at the N terminus, but rather carry signals located toward the extreme C terminus to direct type I secretion.; GO: 0005524 ATP binding, 0015031 protein transport, 0016021 integral to membrane.
Probab=96.47  E-value=0.042  Score=34.18  Aligned_cols=147  Identities=27%  Similarity=0.352  Sum_probs=87.4

Q ss_pred             CCCEEEC--CCCCHHHHHHHHHCCCCCE----EEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCC
Q ss_conf             8714000--0468058876310287704----443456358777766439999677844078999999999999971985
Q gi|254780750|r  609 STNFIVK--DGRHPIVEKTLKQQSSKPF----IANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSY  682 (920)
Q Consensus       609 ~~~l~i~--~gRHPviE~~l~~~~~~~f----VpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~f  682 (920)
                      ++.|.+.  ...||-=++     =..+.    +=++|++.    -..+.++-|=||=.+||||+.|.+        .|.-
T Consensus       318 ~G~L~vE~v~~~PP~~~~-----WsqPivPk~~l~gi~F~----~~aGe~laIIGPSgSGKStLaR~~--------vG~W  380 (556)
T TIGR01842       318 EGHLSVENVTIVPPGGKK-----WSQPIVPKPTLRGISFA----IQAGEALAIIGPSGSGKSTLARIL--------VGIW  380 (556)
T ss_pred             CCEEEEEEEEEECCCCCC-----CCCCCCCHHHHCCCCEE----ECCCCEEEEECCCCCCHHHHHHHH--------HHCC
T ss_conf             636888776510786313-----57897761422786215----637745888747865258898788--------7210


Q ss_pred             CCHH------HCCCCCCCE---------------EE--------EEEECCCCCCCCCCHHHHHHHHHHHH-------HH-
Q ss_conf             3035------320682210---------------56--------76523766113853289999999999-------99-
Q gi|254780750|r  683 VPAS------YAHIGIVDK---------------LF--------SRVGSADNLASGRSTFMVEMIETASI-------LN-  725 (920)
Q Consensus       683 VPA~------~a~i~~~D~---------------If--------tRiGa~D~l~~g~STF~vEm~e~~~I-------L~-  725 (920)
                      -|+.      .|.|-=+|+               +|        +|+|  ||...      -+..|.|.+       |+ 
T Consensus       381 ~~~~G~VRLDGadl~qWD~e~lG~~iGYLPQdvELF~GTva~NIARF~--en~d~------~~iieAAklAGvHElIl~l  452 (556)
T TIGR01842       381 PPASGSVRLDGADLKQWDRETLGKHIGYLPQDVELFSGTVAENIARFG--ENADP------EKIIEAAKLAGVHELILRL  452 (556)
T ss_pred             CCCCCCEEEEHHHHHCCCHHHCCCCCCCCCCCCCCCCCCHHHHCCCCC--CCCCH------HHHHHHHHHHCHHHHHHCC
T ss_conf             135653364033440237536588015479850507676764024468--87887------8999999760303575169


Q ss_pred             --------------------------HC--CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHH
Q ss_conf             --------------------------58--99856999325889880567999999999999726984999748757976
Q gi|254780750|r  726 --------------------------QA--TNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFHELTD  777 (920)
Q Consensus       726 --------------------------~a--t~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~~  777 (920)
                                                .|  ..=.||+|||-=.-=++.==.|++.|+.+ + ++-||.+++.||=+.+..
T Consensus       453 P~GYDT~iG~~G~~LSGGQRQRIaLARAlyG~P~lvvLDEPNsNLD~~GE~AL~~Ai~~-l-K~rg~tvv~itHRp~lL~  530 (556)
T TIGR01842       453 PDGYDTDIGEGGATLSGGQRQRIALARALYGDPKLVVLDEPNSNLDEEGEQALANAIKA-L-KARGITVVVITHRPSLLG  530 (556)
T ss_pred             CCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEECCCCCCCCHHHHHHHHHHHHH-H-HHCCCEEEEEECHHHHHH
T ss_conf             68854431377777861468999999987179837873288987661789999999999-9-867972899841068999


Q ss_pred             HHHHC
Q ss_conf             64306
Q gi|254780750|r  778 LSKSL  782 (920)
Q Consensus       778 l~~~~  782 (920)
                      ..+..
T Consensus       531 ~vDkI  535 (556)
T TIGR01842       531 LVDKI  535 (556)
T ss_pred             HHHHH
T ss_conf             99999


No 242
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism]
Probab=96.46  E-value=0.0036  Score=42.10  Aligned_cols=131  Identities=28%  Similarity=0.356  Sum_probs=73.6

Q ss_pred             EEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHCCCCCCCEEEE----------------
Q ss_conf             4434563587777664399996778440789999999999999719853035320682210567----------------
Q gi|254780750|r  635 IANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHIGIVDKLFS----------------  698 (920)
Q Consensus       635 VpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a~i~~~D~Ift----------------  698 (920)
                      +=++++|..    .++.+++|-||+-+||||+||.+|        |.--|- +-+|.+-++..|                
T Consensus        18 ~l~~i~l~i----~~Gef~vllGPSGcGKSTlLr~IA--------GLe~p~-~G~I~i~g~~vt~l~P~~R~iamVFQ~y   84 (338)
T COG3839          18 VLKDVNLDI----EDGEFVVLLGPSGCGKSTLLRMIA--------GLEEPT-SGEILIDGRDVTDLPPEKRGIAMVFQNY   84 (338)
T ss_pred             EEECCEEEE----CCCCEEEEECCCCCCHHHHHHHHH--------CCCCCC-CCEEEECCEECCCCCHHHCCEEEEECCC
T ss_conf             563326897----479799998999888899999996--------887788-7159999999998995578889993783


Q ss_pred             ----EEECCCCCCCCCCH-------HHHHHHHHHHHH------HH-------------------CCCCCEEEEECCCCCC
Q ss_conf             ----65237661138532-------899999999999------95-------------------8998569993258898
Q gi|254780750|r  699 ----RVGSADNLASGRST-------FMVEMIETASIL------NQ-------------------ATNQSFVILDEIGRGT  742 (920)
Q Consensus       699 ----RiGa~D~l~~g~ST-------F~vEm~e~~~IL------~~-------------------at~~SLVllDElGrGT  742 (920)
                          .|-..|||.-|.-.       ---...|++.+|      +.                   ..+-+++|+||-   .
T Consensus        85 ALyPhMtV~~Niaf~Lk~~~~~k~ei~~rV~eva~~L~l~~lL~r~P~~LSGGQrQRVAlaRAlVr~P~v~L~DEP---l  161 (338)
T COG3839          85 ALYPHMTVYENIAFGLKLRGVPKAEIDKRVKEVAKLLGLEHLLNRKPLQLSGGQRQRVALARALVRKPKVFLLDEP---L  161 (338)
T ss_pred             CCCCCCCHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHHCCCCCCCHHHHHHHHHHHHHHCCCCEEEECCC---H
T ss_conf             0157876999734166447995688899999999873986677359011772567899998777547887884476---4


Q ss_pred             CHHHHH--HHHHHHHHHHHHHCCCEEEEECCCH-HHHHHHHH
Q ss_conf             805679--9999999999972698499974875-79766430
Q gi|254780750|r  743 ATLDGL--SIAWATIEYLHETNRCRGLLATHFH-ELTDLSKS  781 (920)
Q Consensus       743 st~DG~--aiA~aile~l~~~~~~~~lfaTHy~-eL~~l~~~  781 (920)
                      |..|--  .-..+.+..|++..+..+++.||.. |.-.+++.
T Consensus       162 SnLDaklR~~mr~eik~l~~~l~~T~IYVTHDq~EAmtladr  203 (338)
T COG3839         162 SNLDAKLRVLMRSEIKKLHERLGTTTIYVTHDQVEAMTLADR  203 (338)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCEEEECCCHHHHHHHCCE
T ss_conf             676599999999999999986098489980899999840887


No 243
>PRK08181 transposase; Validated
Probab=96.42  E-value=0.089  Score=31.71  Aligned_cols=96  Identities=28%  Similarity=0.327  Sum_probs=63.4

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHCCCCCCCEEEEEEECCC---CC--CCCCCHHHHHHHHHHHHHHHC
Q ss_conf             9996778440789999999999999719853035320682210567652376---61--138532899999999999958
Q gi|254780750|r  653 WLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHIGIVDKLFSRVGSAD---NL--ASGRSTFMVEMIETASILNQA  727 (920)
Q Consensus       653 ~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a~i~~~D~IftRiGa~D---~l--~~g~STF~vEm~e~~~IL~~a  727 (920)
                      +|++||-..|||-+--.+|..++.  -|.-            -.|+++.  |   .+  .+...++       ...++.-
T Consensus       109 vil~Gp~GtGKThLA~Alg~~A~~--~G~~------------V~f~~~~--~L~~~L~~a~~~~~~-------~~~~~~l  165 (269)
T PRK08181        109 LLLFGPPGGGKSHLAAAIGLALIE--NGWR------------VLFTRTT--DLVQKLQVARRELQL-------ESAIAKL  165 (269)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHHH--CCCE------------EEEEEHH--HHHHHHHHHHHCCCH-------HHHHHHH
T ss_conf             899899998788999999999998--7993------------9997899--999999997755839-------9999997


Q ss_pred             CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCH
Q ss_conf             9985699932588988056799999999999972698499974875
Q gi|254780750|r  728 TNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFH  773 (920)
Q Consensus       728 t~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~  773 (920)
                      .+-.|+||||+|--.-+.+|..+-+-++..-+++ + -++++|.++
T Consensus       166 ~~~dLLIiDe~G~~~~~~~~~~~lf~lI~~Rye~-~-S~IITSn~~  209 (269)
T PRK08181        166 DKFDLLILDDLAYVTKDQAETSVLFELISARYER-R-SILITANQP  209 (269)
T ss_pred             HCCCEEEEHHCCCCCCCHHHHHHHHHHHHHHHCC-C-CEEEECCCC
T ss_conf             4446012201056679989999999999998578-8-889988999


No 244
>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism]
Probab=96.33  E-value=0.017  Score=37.06  Aligned_cols=130  Identities=26%  Similarity=0.339  Sum_probs=68.5

Q ss_pred             EEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCC---------C-CHHHCCCCCC-----CEEEEE
Q ss_conf             443456358777766439999677844078999999999999971985---------3-0353206822-----105676
Q gi|254780750|r  635 IANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSY---------V-PASYAHIGIV-----DKLFSR  699 (920)
Q Consensus       635 VpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~f---------V-PA~~a~i~~~-----D~IftR  699 (920)
                      |=.++++..    ..+.+.-+-|||-+||||+||+++=++=- .-|.-         + |.+.++.|+.     .+||.+
T Consensus        18 ~L~gvsl~v----~~Geiv~llG~NGaGKTTlLkti~Gl~~~-~~G~I~~~G~dit~~p~~~r~r~Gi~~VPegR~iF~~   92 (237)
T COG0410          18 ALRGVSLEV----ERGEIVALLGRNGAGKTTLLKTIMGLVRP-RSGRIIFDGEDITGLPPHERARLGIAYVPEGRRIFPR   92 (237)
T ss_pred             EEEEEEEEE----CCCCEEEEECCCCCCHHHHHHHHHCCCCC-CCEEEEECCEECCCCCHHHHHHCCEEECCCCCCCHHH
T ss_conf             885110587----68988999899988889999998589878-8706998983567799789985776867521361000


Q ss_pred             EECCCCCCCCCCHHH-------------------HH---------------HHHHHHHHHHCCCCCEEEEECCCCCCCHH
Q ss_conf             523766113853289-------------------99---------------99999999958998569993258898805
Q gi|254780750|r  700 VGSADNLASGRSTFM-------------------VE---------------MIETASILNQATNQSFVILDEIGRGTATL  745 (920)
Q Consensus       700 iGa~D~l~~g~STF~-------------------vE---------------m~e~~~IL~~at~~SLVllDElGrGTst~  745 (920)
                      +--.+||..|..+.-                   .|               |.-++..|-  +.-.|.||||-.-|-+|.
T Consensus        93 LTVeENL~~g~~~~~~~~~~~~~~e~v~~lFP~Lker~~~~aG~LSGGEQQMLAiaRALm--~~PklLLLDEPs~GLaP~  170 (237)
T COG0410          93 LTVEENLLLGAYARRDKEAQERDLEEVYELFPRLKERRNQRAGTLSGGEQQMLAIARALM--SRPKLLLLDEPSEGLAPK  170 (237)
T ss_pred             CCHHHHHHHHHHCCCCCCCCCCCHHHHHHHCHHHHHHHHCCCCCCCHHHHHHHHHHHHHH--CCCCEEEECCCCCCCCHH
T ss_conf             759998742310245310001138999997863898840844677819999999999996--199889965886676889


Q ss_pred             HHHHHHHHHHHHHHHHCCCEEEEECCC
Q ss_conf             679999999999997269849997487
Q gi|254780750|r  746 DGLSIAWATIEYLHETNRCRGLLATHF  772 (920)
Q Consensus       746 DG~aiA~aile~l~~~~~~~~lfaTHy  772 (920)
                      ==--| ..++..|.+..+--.|.+-.+
T Consensus       171 iv~~I-~~~i~~l~~~~g~tIlLVEQn  196 (237)
T COG0410         171 IVEEI-FEAIKELRKEGGMTILLVEQN  196 (237)
T ss_pred             HHHHH-HHHHHHHHHCCCCEEEEEECC
T ss_conf             99999-999999997489489999425


No 245
>PRK08939 primosomal protein DnaI; Reviewed
Probab=96.32  E-value=0.1  Score=31.32  Aligned_cols=105  Identities=20%  Similarity=0.266  Sum_probs=62.1

Q ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHCCCCCCCEEEEEEECCCCCCCCCCHHHHHHH---------H
Q ss_conf             6439999677844078999999999999971985303532068221056765237661138532899999---------9
Q gi|254780750|r  649 SGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHIGIVDKLFSRVGSADNLASGRSTFMVEMI---------E  719 (920)
Q Consensus       649 ~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a~i~~~D~IftRiGa~D~l~~g~STF~vEm~---------e  719 (920)
                      ..+-+.|.||...|||-++-  |++--||+-|-.|            +|..+          ++|+.+|.         +
T Consensus       156 ~~kGlyl~G~~G~GKTyL~~--aian~La~~g~~v------------~~v~~----------p~~~~~lK~s~~d~s~~~  211 (306)
T PRK08939        156 KVKGLYLYGDFGVGKTYLLA--AIANELAKKGVSS------------TLVHF----------PEFIRELKNAISDGSVKE  211 (306)
T ss_pred             CCCEEEEECCCCCCHHHHHH--HHHHHHHHCCCEE------------EEEEH----------HHHHHHHHHHHCCCCHHH
T ss_conf             88778898999998999999--9999999869929------------99875----------999999999864898899


Q ss_pred             HHHHHHHCCCCCEEEEECCCCCCCHHHHH-HHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHC
Q ss_conf             99999958998569993258898805679-9999999999972698499974875797664306
Q gi|254780750|r  720 TASILNQATNQSFVILDEIGRGTATLDGL-SIAWATIEYLHETNRCRGLLATHFHELTDLSKSL  782 (920)
Q Consensus       720 ~~~IL~~at~~SLVllDElGrGTst~DG~-aiA~aile~l~~~~~~~~lfaTHy~eL~~l~~~~  782 (920)
                      .-..++++   .+.+||.||..+.|.=-. -+-..|++|=... +-.|+|+|-|. +.+|+..+
T Consensus       212 ~i~~~k~~---~vLiLDDiGaE~~t~W~rd~vl~~IL~~Rm~~-~lPTffTSN~~-~~eLe~~l  270 (306)
T PRK08939        212 KIDAVKEA---PVLMLDDIGAEQMSSWVRDEVLGVILQYRMQE-ELPTFFTSNFD-FDELEHHL  270 (306)
T ss_pred             HHHHHHCC---CEEEEECCCCCCCCHHHHHHHHHHHHHHHHHC-CCCEEEECCCC-HHHHHHHH
T ss_conf             99998449---98998444654267778998999999999974-99979977999-99999998


No 246
>KOG0056 consensus
Probab=96.32  E-value=0.1  Score=31.30  Aligned_cols=150  Identities=22%  Similarity=0.323  Sum_probs=81.5

Q ss_pred             CCCCEECCCCCCEEECC---CCCHHHHHHHHHCCCCCEEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHH--------
Q ss_conf             88512104787140000---4680588763102877044434563587777664399996778440789999--------
Q gi|254780750|r  600 NYCRPIIDNSTNFIVKD---GRHPIVEKTLKQQSSKPFIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLR--------  668 (920)
Q Consensus       600 ~y~rP~i~~~~~l~i~~---gRHPviE~~l~~~~~~~fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lR--------  668 (920)
                      +-+-|--+..+.++..+   ++.|           +.-|--||++..    ..++..-+-||-.|||||.||        
T Consensus       526 P~a~pl~~~~G~i~fsnvtF~Y~p-----------~k~vl~disF~v----~pGktvAlVG~SGaGKSTimRlLfRffdv  590 (790)
T KOG0056         526 PGAPPLKVTQGKIEFSNVTFAYDP-----------GKPVLSDISFTV----QPGKTVALVGPSGAGKSTIMRLLFRFFDV  590 (790)
T ss_pred             CCCCCCCCCCCEEEEEEEEEECCC-----------CCCEEECCEEEE----CCCCEEEEECCCCCCHHHHHHHHHHHHHC
T ss_conf             999973305770899876786489-----------986123214885----69968999778988666899999999405


Q ss_pred             -------------HHHHHHHHHHCCCCCCHHHC--CCCCCCEE-EEEEECCCC-CCC----------------CCCHHH-
Q ss_conf             -------------99999999971985303532--06822105-676523766-113----------------853289-
Q gi|254780750|r  669 -------------QNALIVIMAQMGSYVPASYA--HIGIVDKL-FSRVGSADN-LAS----------------GRSTFM-  714 (920)
Q Consensus       669 -------------qval~vilAQiG~fVPA~~a--~i~~~D~I-ftRiGa~D~-l~~----------------g~STF~-  714 (920)
                                   +|-+..+=.|||- ||-+..  .=++++.| |.|.+|+|+ +..                |.-|=- 
T Consensus       591 ~sGsI~iDgqdIrnvt~~SLRs~IGV-VPQDtvLFNdTI~yNIryak~~AsneevyaAAkAA~IHdrIl~fPegY~t~VG  669 (790)
T KOG0056         591 NSGSITIDGQDIRNVTQSSLRSSIGV-VPQDTVLFNDTILYNIRYAKPSASNEEVYAAAKAAQIHDRILQFPEGYNTRVG  669 (790)
T ss_pred             CCCEEEECCCHHHHHHHHHHHHHCCC-CCCCCEEECCEEEEHEEECCCCCCHHHHHHHHHHHHHHHHHHCCCHHHHHHHH
T ss_conf             57608986701788879989975683-56751354210000102168899718999999875578988628425543320


Q ss_pred             --------HHHHH---HHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECC
Q ss_conf             --------99999---9999995899856999325889880567999999999999726984999748
Q gi|254780750|r  715 --------VEMIE---TASILNQATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATH  771 (920)
Q Consensus       715 --------vEm~e---~~~IL~~at~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTH  771 (920)
                              -|-..   ...||+   .-|.|++||--..-+|..--+| .|.++.+.. ++ .++..-|
T Consensus       670 ERGLkLSGGEKQRVAiARtiLK---~P~iIlLDEATSALDT~tER~I-QaaL~rlca-~R-TtIVvAH  731 (790)
T KOG0056         670 ERGLKLSGGEKQRVAIARTILK---APSIILLDEATSALDTNTERAI-QAALARLCA-NR-TTIVVAH  731 (790)
T ss_pred             HCCCCCCCCCHHHHHHHHHHHC---CCCEEEECCHHHHCCCCCHHHH-HHHHHHHHC-CC-CEEEEEE
T ss_conf             0243557750356899999861---8958997130432378628999-999999856-88-5599864


No 247
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2. The enzyme that catalyzes the final step in methanogenesis, methyl coenzyme M reductase, contains alpha, beta, and gamma chains. In older literature, the complex of alpha, beta, and gamma chains was termed component C, while this single chain protein was termed methyl coenzyme M reductase system component A2.
Probab=96.30  E-value=0.052  Score=33.48  Aligned_cols=54  Identities=15%  Similarity=0.202  Sum_probs=32.6

Q ss_pred             CCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHH-HHHHHH
Q ss_conf             8998569993258898805679999999999997269849997487579-766430
Q gi|254780750|r  727 ATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFHEL-TDLSKS  781 (920)
Q Consensus       727 at~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~eL-~~l~~~  781 (920)
                      ++.-.++|+||--+|=+..--..|...+++-. +..+.-++|.||..+. ..+.+.
T Consensus       443 ~~~P~vlilDEPT~glD~~~~~~i~~~l~~~~-~~~g~tvi~iShDl~~~~~~~dR  497 (520)
T TIGR03269       443 IKEPRIVILDEPTGTMDPITKVDVTHSILKAR-EEMEQTFIIVSHDMDFVLDVCDR  497 (520)
T ss_pred             HHCCCEEEEECCHHHHHHHHHHHHHHHHHHHH-HHCCCEEEEECCCHHHHHHHCCE
T ss_conf             97989899938601133899999999999999-83298999977888999986999


No 248
>PRK09183 transposase/IS protein; Provisional
Probab=96.19  E-value=0.046  Score=33.84  Aligned_cols=95  Identities=18%  Similarity=0.262  Sum_probs=60.9

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHCCCCCCCEEEEEEECCCCCCCCCCHHHHHHHH------HHHHHH-
Q ss_conf             9996778440789999999999999719853035320682210567652376611385328999999------999999-
Q gi|254780750|r  653 WLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHIGIVDKLFSRVGSADNLASGRSTFMVEMIE------TASILN-  725 (920)
Q Consensus       653 ~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a~i~~~D~IftRiGa~D~l~~g~STF~vEm~e------~~~IL~-  725 (920)
                      +|++||-..|||-+-=.+|..++.  -|-            .-.|+++.   +|       +.++.+      ....++ 
T Consensus       104 vil~G~~GtGKThLA~Alg~~A~~--~G~------------~v~f~~~~---~L-------~~~L~~a~~~~~~~~~l~r  159 (258)
T PRK09183        104 IVLLGPSGVGKTHLAIALGYEAVR--AGI------------KVRFTTAA---DL-------LLQLSTAQRQGRYKTTLQR  159 (258)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHHH--CCC------------EEEEEEHH---HH-------HHHHHHHHHCCCHHHHHHH
T ss_conf             799899998689999999999998--799------------39997899---99-------9999999876859999998


Q ss_pred             HCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCH
Q ss_conf             589985699932588988056799999999999972698499974875
Q gi|254780750|r  726 QATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFH  773 (920)
Q Consensus       726 ~at~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~  773 (920)
                      ....-.|+||||+|--.-+..+..+-+-+++.-.++ + -++++|.++
T Consensus       160 ~l~~~dLLIiDdlG~~~~~~~~~~~lfeli~~Rye~-~-S~IiTSn~~  205 (258)
T PRK09183        160 GVMAPRLLIIDEIGYLPFSQEEANLFFQVIAKRYEK-G-AMILTSNLP  205 (258)
T ss_pred             HHCCCCEEEEHHHHCCCCCHHHHHHHHHHHHHHHCC-C-CEEEECCCC
T ss_conf             743465144313315468888999999999998576-7-789988999


No 249
>pfam03215 Rad17 Rad17 cell cycle checkpoint protein.
Probab=96.18  E-value=0.052  Score=33.43  Aligned_cols=34  Identities=18%  Similarity=0.272  Sum_probs=24.7

Q ss_pred             CCCCCHHHH-HHHHHHHHHHHHCCCCCCHHHCCCCC
Q ss_conf             784407899-99999999999719853035320682
Q gi|254780750|r  658 PNMGGKSTF-LRQNALIVIMAQMGSYVPASYAHIGI  692 (920)
Q Consensus       658 pNmgGKSt~-lRqval~vilAQiG~fVPA~~a~i~~  692 (920)
                      |=|| |.|+ ||.-+.|.+.-+||-+.-+++..=|+
T Consensus       449 ~~~~-~~~~~~~~~~~i~~i~~i~~~~~~~~~~~~~  483 (490)
T pfam03215       449 PMIG-AKDYAMLTCPYITIIKDIIDPQRIEYFLSGP  483 (490)
T ss_pred             HHHH-HHCCCCCCCHHHHHHHHHCCHHHHHHCCCCC
T ss_conf             5877-5023112614657998613313333203687


No 250
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport.  Other members of this system include the MetP permease and  the MetQ substrate binding protein.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=96.18  E-value=0.099  Score=31.35  Aligned_cols=138  Identities=25%  Similarity=0.292  Sum_probs=67.3

Q ss_pred             EEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCC------CCH-HH-------CCCCCCC---EEE
Q ss_conf             443456358777766439999677844078999999999999971985------303-53-------2068221---056
Q gi|254780750|r  635 IANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSY------VPA-SY-------AHIGIVD---KLF  697 (920)
Q Consensus       635 VpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~f------VPA-~~-------a~i~~~D---~If  697 (920)
                      +=+|++++.    ..+.+.-|-||.-+||||++|.++-+. -..-|.-      +.. ..       -.++.+=   ..|
T Consensus        20 al~~vsl~i----~~Ge~~~ivG~SGsGKSTllr~i~gL~-~p~sG~I~~~g~~i~~~~~~~~~~~Rr~ig~VFQ~~~L~   94 (233)
T cd03258          20 ALKDVSLSV----PKGEIFGIIGRSGAGKSTLIRCINGLE-RPTSGSVLVDGTDLTLLSGKELRKARRRIGMIFQHFNLL   94 (233)
T ss_pred             EEECCEEEE----CCCCEEEEECCCCCHHHHHHHHHHCCC-CCCCCEEEECCEECCCCCHHHHHHHHCCCCEEECCCCCC
T ss_conf             984828899----999999998898058999999996799-999808999999989799999999862587794377889


Q ss_pred             EEEECCCCCCC-----CCCH-----HHHHHHHHH---------------------HH-HHHCCCCCEEEEECCCCCCCHH
Q ss_conf             76523766113-----8532-----899999999---------------------99-9958998569993258898805
Q gi|254780750|r  698 SRVGSADNLAS-----GRST-----FMVEMIETA---------------------SI-LNQATNQSFVILDEIGRGTATL  745 (920)
Q Consensus       698 tRiGa~D~l~~-----g~ST-----F~vEm~e~~---------------------~I-L~~at~~SLVllDElGrGTst~  745 (920)
                      ..+-..||+..     |.|.     -..|+.+.-                     .| ---+.+-.++|.||-   |+..
T Consensus        95 ~~~tv~~nv~~~l~~~~~~~~~~~~r~~~lL~~vgL~~~~~~yP~eLSGGq~QRVaIARAL~~~P~lllaDEP---Ts~L  171 (233)
T cd03258          95 SSRTVFENVALPLEIAGVPKAEIEERVLELLELVGLEDKADAYPAQLSGGQKQRVGIARALANNPKVLLCDEA---TSAL  171 (233)
T ss_pred             CCCCHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHHCCCCCCCHHHHHHHHHHHHHHCCCCEEEECCC---CCCC
T ss_conf             9883999999999974999999999999999867991676269652677888999999998339989996597---6646


Q ss_pred             HHHH--HHHHHHHHHHHHCCCEEEEECCCHHHH-HHHH
Q ss_conf             6799--999999999972698499974875797-6643
Q gi|254780750|r  746 DGLS--IAWATIEYLHETNRCRGLLATHFHELT-DLSK  780 (920)
Q Consensus       746 DG~a--iA~aile~l~~~~~~~~lfaTHy~eL~-~l~~  780 (920)
                      |-..  --...+..|.+..+...+|+||.-++. .+++
T Consensus       172 D~~~~~~il~ll~~l~~e~g~t~i~vTHDl~~~~~~ad  209 (233)
T cd03258         172 DPETTQSILALLRDINRELGLTIVLITHEMEVVKRICD  209 (233)
T ss_pred             CHHHHHHHHHHHHHHHHHHCCEEEEECCCHHHHHHHCC
T ss_conf             98899999999999999729899998989999998699


No 251
>KOG0059 consensus
Probab=96.15  E-value=0.091  Score=31.65  Aligned_cols=64  Identities=20%  Similarity=0.279  Sum_probs=45.3

Q ss_pred             CCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHH-HHHHCCCEEEEEEEE
Q ss_conf             899856999325889880567999999999999726984999748757976-643068858999999
Q gi|254780750|r  727 ATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFHELTD-LSKSLKRFHNATLQV  792 (920)
Q Consensus       727 at~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~~-l~~~~~~v~n~~~~~  792 (920)
                      ...-++|+|||---|-+|. +-=..|.++..+.+..+ -.+.+||+-|=++ +.....-..+.++.+
T Consensus       714 ig~p~vi~LDEPstGmDP~-arr~lW~ii~~~~k~g~-aiiLTSHsMeE~EaLCtR~aImv~G~l~c  778 (885)
T KOG0059         714 IGDPSVILLDEPSTGLDPK-ARRHLWDIIARLRKNGK-AIILTSHSMEEAEALCTRTAIMVIGQLRC  778 (885)
T ss_pred             CCCCCEEEECCCCCCCCHH-HHHHHHHHHHHHHHCCC-EEEEEECCHHHHHHHHCCEEEEECCEEEE
T ss_conf             1698679981787668988-99999999999985595-79999356999999862434687577999


No 252
>cd00983 recA RecA is a  bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response.  RecA couples ATP hydrolysis to DNA strand exchange.
Probab=96.13  E-value=0.07  Score=32.51  Aligned_cols=122  Identities=19%  Similarity=0.267  Sum_probs=69.4

Q ss_pred             CCCEEEEEECCCCCCHHHH-HHHHHHHHHHHHCCC---CCCHHHCCCCCCCEEEEEEEC-CCCCCCCCCHHHHHHHHHHH
Q ss_conf             6643999967784407899-999999999997198---530353206822105676523-76611385328999999999
Q gi|254780750|r  648 NSGKLWLLTGPNMGGKSTF-LRQNALIVIMAQMGS---YVPASYAHIGIVDKLFSRVGS-ADNLASGRSTFMVEMIETAS  722 (920)
Q Consensus       648 ~~~~~~iiTGpNmgGKSt~-lRqval~vilAQiG~---fVPA~~a~i~~~D~IftRiGa-~D~l~~g~STF~vEm~e~~~  722 (920)
                      ..+|+.-|.||..+||||+ |..++-++   ..|.   |+=|+.+- .+  .-...+|- .|++.--++...-++.++..
T Consensus        53 P~GRivei~G~essGKTtlal~~ia~aQ---k~gg~~~~iDaE~a~-d~--~~a~~lGVD~~~l~~~qp~~~Eq~l~i~~  126 (325)
T cd00983          53 PKGRIIEIYGPESSGKTTLALHAIAEAQ---KLGGTVAFIDAEHAL-DP--VYAKKLGVDLDNLLISQPDTGEQALEIAD  126 (325)
T ss_pred             CCCEEEEEECCCCCCHHHHHHHHHHHHH---HCCCEEEEEEHHHCC-CH--HHHHHCCCCHHHEEEECCCHHHHHHHHHH
T ss_conf             6880899988987779999999999987---359839999625425-98--99998099846758966638999999999


Q ss_pred             HHHHCCCCCEEEEECCCCCCCHHH----------H-H----HHHHHHHHHHHHHCCCEEEEECCCHHH
Q ss_conf             999589985699932588988056----------7-9----999999999997269849997487579
Q gi|254780750|r  723 ILNQATNQSFVILDEIGRGTATLD----------G-L----SIAWATIEYLHETNRCRGLLATHFHEL  775 (920)
Q Consensus       723 IL~~at~~SLVllDElGrGTst~D----------G-~----aiA~aile~l~~~~~~~~lfaTHy~eL  775 (920)
                      -|-+...-.||++|=+|-=+...+          | .    +-|+-.+...+.+.+|..+|.-|..+=
T Consensus       127 ~li~s~~~dliViDSvaal~p~~E~e~~~~d~~vg~~ArlmskalRklt~~l~k~~~~lIfiNQ~R~k  194 (325)
T cd00983         127 SLVRSGAVDLIVVDSVAALVPKAEIEGEMGDSHVGLQARLMSQALRKLTGSINKSNTTVIFINQLREK  194 (325)
T ss_pred             HHHCCCCCCEEEECCCCCCCCHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEEEHHH
T ss_conf             97515887679981511236578876011321143899999999999998753378079995543221


No 253
>TIGR01288 nodI nodulation ABC transporter NodI; InterPro: IPR005978   ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs.   ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain .    The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , .   The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , .   Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1).     Nodulation ABC transporter, NodI is required for normal nodulation by nitrogen-fixing root nodule bacteria such as Mesorhizobium loti. It is a member of the family of ABC transporter ATP binding proteins and works with NodJ IPR005981 from INTERPRO to export a variety of modified carbohydrate molecules as signals to plant hosts to establish root nodules.    This model does not recognize the highly divergent NodI from Azorhizobium caulinodans.; GO: 0005215 transporter activity, 0005524 ATP binding, 0006810 transport, 0009877 nodulation, 0016020 membrane.
Probab=96.10  E-value=0.027  Score=35.62  Aligned_cols=140  Identities=32%  Similarity=0.446  Sum_probs=82.6

Q ss_pred             CCCEEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHH-----HHHHCCCCCCHH----HCCCCCC---CEEEE
Q ss_conf             77044434563587777664399996778440789999999999-----999719853035----3206822---10567
Q gi|254780750|r  631 SKPFIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIV-----IMAQMGSYVPAS----YAHIGIV---DKLFS  698 (920)
Q Consensus       631 ~~~fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~v-----ilAQiG~fVPA~----~a~i~~~---D~Ift  698 (920)
                      +...|-||+.+..    ..+.+.=+-|||.+||||.-|.+-=++     -..-.|-.+|+.    .+++|++   |.+=.
T Consensus        15 G~k~~v~~lsf~~----~~GeCfGllGPnGaGkst~~r~~lG~~~P~~G~itvl~~~~P~~~r~ar~~~G~v~qfd~l~~   90 (303)
T TIGR01288        15 GDKVVVNDLSFTI----AAGECFGLLGPNGAGKSTIARLVLGLISPDEGKITVLGEPVPARARLARAKIGVVPQFDNLDR   90 (303)
T ss_pred             CCEEEEECCEEEE----ECCCEEECCCCCCCCHHHHHHHHHHCCCCCCCEEEEECCCCCHHHHHHHHHCCEEECCCCCCH
T ss_conf             7737873131455----335122222788762577766765235888752788247774255433444011202012320


Q ss_pred             EEECCCCCCC-----CCCHHHHH-----HHHHHHH--------------------HHHC--CCCCEEEEECCCCCCCHHH
Q ss_conf             6523766113-----85328999-----9999999--------------------9958--9985699932588988056
Q gi|254780750|r  699 RVGSADNLAS-----GRSTFMVE-----MIETASI--------------------LNQA--TNQSFVILDEIGRGTATLD  746 (920)
Q Consensus       699 RiGa~D~l~~-----g~STF~vE-----m~e~~~I--------------------L~~a--t~~SLVllDElGrGTst~D  746 (920)
                      ..-+.+|+.-     +.||=.+|     +.|.+.+                    |-.|  ..-.|.++||--.|-+|+-
T Consensus        91 eft~renllv~Gryf~~~~r~~e~~~P~ll~farleska~~~v~~lsGGm~rrltla~alindP~ll~ldePttGldPha  170 (303)
T TIGR01288        91 EFTVRENLLVFGRYFGLSTREIEEVIPSLLEFARLESKADVRVADLSGGMKRRLTLARALINDPQLLILDEPTTGLDPHA  170 (303)
T ss_pred             HHHHHHHEEEEEEEEECHHHHHHHHHHHHHHHHHHHHHCCCCHHHHCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCHHH
T ss_conf             11222110222000000045587754667776642100254054532514678888888743983799737877877146


Q ss_pred             HHHHHHHHHHHHHHHCCCEEEEECCCHHHH
Q ss_conf             799999999999972698499974875797
Q gi|254780750|r  747 GLSIAWATIEYLHETNRCRGLLATHFHELT  776 (920)
Q Consensus       747 G~aiA~aile~l~~~~~~~~lfaTHy~eL~  776 (920)
                      - -+-|--+..|... +-..|.+||+-|=+
T Consensus       171 r-hliWerlr~lla~-Gktilltth~meea  198 (303)
T TIGR01288       171 R-HLIWERLRSLLAR-GKTILLTTHFMEEA  198 (303)
T ss_pred             H-HHHHHHHHHHHHC-CCEEEEHHHHHHHH
T ss_conf             7-8999999999853-86112034677777


No 254
>KOG0217 consensus
Probab=96.04  E-value=1.8e-05  Score=59.25  Aligned_cols=176  Identities=17%  Similarity=0.074  Sum_probs=120.4

Q ss_pred             CCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHCCCCCCCEEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHC
Q ss_conf             66439999677844078999999999999971985303532068221056765237661138532899999999999958
Q gi|254780750|r  648 NSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHIGIVDKLFSRVGSADNLASGRSTFMVEMIETASILNQA  727 (920)
Q Consensus       648 ~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a~i~~~D~IftRiGa~D~l~~g~STF~vEm~e~~~IL~~a  727 (920)
                      +....+|-++||.||+|. +|-+.-....--.+.|+|+.++.+.-+|.+--|+-+.++  .+++.|.++|.+-- |.-.+
T Consensus       752 Gk~~y~lEvP~n~~~~s~-~~~~~~S~~Kg~~RY~tp~~~kli~~l~~aee~~~~~~~--d~~~r~~~~f~~~~-~~w~~  827 (1125)
T KOG0217         752 GKDVYQLEVPENGGVPSS-LRYELMSAKKGVSRYYTPDLRKLIAHLDEAEERKKSSLS--DLKRRLIVRFDEHY-IIWQA  827 (1125)
T ss_pred             CCEEEEEECCCCCCCCCC-HHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHH--HHHHHHHHHHHHHH-HHHHH
T ss_conf             754799963765687783-689998753273324687799999999999999987777--88999999863237-99999


Q ss_pred             CCCCEEEEECCCCCCCHHHH----HHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHH----CCCEEEEEEEEEEECCEE
Q ss_conf             99856999325889880567----9999999999997269849997487579766430----688589999999609927
Q gi|254780750|r  728 TNQSFVILDEIGRGTATLDG----LSIAWATIEYLHETNRCRGLLATHFHELTDLSKS----LKRFHNATLQVSDSNEGI  799 (920)
Q Consensus       728 t~~SLVllDElGrGTst~DG----~aiA~aile~l~~~~~~~~lfaTHy~eL~~l~~~----~~~v~n~~~~~~~~~~~i  799 (920)
                      |-++++.||+|.++|-+.+|    +.++ .|++-.- . ..+..|.+|-|..-.+...    .|+..  .+...+.+ .+
T Consensus       828 tv~~~a~iD~l~sla~~s~~~~~~~Crp-~i~~~~d-t-~~~l~~~~~~Hpcfsl~s~~~~fipN~v--~~g~~~e~-~~  901 (1125)
T KOG0217         828 TVKALASIDCLLSLAETSKGLGGPMCRP-EIVESTD-T-PGFLIVKGLRHPCFSLPSTGTSFIPNDV--ELGGAEEN-RE  901 (1125)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCCCCCCC-EEECCCC-C-CCEEEEECCCCCEEECCCCCCCCCCCHH--HCCCCCCC-EE
T ss_conf             9999998899987777650379875352-4641468-8-8616884266724623767776456322--20555432-02


Q ss_pred             EE----EEEEEECCCCCCHHHHHHHHCC--CCHHHHHHHH
Q ss_conf             78----7777447898877899999829--9989999999
Q gi|254780750|r  800 IF----LHKVIPGIADHSYGIQVGKLAG--LPNTVISRAY  833 (920)
Q Consensus       800 ~f----lykl~~G~~~~Sygi~vA~laG--~p~~vi~~A~  833 (920)
                      ..    .-..+.+++.++--..++...|  +|.++++++-
T Consensus       902 ~llTGpNmgGKSTllRq~c~~vilaq~G~~VPa~~~~~tp  941 (1125)
T KOG0217         902 GLLTGPNMGGKSTLLRQACIAVILAQIGCDVPAEVMELTP  941 (1125)
T ss_pred             EEECCCCCCCCHHHHHHHHHHHHHHHHCCCCCHHHHCCCC
T ss_conf             2320687577248999999999999857876588860661


No 255
>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional
Probab=96.04  E-value=0.14  Score=30.32  Aligned_cols=123  Identities=20%  Similarity=0.236  Sum_probs=63.3

Q ss_pred             EEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHC------------------CCCCCC-
Q ss_conf             4443456358777766439999677844078999999999999971985303532------------------068221-
Q gi|254780750|r  634 FIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYA------------------HIGIVD-  694 (920)
Q Consensus       634 fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a------------------~i~~~D-  694 (920)
                      .|=+|+++..    ..+...-|.||+.+||||+++-+.        |.|-|-+-.                  .++.|- 
T Consensus       355 ~vL~~is~~I----~~Ge~vaIVG~SGsGKSTL~~LL~--------rly~p~~G~I~idG~di~~i~~~~lR~~i~~V~Q  422 (593)
T PRK10790        355 LVLKNINLSV----PSRNFVALVGHTGSGKSTLASLLM--------GYYPLTEGEIRLDGRPLSSLSHSVLRQGVAMVQQ  422 (593)
T ss_pred             HHHHCCCCCC----CCCCEEEEECCCCCCHHHHHHHHH--------HHCCCCCCCCCCCCEECCCCCHHHHHHCCCCCCC
T ss_conf             0142601044----899789987999886899999999--------8556789941659932442468888631575166


Q ss_pred             --EEEEEEECCCCCCCCCCHHHHHHHHHHHHH------H----------------------------H--CCCCCEEEEE
Q ss_conf             --056765237661138532899999999999------9----------------------------5--8998569993
Q gi|254780750|r  695 --KLFSRVGSADNLASGRSTFMVEMIETASIL------N----------------------------Q--ATNQSFVILD  736 (920)
Q Consensus       695 --~IftRiGa~D~l~~g~STF~vEm~e~~~IL------~----------------------------~--at~~SLVllD  736 (920)
                        -+|.. --.|||.-|...=..|+.+.+...      .                            .  ..+..++|+|
T Consensus       423 ~~~LF~g-TI~eNi~~g~~~~~~~i~~a~~~a~l~~~i~~lp~G~dT~vge~G~~LSgGQrQRiaiARall~~p~iliLD  501 (593)
T PRK10790        423 DPVVLAD-TFLANVTLGRDISEEQVWQALETVQLAELARSLSDGLYTPLGEQGNTLSVGQKQLLALARVLVETPQILILD  501 (593)
T ss_pred             CCCCCCC-CHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHCCCHHCCHHCCCCCCCCHHHHHHHHHHHHHHCCCCEEEEE
T ss_conf             6514565-299997760023679999999997789999857420104423876887999999999999995598999983


Q ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHH-CCCEEEEECCCH
Q ss_conf             2588988056799999999999972-698499974875
Q gi|254780750|r  737 EIGRGTATLDGLSIAWATIEYLHET-NRCRGLLATHFH  773 (920)
Q Consensus       737 ElGrGTst~DG~aiA~aile~l~~~-~~~~~lfaTHy~  773 (920)
                      |-   ||.-|-.. -..|.+.|-+. .++.++..||=-
T Consensus       502 Ea---TSaLD~~t-E~~i~~~l~~~~~~~T~i~IaHRl  535 (593)
T PRK10790        502 EA---TASIDSGT-EQAIQQALAAIREHTTLVVIAHRL  535 (593)
T ss_pred             CC---CCCCCHHH-HHHHHHHHHHHCCCCEEEEECCCH
T ss_conf             87---77889999-999999999972899899970789


No 256
>PRK00440 rfc replication factor C small subunit; Reviewed
Probab=96.01  E-value=0.12  Score=30.74  Aligned_cols=99  Identities=20%  Similarity=0.215  Sum_probs=52.0

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHCCCCCCCEEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHC-CCCC
Q ss_conf             999677844078999999999999971985303532068221056765237661138532899999999999958-9985
Q gi|254780750|r  653 WLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHIGIVDKLFSRVGSADNLASGRSTFMVEMIETASILNQA-TNQS  731 (920)
Q Consensus       653 ~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a~i~~~D~IftRiGa~D~l~~g~STF~vEm~e~~~IL~~a-t~~S  731 (920)
                      +|++||...||+|..+-+|     .++.+.-         ++.=+..+-|+|+  +|....--...+.+..-... .+.-
T Consensus        40 lLf~GppG~GKTt~a~~la-----~~l~~~~---------~~~~~lelnasd~--r~id~vr~~i~~~~~~~~~~~~~~k  103 (318)
T PRK00440         40 LLFAGPPGTGKTTAALALA-----RELYGEY---------WRENFLELNASDE--RGIDVIRNKIKEFARTAPVGGAPFK  103 (318)
T ss_pred             EEEECCCCCCHHHHHHHHH-----HHHCCCC---------CCCCEEEECCCCC--CCHHHHHHHHHHHHHHCCCCCCCEE
T ss_conf             9888959988999999999-----9976986---------4347689516456--6717899999999972677899738


Q ss_pred             EEEEECCCCCCCHHHHHHHHHHHHHHHHHH--CCCEEEEECCCH
Q ss_conf             699932588988056799999999999972--698499974875
Q gi|254780750|r  732 FVILDEIGRGTATLDGLSIAWATIEYLHET--NRCRGLLATHFH  773 (920)
Q Consensus       732 LVllDElGrGTst~DG~aiA~aile~l~~~--~~~~~lfaTHy~  773 (920)
                      +|++||.-+=|.  ++    +..+....+.  ..|+.+++|.+.
T Consensus       104 iiiiDE~d~l~~--~a----q~aL~~~mE~~~~~~~fil~~n~~  141 (318)
T PRK00440        104 IIFLDEADNLTS--DA----QQALRRTMEMYSQTTRFILSCNYS  141 (318)
T ss_pred             EEEEECCCCCCH--HH----HHHHHHHHHCCCCCCEEEEECCCC
T ss_conf             999868553225--56----788876431056662588634883


No 257
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases. Helicases couple NTP hydrolysis to the unwinding of nucleic acid duplexes into their component strands.
Probab=95.93  E-value=0.025  Score=35.80  Aligned_cols=44  Identities=36%  Similarity=0.403  Sum_probs=31.9

Q ss_pred             CCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHCCCCC
Q ss_conf             664399996778440789999999999999719853035320682
Q gi|254780750|r  648 NSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHIGI  692 (920)
Q Consensus       648 ~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a~i~~  692 (920)
                      ..+.+.+|+|+-..|||+|+.++++..+ +|-|-.|--=+.+++.
T Consensus        28 ~~GeL~viaarpg~GKT~f~~~~a~~~~-~~~g~~vl~~SlEm~~   71 (271)
T cd01122          28 RKGELIILTAGTGVGKTTFLREYALDLI-TQHGVRVGTISLEEPV   71 (271)
T ss_pred             CCCCEEEEEECCCCCHHHHHHHHHHHHH-HHCCCEEEEEECCCCH
T ss_conf             9980899996899869999999999999-9769908999704999


No 258
>PRK13695 putative NTPase; Provisional
Probab=95.83  E-value=0.13  Score=30.52  Aligned_cols=115  Identities=22%  Similarity=0.278  Sum_probs=59.4

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHHHHH-----CCCCCCH--H-HCCC--CCCC------EEEEEEECCCCCCCCC-CHHHH
Q ss_conf             99967784407899999999999997-----1985303--5-3206--8221------0567652376611385-32899
Q gi|254780750|r  653 WLLTGPNMGGKSTFLRQNALIVIMAQ-----MGSYVPA--S-YAHI--GIVD------KLFSRVGSADNLASGR-STFMV  715 (920)
Q Consensus       653 ~iiTGpNmgGKSt~lRqval~vilAQ-----iG~fVPA--~-~a~i--~~~D------~IftRiGa~D~l~~g~-STF~v  715 (920)
                      ..||||--.||||+++-+.=.  |..     .|.+.+-  + .-++  -++|      .+++|++..-..--|+ .-+.-
T Consensus         6 I~iTG~PGvGKTTli~Kv~~~--L~~~g~~v~GF~T~Evre~G~R~GF~vv~l~~g~~~~lA~~~~~~~~~VgkY~V~~~   83 (174)
T PRK13695          6 IGITGMPGVGKTTLVLKIAEL--LAREGYKVGGFITEEVREGGKRIGFKIIDLDTGEEGILARVGAVSRPRVGKYVVNLE   83 (174)
T ss_pred             EEEECCCCCCHHHHHHHHHHH--HHHCCCEEEEEEEEEEECCCEEEEEEEEECCCCCEEEEEECCCCCCCCCCCEEEEHH
T ss_conf             998789998899999999999--863696174699525603882850599990588568767537889855456687168


Q ss_pred             HHHHH-HHHHHHC-CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCH
Q ss_conf             99999-9999958-9985699932588988056799999999999972698499974875
Q gi|254780750|r  716 EMIET-ASILNQA-TNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFH  773 (920)
Q Consensus       716 Em~e~-~~IL~~a-t~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~  773 (920)
                      +..+. ..+|++| ++..|+++||+|+=--....  .-.+|.+-| +..+ .+|.+=|-+
T Consensus        84 ~~e~~~~~~l~~a~~~~dlivIDEIG~MEl~s~~--F~~~V~~~L-~s~k-pvl~tih~p  139 (174)
T PRK13695         84 DLERIAIPAISRALREADLIIIDEIGPMELKSKK--FVSAVEEVL-KSEK-PVIATVHRP  139 (174)
T ss_pred             HHHHHHHHHHHHCCCCCCEEEEECCCHHHHHHHH--HHHHHHHHH-CCCC-CEEEEECHH
T ss_conf             9789989999835357879999631033110499--999999997-3899-899997758


No 259
>PRK04195 replication factor C large subunit; Provisional
Probab=95.83  E-value=0.15  Score=30.02  Aligned_cols=15  Identities=27%  Similarity=0.339  Sum_probs=6.8

Q ss_pred             CCCHHHHHHHHHHHH
Q ss_conf             200011134566643
Q gi|254780750|r  530 SNLTRFTTLELIDLE  544 (920)
Q Consensus       530 ~~~~Rf~t~eL~~l~  544 (920)
                      .+.+||..|..-.+.
T Consensus       324 ~~~~~y~~P~~~~~l  338 (403)
T PRK04195        324 RGFTRYQPPSRIRLL  338 (403)
T ss_pred             CCCCCCCCCHHHHHH
T ss_conf             996457895698998


No 260
>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional
Probab=95.77  E-value=0.12  Score=30.63  Aligned_cols=33  Identities=24%  Similarity=0.226  Sum_probs=26.2

Q ss_pred             EEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHH
Q ss_conf             4434563587777664399996778440789999999
Q gi|254780750|r  635 IANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNA  671 (920)
Q Consensus       635 VpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqva  671 (920)
                      +=+||+|+.    ..+.++=|-|+|-+||||++|.+.
T Consensus        31 av~~Vsf~i----~~GEilgivGeSGsGKSTl~~~i~   63 (330)
T PRK09473         31 AVNDLNFSL----RAGETLGIVGESGSGKSQTAFALM   63 (330)
T ss_pred             EEECCEEEE----CCCCEEEEECCCCCHHHHHHHHHH
T ss_conf             866747688----899899998689877999999997


No 261
>smart00382 AAA ATPases associated with a variety of cellular activities. AAA - ATPases associated with a variety of cellular activities. This profile/alignment only detects a fraction of this vast family. The poorly conserved N-terminal helix is missing from the alignment.
Probab=95.73  E-value=0.0092  Score=39.08  Aligned_cols=90  Identities=20%  Similarity=0.175  Sum_probs=43.4

Q ss_pred             EEEEEECCCCCCHHHHHHHHHHHHHHHH-CCCCCCHHHCCCCCCCEEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHCCC
Q ss_conf             3999967784407899999999999997-198530353206822105676523766113853289999999999995899
Q gi|254780750|r  651 KLWLLTGPNMGGKSTFLRQNALIVIMAQ-MGSYVPASYAHIGIVDKLFSRVGSADNLASGRSTFMVEMIETASILNQATN  729 (920)
Q Consensus       651 ~~~iiTGpNmgGKSt~lRqval~vilAQ-iG~fVPA~~a~i~~~D~IftRiGa~D~l~~g~STF~vEm~e~~~IL~~at~  729 (920)
                      +..+|.||.-+||||.++.+|...-... .-.++-++...-......+..... ++  ...+.-+..+.   .++..|-.
T Consensus         3 ~~ill~G~~GsGKTtl~~~la~~~~~~~~~v~~~~~~~~~~~~~~~~~~~~~~-~~--~~~~~~~~~~~---~~~~~~~~   76 (148)
T smart00382        3 EVILIVGPPGSGKTTLARALARELGPPGGGVIYIDGEDILEEVLDQLLLIIVG-GK--KASGSGELRLR---LALALARK   76 (148)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHHHCCCCCCEEEEEHHHHHHHHHHHHHHHHHC-CC--CCCCCHHHHHH---HHHHHHHH
T ss_conf             78999999970299999999987266899689987599898889876530001-12--21051999999---99999984


Q ss_pred             --CCEEEEECCCCCCCHHH
Q ss_conf             --85699932588988056
Q gi|254780750|r  730 --QSFVILDEIGRGTATLD  746 (920)
Q Consensus       730 --~SLVllDElGrGTst~D  746 (920)
                        .+++++||+++=.....
T Consensus        77 ~~~~viiiDei~~~~~~~~   95 (148)
T smart00382       77 LKPDVLILDEITSLLDAEQ   95 (148)
T ss_pred             CCCCEEEEECCHHHCCCCC
T ss_conf             4998999827502147620


No 262
>KOG0060 consensus
Probab=95.71  E-value=0.085  Score=31.88  Aligned_cols=125  Identities=22%  Similarity=0.294  Sum_probs=59.8

Q ss_pred             CCCEEEEEECCCCCCHHHHHHHHHHHHHHHH-------CC-----CCCCHH-HCCCC-CCCEEEEEEECCCCCCCCCCHH
Q ss_conf             6643999967784407899999999999997-------19-----853035-32068-2210567652376611385328
Q gi|254780750|r  648 NSGKLWLLTGPNMGGKSTFLRQNALIVIMAQ-------MG-----SYVPAS-YAHIG-IVDKLFSRVGSADNLASGRSTF  713 (920)
Q Consensus       648 ~~~~~~iiTGpNmgGKSt~lRqval~vilAQ-------iG-----~fVPA~-~a~i~-~~D~IftRiGa~D~l~~g~STF  713 (920)
                      .+++-++|||||.+|||++||..|=+==.-+       -|     .|||-. ++.+| +-|+|.=-.++.|...++.|+=
T Consensus       459 ~~g~~LLItG~sG~GKtSLlRvlggLWp~~~G~l~k~~~~~~~~lfflPQrPYmt~GTLRdQvIYP~~~~~~~~~~~~d~  538 (659)
T KOG0060         459 PSGQNLLITGPSGCGKTSLLRVLGGLWPSTGGKLTKPTDGGPKDLFFLPQRPYMTLGTLRDQVIYPLKAEDMDSKSASDE  538 (659)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCEEEECCCCCCCCEEEECCCCCCCCCCHHHHEECCCCCCCCCCCCCCHH
T ss_conf             58975999789987636899998532516787276056788775588368877666544550332575322101377678


Q ss_pred             ----HHHHHHHHHHHHHC------------------------------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             ----99999999999958------------------------------99856999325889880567999999999999
Q gi|254780750|r  714 ----MVEMIETASILNQA------------------------------TNQSFVILDEIGRGTATLDGLSIAWATIEYLH  759 (920)
Q Consensus       714 ----~vEm~e~~~IL~~a------------------------------t~~SLVllDElGrGTst~DG~aiA~aile~l~  759 (920)
                          +.|-....+|+...                              .+--+.++||=   ||.-+ ...-.|+-+.+ 
T Consensus       539 ~i~r~Le~v~L~hl~~r~ggld~~~~~dW~dvLS~GEqQRLa~ARLfy~kPk~AiLDE~---TSAv~-~dvE~~~Yr~~-  613 (659)
T KOG0060         539 DILRILENVQLGHLLEREGGLDQQVDWDWMDVLSPGEQQRLAFARLFYHKPKFAILDEC---TSAVT-EDVEGALYRKC-  613 (659)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCCHHHCCHHHHCCHHHHHHHHHHHHHHCCCCEEEEECC---HHHCC-HHHHHHHHHHH-
T ss_conf             99999998545558998578882222057763698888899999998608836876030---22235-76799999999-


Q ss_pred             HHCCCEEEEECCCHHHHH
Q ss_conf             726984999748757976
Q gi|254780750|r  760 ETNRCRGLLATHFHELTD  777 (920)
Q Consensus       760 ~~~~~~~lfaTHy~eL~~  777 (920)
                      +..+-..+-.-|-..|..
T Consensus       614 r~~giT~iSVgHRkSL~k  631 (659)
T KOG0060         614 REMGITFISVGHRKSLWK  631 (659)
T ss_pred             HHCCCEEEEECCHHHHHH
T ss_conf             980976999635788986


No 263
>COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism]
Probab=95.58  E-value=0.013  Score=37.93  Aligned_cols=133  Identities=27%  Similarity=0.343  Sum_probs=76.2

Q ss_pred             EEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHH--------HHHHHHHCCCCCC-HHHCCCCCCC-----EEEEEE
Q ss_conf             4434563587777664399996778440789999999--------9999997198530-3532068221-----056765
Q gi|254780750|r  635 IANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNA--------LIVIMAQMGSYVP-ASYAHIGIVD-----KLFSRV  700 (920)
Q Consensus       635 VpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqva--------l~vilAQiG~fVP-A~~a~i~~~D-----~IftRi  700 (920)
                      .=||+++..    ..+.+.-|-|||-+||||+.--+.        -+.+-.+--.-.| .+-+++|++-     ++|..|
T Consensus        19 Al~~Vsl~v----~~Gei~~LIGPNGAGKTTlfNlitG~~~P~~G~v~~~G~~it~l~p~~iar~Gi~RTFQ~~rlF~~l   94 (250)
T COG0411          19 AVNDVSLEV----RPGEIVGLIGPNGAGKTTLFNLITGFYKPSSGTVIFRGRDITGLPPHRIARLGIARTFQITRLFPGL   94 (250)
T ss_pred             EEECEEEEE----CCCEEEEEECCCCCCCEEEEEEECCCCCCCCCEEEECCCCCCCCCHHHHHHCCCEEECCCCCCCCCC
T ss_conf             970414787----3872899988998882456653236405887369988803677888899862504632034126897


Q ss_pred             ECCCCCCCCCC-------H-----H---HHHHHHHH-HHHH----------------------------HCCCCCEEEEE
Q ss_conf             23766113853-------2-----8---99999999-9999----------------------------58998569993
Q gi|254780750|r  701 GSADNLASGRS-------T-----F---MVEMIETA-SILN----------------------------QATNQSFVILD  736 (920)
Q Consensus       701 Ga~D~l~~g~S-------T-----F---~vEm~e~~-~IL~----------------------------~at~~SLVllD  736 (920)
                      -.-||+.-|..       .     +   ..|..|-| .+|.                            -|+.--|+|||
T Consensus        95 TVlENv~va~~~~~~~~~~l~~~~~~~~e~~~~e~A~~~Le~vgL~~~a~~~A~~LsyG~qR~LEIArALa~~P~lLLLD  174 (250)
T COG0411          95 TVLENVAVGAHARLGLSGLLGRPRARKEEREARERARELLEFVGLGELADRPAGNLSYGQQRRLEIARALATQPKLLLLD  174 (250)
T ss_pred             CHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHCCCCHHHCCHHHCCCHHHHHHHHHHHHHHCCCCEEEEC
T ss_conf             38898998865311035440563100147999999999998739932533601028856768999999986699878856


Q ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCC
Q ss_conf             258898805679999999999997269849997487
Q gi|254780750|r  737 EIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHF  772 (920)
Q Consensus       737 ElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy  772 (920)
                      |--.|-++.+--.++. .+..+-+..+--.|..-|-
T Consensus       175 EPaAGln~~e~~~l~~-~i~~i~~~~g~tillIEHd  209 (250)
T COG0411         175 EPAAGLNPEETEELAE-LIRELRDRGGVTILLIEHD  209 (250)
T ss_pred             CCCCCCCHHHHHHHHH-HHHHHHHCCCCEEEEEEEC
T ss_conf             7657989899999999-9999885489689999742


No 264
>PRK10869 recombination and repair protein; Provisional
Probab=95.47  E-value=0.22  Score=28.77  Aligned_cols=112  Identities=16%  Similarity=0.262  Sum_probs=67.7

Q ss_pred             CCHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHC-CCEEEEECCCHHHHHHHHHCCCEEEE
Q ss_conf             53289999999999995899856999325889880567999999999999726-98499974875797664306885899
Q gi|254780750|r  710 RSTFMVEMIETASILNQATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETN-RCRGLLATHFHELTDLSKSLKRFHNA  788 (920)
Q Consensus       710 ~STF~vEm~e~~~IL~~at~~SLVllDElGrGTst~DG~aiA~aile~l~~~~-~~~~lfaTHy~eL~~l~~~~~~v~n~  788 (920)
                      .|-+|-=   ...++-....-.-+|+||+=.|.|-.-    |.+|-+.|.+.. .+=++..||.+.++..++.       
T Consensus       436 lSRimLA---lk~v~a~~~~~~tlIFDEID~GigG~~----a~~vg~~L~~ls~~~QVi~ITHlpQvAa~ad~-------  501 (553)
T PRK10869        436 LSRIALA---IQVITARKMETPALIFDEVDVGISGPT----AAVVGKLLRQLGESTQVMCVTHLPQVAGCGHQ-------  501 (553)
T ss_pred             HHHHHHH---HHHHHHCCCCCCEEEEECCCCCCCHHH----HHHHHHHHHHHHCCCEEEEECCHHHHHHCCCC-------
T ss_conf             9999999---999970579998289857888998799----99999999998529879998036999854487-------


Q ss_pred             EEEEE-EECCEEEEEEEEEECCCCCCHHHHHHHHCC---CCHHHHHHHHHHHH
Q ss_conf             99999-609927787777447898877899999829---99899999999999
Q gi|254780750|r  789 TLQVS-DSNEGIIFLHKVIPGIADHSYGIQVGKLAG---LPNTVISRAYDILK  837 (920)
Q Consensus       789 ~~~~~-~~~~~i~flykl~~G~~~~Sygi~vA~laG---~p~~vi~~A~~~~~  837 (920)
                      |+.|. +..++.|+. ++.+ ..+.-==-++|||.|   +-+.-++.|+++++
T Consensus       502 H~~V~K~~~~~~t~t-~i~~-L~~~eRv~EiARMlsG~~it~~al~~A~eLL~  552 (553)
T PRK10869        502 HMFVSKETDGGMTET-HMQP-LDKKARLQELARLLGGSEVTRNTLANAKELLA  552 (553)
T ss_pred             EEEEEEECCCCEEEE-EEEE-CCHHHHHHHHHHHHCCCCCCHHHHHHHHHHHC
T ss_conf             789999737982689-8788-98407999999984799876999999999865


No 265
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C.  This family is also known as MRP (mulrtidrug resisitance-associated protein).  Some of the MRP members have five additional transmembrane segments in their N-terminus, but the function of these additional membrane-spanning domains is not clear.  The MRP was found in the multidrug-resistance lung cancer cell in which p-glycoprotein was not overexpressed.  MRP exports glutathione by drug stimulation, as well as, certain substrates in conjugated forms with anions, such as glutathione, glucuronate, and sulfate.
Probab=95.43  E-value=0.024  Score=35.98  Aligned_cols=35  Identities=23%  Similarity=0.276  Sum_probs=27.4

Q ss_pred             CEEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHH
Q ss_conf             044434563587777664399996778440789999999
Q gi|254780750|r  633 PFIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNA  671 (920)
Q Consensus       633 ~fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqva  671 (920)
                      .+|=+|++|..    ..+.+..|.|||-+||||++|.+.
T Consensus        17 ~~vL~~isl~i----~~Ge~v~ivG~sGsGKSTLl~ll~   51 (221)
T cd03244          17 PPVLKNISFSI----KPGEKVGIVGRTGSGKSSLLLALF   51 (221)
T ss_pred             CCCEEEEEEEE----CCCCEEEEECCCCCCHHHHHHHHH
T ss_conf             75175448998----699899999999998999999996


No 266
>cd03275 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains.  Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins.  The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases.  The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences.  In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (for
Probab=95.42  E-value=0.23  Score=28.64  Aligned_cols=74  Identities=23%  Similarity=0.380  Sum_probs=45.9

Q ss_pred             CCCCCCCCHHHHHHHHHHHH--HHHCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHC--CCEEEEECCCHHHHHHH
Q ss_conf             66113853289999999999--995899856999325889880567999999999999726--98499974875797664
Q gi|254780750|r  704 DNLASGRSTFMVEMIETASI--LNQATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETN--RCRGLLATHFHELTDLS  779 (920)
Q Consensus       704 D~l~~g~STF~vEm~e~~~I--L~~at~~SLVllDElGrGTst~DG~aiA~aile~l~~~~--~~~~lfaTHy~eL~~l~  779 (920)
                      |+|+.|+-|.    .-+|.|  +...-|--+.+|||+   ..+.|..-+. -+..||.+..  .+-.++.||-..+-+.+
T Consensus       154 ~~LSGGEKtl----~alallFai~~~~PsPF~vLDEV---DAaLD~~Nv~-r~~~~i~~~~~~~~QfIvITh~~~~~~~A  225 (247)
T cd03275         154 DNLSGGEKTM----AALALLFAIHSYQPAPFFVLDEV---DAALDNTNVG-KVASYIREQAGPNFQFIVISLKEEFFSKA  225 (247)
T ss_pred             HHCCCCHHHH----HHHHHHHHHHCCCCCCEEEEECC---CCCCCHHHHH-HHHHHHHHHHCCCCEEEEEECCHHHHHHC
T ss_conf             3338208999----99999999971289955887067---6346889999-99999998725686799998888998630


Q ss_pred             HHCCCE
Q ss_conf             306885
Q gi|254780750|r  780 KSLKRF  785 (920)
Q Consensus       780 ~~~~~v  785 (920)
                      +.+=+|
T Consensus       226 d~L~GV  231 (247)
T cd03275         226 DALVGV  231 (247)
T ss_pred             CEEEEE
T ss_conf             018989


No 267
>PRK07952 DNA replication protein DnaC; Validated
Probab=95.41  E-value=0.16  Score=29.85  Aligned_cols=103  Identities=22%  Similarity=0.268  Sum_probs=61.1

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHCCCCCCCEEEEEEECCCCCCCCCCHHH-HHHHHHHHHHHHCCCC
Q ss_conf             999967784407899999999999997198530353206822105676523766113853289-9999999999958998
Q gi|254780750|r  652 LWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHIGIVDKLFSRVGSADNLASGRSTFM-VEMIETASILNQATNQ  730 (920)
Q Consensus       652 ~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a~i~~~D~IftRiGa~D~l~~g~STF~-vEm~e~~~IL~~at~~  730 (920)
                      -+|.+||-..|||.+-=.+|-..+  +-|-.|            +|+.+.  |=+.+=++||- -++.| ..+++....-
T Consensus        98 gLlF~G~~GTGKThLA~aIan~Li--~~G~sV------------lf~t~~--dLl~~lr~t~~~~~~~e-~~~l~~l~~~  160 (242)
T PRK07952         98 SFIFSGKPGTGKNHLAAAICNELL--LRGKSV------------LIITVA--DIMSAMKDTFRNSETSE-EQLLNDLSNV  160 (242)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHH--HCCCEE------------EEEEHH--HHHHHHHHHHHCCCCCH-HHHHHHHHCC
T ss_conf             179978999978999999999999--879949------------997799--99999999980687569-9999986318


Q ss_pred             CEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCC
Q ss_conf             569993258898805679999999999997269849997487
Q gi|254780750|r  731 SFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHF  772 (920)
Q Consensus       731 SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy  772 (920)
                      .|+||||||--..|..+..+-+.++..=....++ ++++|-+
T Consensus       161 dLLIiDdlG~e~~t~~~~~~lf~iId~Ry~~~kp-~IitTNl  201 (242)
T PRK07952        161 DLLVIDEIGVQTESRYEKVIINQIVDRRSSSKRP-TGMLTNS  201 (242)
T ss_pred             CEEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCC-EEEEECC
T ss_conf             9898730146658888999999999999971698-8998179


No 268
>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional
Probab=95.20  E-value=0.27  Score=28.17  Aligned_cols=47  Identities=17%  Similarity=0.212  Sum_probs=30.0

Q ss_pred             CCCCCEEEEECCCCCCCHHHHHHHHHHHHHH---HHHHCCCEEEEECCCHHHHH
Q ss_conf             8998569993258898805679999999999---99726984999748757976
Q gi|254780750|r  727 ATNQSFVILDEIGRGTATLDGLSIAWATIEY---LHETNRCRGLLATHFHELTD  777 (920)
Q Consensus       727 at~~SLVllDElGrGTst~DG~aiA~aile~---l~~~~~~~~lfaTHy~eL~~  777 (920)
                      +.+-.|+|+||-   ||..|- .+...|++-   |.+..+.-.||.||.-.+..
T Consensus       170 ~~~P~lLi~DEP---TsaLD~-~~q~~Il~ll~~l~~~~~~t~l~ITHDl~~v~  219 (327)
T PRK11308        170 MLDPDVVVADEP---VSALDV-SVQAQVLNLMMDLQQELGLSYVFISHDLSVVE  219 (327)
T ss_pred             HCCCCEEEEECC---CCCCCH-HHHHHHHHHHHHHHHHCCCEEEEECCCHHHHH
T ss_conf             428989998478---654699-99999999999999700976999869899999


No 269
>PRK12402 replication factor C small subunit 2; Reviewed
Probab=95.19  E-value=0.22  Score=28.76  Aligned_cols=104  Identities=19%  Similarity=0.291  Sum_probs=50.1

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHHHHHCCC-CCCHHHCCCCCCCEEEEEEECC----C---------CCCCCCCHHHHHHH
Q ss_conf             99967784407899999999999997198-5303532068221056765237----6---------61138532899999
Q gi|254780750|r  653 WLLTGPNMGGKSTFLRQNALIVIMAQMGS-YVPASYAHIGIVDKLFSRVGSA----D---------NLASGRSTFMVEMI  718 (920)
Q Consensus       653 ~iiTGpNmgGKSt~lRqval~vilAQiG~-fVPA~~a~i~~~D~IftRiGa~----D---------~l~~g~STF~vEm~  718 (920)
                      +|++||-..||+|..|-+|--     ++| .+.....++..-| .+.| |..    |         .-..|.|.    ..
T Consensus        39 lLf~GPpG~GKTt~A~~lA~~-----l~~~~~~~~~~~~nasd-~~~~-~~~~i~~~~~~~~~~~~~~~~~~~~----~d  107 (337)
T PRK12402         39 LVVYGPSGSGKTAAVRALARE-----LYGDPWENNFTYFNVSD-FFDQ-GKKYLVEDPRFAHFYDDPKRKYKSV----ID  107 (337)
T ss_pred             EEEECCCCCCHHHHHHHHHHH-----HCCCCCCCCCCEECCCC-CCCC-CCCEEECCCCHHHHHCCHHHCCCCH----HH
T ss_conf             988892984899999999999-----67997567833311653-1135-6400101664234420153327737----89


Q ss_pred             HHHHHHHH-C------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHH--CCCEEEEECCCH
Q ss_conf             99999995-8------9985699932588988056799999999999972--698499974875
Q gi|254780750|r  719 ETASILNQ-A------TNQSFVILDEIGRGTATLDGLSIAWATIEYLHET--NRCRGLLATHFH  773 (920)
Q Consensus       719 e~~~IL~~-a------t~~SLVllDElGrGTst~DG~aiA~aile~l~~~--~~~~~lfaTHy~  773 (920)
                      ....+++. |      ++.-+|||||..+-|..      |+..+..+++.  ..|+.+|+|.+.
T Consensus       108 ~i~~ii~~~a~~~p~~~~~KiiIlDEad~lt~~------Aq~aLlk~lEe~~~~~~fIl~t~~~  165 (337)
T PRK12402        108 NFKHILKEYASMRPLSADYKLILFDNAEALRED------AQQALRRIMERYSETCRFIFSTTQP  165 (337)
T ss_pred             HHHHHHHHHHCCCCCCCCEEEEEEECCCCCCHH------HHHHHHHHHHCCCCCEEEEEECCCC
T ss_conf             999999998614887788049997071317999------9999998874088766998723864


No 270
>PRK10261 glutathione transporter ATP-binding protein; Provisional
Probab=95.19  E-value=0.27  Score=28.15  Aligned_cols=47  Identities=21%  Similarity=0.139  Sum_probs=30.0

Q ss_pred             CCCCCEEEEECCCCCCCHHHHH--HHHHHHHHHHHHHCCCEEEEECCCHHHH
Q ss_conf             8998569993258898805679--9999999999972698499974875797
Q gi|254780750|r  727 ATNQSFVILDEIGRGTATLDGL--SIAWATIEYLHETNRCRGLLATHFHELT  776 (920)
Q Consensus       727 at~~SLVllDElGrGTst~DG~--aiA~aile~l~~~~~~~~lfaTHy~eL~  776 (920)
                      +..-.++|+||-   ||..|=.  |--+..+..|.+..+.-.||.||.-.+.
T Consensus       479 ~~~P~lLI~DEP---Ts~LDv~~qa~il~Ll~~L~~~~g~til~IsHDl~~v  527 (623)
T PRK10261        479 ALNPKVIIADEA---VSALDVSIRGQIINLLLDLQRDFGIAYLFISHDMAVV  527 (623)
T ss_pred             HHCCCEEEEECC---CCCCCHHHHHHHHHHHHHHHHHHCCEEEEECCCHHHH
T ss_conf             969999999688---6667999999999999999997298999986899999


No 271
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism]
Probab=95.14  E-value=0.052  Score=33.45  Aligned_cols=127  Identities=24%  Similarity=0.280  Sum_probs=63.8

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHHHHHCCCCC----CHH------HCCCCCCC------EEEEEEECCCCCCCCCCHHHHH
Q ss_conf             9996778440789999999999999719853----035------32068221------0567652376611385328999
Q gi|254780750|r  653 WLLTGPNMGGKSTFLRQNALIVIMAQMGSYV----PAS------YAHIGIVD------KLFSRVGSADNLASGRSTFMVE  716 (920)
Q Consensus       653 ~iiTGpNmgGKSt~lRqval~vilAQiG~fV----PA~------~a~i~~~D------~IftRiGa~D~l~~g~STF~vE  716 (920)
                      ..||||--.||||++.-++  --|.+-|+=|    ..+      .--+.++|      .+|++.|.+- ---|.=.--+|
T Consensus         8 i~ITG~PGvGKtTl~~ki~--e~L~~~g~kvgGf~t~EVR~gGkR~GF~Ivdl~tg~~~~la~~~~~~-~rvGkY~V~v~   84 (179)
T COG1618           8 IFITGRPGVGKTTLVLKIA--EKLREKGYKVGGFITPEVREGGKRIGFKIVDLATGEEGILARVGFSR-PRVGKYGVNVE   84 (179)
T ss_pred             EEEECCCCCCHHHHHHHHH--HHHHHCCCEEEEEEEEEEECCCEEEEEEEEECCCCCEEEEEECCCCC-CCCCEEEEEHH
T ss_conf             9986799845899999999--99985596651398311420882751599981479557988847887-62104786278


Q ss_pred             HHH--HHHHHHHCCCC-CEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCC---HHHHHHHHHCCCEE
Q ss_conf             999--99999958998-569993258898805679999999999997269849997487---57976643068858
Q gi|254780750|r  717 MIE--TASILNQATNQ-SFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHF---HELTDLSKSLKRFH  786 (920)
Q Consensus       717 m~e--~~~IL~~at~~-SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy---~eL~~l~~~~~~v~  786 (920)
                      -.|  ....|++|-.. -+||+||+|.=--..-.  . ...++..++..++ .+++-|-   |.+.+-......+.
T Consensus        85 ~le~i~~~al~rA~~~aDvIIIDEIGpMElks~~--f-~~~ve~vl~~~kp-liatlHrrsr~P~v~~ik~~~~v~  156 (179)
T COG1618          85 GLEEIAIPALRRALEEADVIIIDEIGPMELKSKK--F-REAVEEVLKSGKP-LIATLHRRSRHPLVQRIKKLGGVY  156 (179)
T ss_pred             HHHHHHHHHHHHHHHCCCEEEEECCCCHHHCCHH--H-HHHHHHHHCCCCC-EEEEEECCCCCHHHHHHHHCCCEE
T ss_conf             8899868999988634998999433633020088--9-9999999658993-799996256775899864248779


No 272
>COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism]
Probab=95.13  E-value=0.02  Score=36.52  Aligned_cols=40  Identities=33%  Similarity=0.552  Sum_probs=27.8

Q ss_pred             EEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHH
Q ss_conf             4434563587777664399996778440789999999999999719853035
Q gi|254780750|r  635 IANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPAS  686 (920)
Q Consensus       635 VpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~  686 (920)
                      +-+++++..    ..+-+.-|-|||-+||||+||..        +|-+-|..
T Consensus        16 ll~~vsl~~----~pGev~ailGPNGAGKSTlLk~L--------sGel~p~~   55 (259)
T COG4559          16 LLDGVSLDL----RPGEVLAILGPNGAGKSTLLKAL--------SGELSPDS   55 (259)
T ss_pred             ECCCCCEEC----CCCCEEEEECCCCCCHHHHHHHH--------HCCCCCCC
T ss_conf             104731541----68727999888986588899986--------17637888


No 273
>pfam05729 NACHT NACHT domain. This NTPase domain is found in apoptosis proteins as well as those involved in MHC transcription activation. This family is closely related to pfam00931.
Probab=95.10  E-value=0.18  Score=29.39  Aligned_cols=121  Identities=26%  Similarity=0.350  Sum_probs=56.8

Q ss_pred             EEEEEECCCCCCHHHHHHHHHHHHHHHHC------CCCCCHHHCC----CCCCCEEEEEEECCCCCCCCCCHHHHHHHHH
Q ss_conf             39999677844078999999999999971------9853035320----6822105676523766113853289999999
Q gi|254780750|r  651 KLWLLTGPNMGGKSTFLRQNALIVIMAQM------GSYVPASYAH----IGIVDKLFSRVGSADNLASGRSTFMVEMIET  720 (920)
Q Consensus       651 ~~~iiTGpNmgGKSt~lRqval~vilAQi------G~fVPA~~a~----i~~~D~IftRiGa~D~l~~g~STF~vEm~e~  720 (920)
                      |..+|.|+-..||||++|-+++....-+.      =-|+++....    .++.|-|+.--.        .+.  .+..|.
T Consensus         1 r~i~i~G~aG~GKTtll~kl~~~wa~g~~~~~~~~vf~~~~r~~~~~~~~sl~~ll~~~~~--------~~~--~~~~~~   70 (165)
T pfam05729         1 RTVILQGEAGSGKTTLLQKLALLWAQGKLPQDFDFVFFLPCRELSRSGEASLADLLFSQWP--------EPA--APVSEV   70 (165)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHCCCCCCCCCEEEEEEHHHHCCCCCCCHHHHHHHHCC--------CCC--CCHHHH
T ss_conf             9899982798989999999999998698436972899999567077766899999998767--------745--763789


Q ss_pred             -HHHHHHCCCCCEEEE---ECCCCCCCHHHHHHHHHHHHHHHHHH---CCCEEEEECCCHHHHHHHHHC
Q ss_conf             -999995899856999---32588988056799999999999972---698499974875797664306
Q gi|254780750|r  721 -ASILNQATNQSFVIL---DEIGRGTATLDGLSIAWATIEYLHET---NRCRGLLATHFHELTDLSKSL  782 (920)
Q Consensus       721 -~~IL~~at~~SLVll---DElGrGTst~DG~aiA~aile~l~~~---~~~~~lfaTHy~eL~~l~~~~  782 (920)
                       ..|+.+. .+-|+|+   ||+..--+..+...-....+..|++.   .+|+.+++|.-+...++...+
T Consensus        71 ~~~~~~~~-~k~L~ilDGlDE~~~~~~~~~~~~~~~~~l~~ll~~~~lp~~~vliTsRp~~~~~l~~~~  138 (165)
T pfam05729        71 WAVILELP-ERVLLILDGLDELASDLGQLDGPLPVLTLLSSLLRKKLLPGASLLLTSRPDALRDLRRGL  138 (165)
T ss_pred             HHHHHHCC-CCEEEEECCHHHHCCCCCCCCCCCCHHHHHHHHHHHCCCCCCEEEEEECCCHHHHHHHHC
T ss_conf             99998397-728999648455144435644457799999999841527886499996803798857764


No 274
>PRK06921 hypothetical protein; Provisional
Probab=95.08  E-value=0.26  Score=28.27  Aligned_cols=130  Identities=18%  Similarity=0.325  Sum_probs=73.5

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHHHCCC---CCCHHHCCCCCCCEEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHCC
Q ss_conf             999967784407899999999999997198---53035320682210567652376611385328999999999999589
Q gi|254780750|r  652 LWLLTGPNMGGKSTFLRQNALIVIMAQMGS---YVPASYAHIGIVDKLFSRVGSADNLASGRSTFMVEMIETASILNQAT  728 (920)
Q Consensus       652 ~~iiTGpNmgGKSt~lRqval~vilAQiG~---fVPA~~a~i~~~D~IftRiGa~D~l~~g~STF~vEm~e~~~IL~~at  728 (920)
                      -++++|+-..|| |+|=......+|-+.|-   |+|..        .+|..+-         -+|.. ..+.-..+++| 
T Consensus       118 ~l~f~G~~G~GK-ThLa~aIa~~Ll~~~~~~Vly~~~~--------~~~~~lk---------~~~~~-~~~~l~~~~~~-  177 (265)
T PRK06921        118 SIALLGQPGSGK-THLLTAAANELMRKKGVPVLYFPFV--------EGFGDLK---------DDFDL-LEAKLNRMKKV-  177 (265)
T ss_pred             CEEEECCCCCCH-HHHHHHHHHHHHHHCCCEEEEEEHH--------HHHHHHH---------HHHHH-HHHHHHHHHCC-
T ss_conf             279972898988-9999999999999629719998879--------9999999---------88888-99999986329-


Q ss_pred             CCCEEEEECC-----CCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCH--HHHHHHHHC-----CCEEEEEEEEEEEC
Q ss_conf             9856999325-----88988056799999999999972698499974875--797664306-----88589999999609
Q gi|254780750|r  729 NQSFVILDEI-----GRGTATLDGLSIAWATIEYLHETNRCRGLLATHFH--ELTDLSKSL-----KRFHNATLQVSDSN  796 (920)
Q Consensus       729 ~~SLVllDEl-----GrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~--eL~~l~~~~-----~~v~n~~~~~~~~~  796 (920)
                        .|.|||.|     |....|.=.....+.++.|=....+ .++++|-+.  +|.++.+..     ...+.+-+.+.  +
T Consensus       178 --dlLIIDDLfk~~~G~e~~te~~~~~lf~iIN~Ry~~~k-ptIiSSNl~~~~L~~i~e~i~SRi~emc~~~~v~~~--G  252 (265)
T PRK06921        178 --EVLFIDDLFKPVNGKPRATEWQIEQTYSVVNYRYLNHK-PILISSELTIDELLDIDEALGSRIVEMCKDYLVIIN--G  252 (265)
T ss_pred             --CEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCC-CEEEECCCCHHHHHHHHHHHHHHHHHHCCCCEEEEE--C
T ss_conf             --99998221223479878988999999999999997699-989986899899987637988889997257489996--7


Q ss_pred             CEEEEEEEEE
Q ss_conf             9277877774
Q gi|254780750|r  797 EGIIFLHKVI  806 (920)
Q Consensus       797 ~~i~flykl~  806 (920)
                      ++.-..|||.
T Consensus       253 ~~~~ln~rl~  262 (265)
T PRK06921        253 DSFLLNHRLE  262 (265)
T ss_pred             CHHHHHHHHC
T ss_conf             4113433421


No 275
>cd00984 DnaB_C DnaB helicase C terminal domain. The hexameric helicase DnaB unwinds the DNA duplex at the  chromosome replication fork. Although the mechanism by which DnaB both couples ATP hydrolysis to translocation along DNA and denatures the duplex is unknown, a change in the quaternary structure of the protein involving dimerization of the N-terminal domain has been observed and may occur during the enzymatic cycle. This C-terminal domain contains an ATP-binding site and is therefore probably the site of ATP hydrolysis.
Probab=94.89  E-value=0.18  Score=29.46  Aligned_cols=42  Identities=19%  Similarity=0.169  Sum_probs=30.0

Q ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHCCCC
Q ss_conf             6439999677844078999999999999971985303532068
Q gi|254780750|r  649 SGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHIG  691 (920)
Q Consensus       649 ~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a~i~  691 (920)
                      .+.+++|+|+--.|||||+.++|+.... +-|-.|--=+.+++
T Consensus        12 ~G~L~vi~a~~g~GKS~~~~~la~~~a~-~~g~~V~~~SlEm~   53 (242)
T cd00984          12 PGDLIIIAARPSMGKTAFALNIAENIAK-KQGKPVLFFSLEMS   53 (242)
T ss_pred             CCCEEEEEECCCCCHHHHHHHHHHHHHH-HCCCCEEEEECCCC
T ss_conf             9818999968999999999999999999-77995999933353


No 276
>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional
Probab=94.87  E-value=0.08  Score=32.07  Aligned_cols=33  Identities=24%  Similarity=0.424  Sum_probs=24.5

Q ss_pred             EEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHH
Q ss_conf             4434563587777664399996778440789999999
Q gi|254780750|r  635 IANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNA  671 (920)
Q Consensus       635 VpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqva  671 (920)
                      |=+|+++..    ..+...-|.||+.+||||+++-+.
T Consensus       330 vL~~isl~I----~~Ge~vaIVG~SGsGKSTLl~LL~  362 (569)
T PRK10789        330 ALENVNFTL----KPGQMLGICGPTGSGKSTLLSLIQ  362 (569)
T ss_pred             HHCCCCCEE----CCCCEEEEECCCCCCHHHHHHHHH
T ss_conf             230765688----899789987999998799999999


No 277
>cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends. They cleave ends sealed by hairpin structures and are thought to play a role in removing protein bound to DNA termini.
Probab=94.74  E-value=0.052  Score=33.45  Aligned_cols=35  Identities=29%  Similarity=0.445  Sum_probs=24.9

Q ss_pred             EEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             34563587777664399996778440789999999999
Q gi|254780750|r  637 NDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIV  674 (920)
Q Consensus       637 Ndi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~v  674 (920)
                      +.|.++.   .++..+.+|+|||.+||||.+-.+..+-
T Consensus        18 ~~IDF~~---~~~~~lflI~G~nGsGKSTIlDAI~~aL   52 (213)
T cd03279          18 QVIDFTG---LDNNGLFLICGPTGAGKSTILDAITYAL   52 (213)
T ss_pred             EEEECCC---CCCCCEEEEECCCCCCHHHHHHHHHHHH
T ss_conf             1784876---7878889998899997889999999998


No 278
>PRK03918 chromosome segregation protein; Provisional
Probab=94.67  E-value=0.033  Score=34.91  Aligned_cols=71  Identities=24%  Similarity=0.236  Sum_probs=41.9

Q ss_pred             CCCCCCCCHHHHHHH---HHHHHHHHCCCCCEEEEECCCCCCCHHHHHHH--HHHHHHHHHHHCCCEEEEECCCHHHHHH
Q ss_conf             661138532899999---99999995899856999325889880567999--9999999997269849997487579766
Q gi|254780750|r  704 DNLASGRSTFMVEMI---ETASILNQATNQSFVILDEIGRGTATLDGLSI--AWATIEYLHETNRCRGLLATHFHELTDL  778 (920)
Q Consensus       704 D~l~~g~STF~vEm~---e~~~IL~~at~~SLVllDElGrGTst~DG~ai--A~aile~l~~~~~~~~lfaTHy~eL~~l  778 (920)
                      +.|+.|.+ |++=+.   -.+..+  +.+-.+++|||.   |.+.|-..+  +.-+++.+... +..+++.||-.+|.+.
T Consensus       790 ~~LSGGE~-~~~aLAL~Lals~~~--~~~~~~lflDEg---fg~LD~~~~~~~~~~L~~l~~~-~~qi~IISH~~el~~~  862 (882)
T PRK03918        790 GFLSGGER-IALGLAFRLALSMYL--AGEISLLILDEP---TPFLDEERRRKLVDIMERYLRK-IPQVIIVSHDEELKDA  862 (882)
T ss_pred             CCCCHHHH-HHHHHHHHHHHHHHH--HCCCCEEEEECC---CCCCCHHHHHHHHHHHHHHHCC-CCEEEEEECHHHHHHH
T ss_conf             77888899-999999999999987--149994998799---7887989999999999998658-9989999575789986


Q ss_pred             HHH
Q ss_conf             430
Q gi|254780750|r  779 SKS  781 (920)
Q Consensus       779 ~~~  781 (920)
                      .+.
T Consensus       863 ~d~  865 (882)
T PRK03918        863 ADH  865 (882)
T ss_pred             CCC
T ss_conf             796


No 279
>cd01120 RecA-like_NTPases RecA-like NTPases. This family includes the NTP binding domain of F1 and V1 H+ATPases, DnaB and related helicases as well as bacterial RecA and related eukaryotic and archaeal recombinases. This group also includes bacterial conjugation proteins and related DNA transfer proteins involved in type II and type IV secretion.
Probab=94.61  E-value=0.05  Score=33.56  Aligned_cols=86  Identities=27%  Similarity=0.339  Sum_probs=46.5

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHHH-HHCCCCCCHHHCCCCCCCEE--EEEEECCCCCC----CCCCHHHHHHHHHHHHHH
Q ss_conf             999677844078999999999999-97198530353206822105--67652376611----385328999999999999
Q gi|254780750|r  653 WLLTGPNMGGKSTFLRQNALIVIM-AQMGSYVPASYAHIGIVDKL--FSRVGSADNLA----SGRSTFMVEMIETASILN  725 (920)
Q Consensus       653 ~iiTGpNmgGKSt~lRqval~vil-AQiG~fVPA~~a~i~~~D~I--ftRiGa~D~l~----~g~STF~vEm~e~~~IL~  725 (920)
                      .+|+||-..||||++.|++..+.- .....||-.+...-.++.++  +..-++.+++.    ..-.+......+.+..+.
T Consensus         2 ~li~g~~g~GKttl~~~~~~~~~~~~~~~~~~~~ee~~~q~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   81 (165)
T cd01120           2 ILVFGPTGSGKTTLALQLALNIATKGGKVVYVDIEEEIEELTERLIGESLKGALDNLIIVFATADDPAAARLLSKAERLR   81 (165)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHHHCCCCCCEEEEEECCCCCCHHHHHHHHHHHHH
T ss_conf             89998999989999999999987639979999866644899999998622467130799935999769999999999999


Q ss_pred             HCCCCCEEEEECC
Q ss_conf             5899856999325
Q gi|254780750|r  726 QATNQSFVILDEI  738 (920)
Q Consensus       726 ~at~~SLVllDEl  738 (920)
                      ......||++|.+
T Consensus        82 ~~~~~vliiiDSi   94 (165)
T cd01120          82 ERGGDDLIILDEL   94 (165)
T ss_pred             HCCCCEEEEEECH
T ss_conf             8699779999288


No 280
>pfam00004 AAA ATPase family associated with various cellular activities (AAA). AAA family proteins often perform chaperone-like functions that assist in the assembly, operation, or disassembly of protein complexes.
Probab=94.56  E-value=0.38  Score=27.00  Aligned_cols=103  Identities=20%  Similarity=0.220  Sum_probs=49.0

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHCCCCCCCEEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHC--CCC
Q ss_conf             999677844078999999999999971985303532068221056765237661138532899999999999958--998
Q gi|254780750|r  653 WLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHIGIVDKLFSRVGSADNLASGRSTFMVEMIETASILNQA--TNQ  730 (920)
Q Consensus       653 ~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a~i~~~D~IftRiGa~D~l~~g~STF~vEm~e~~~IL~~a--t~~  730 (920)
                      +++.||--.|||++.|.+|     .++|..+    .++..-|-+-.        ..|.+.     ..+..+++.|  ...
T Consensus         1 iLl~GppGtGKT~~a~~la-----~~~~~~~----~~v~~~~~~~~--------~~g~~~-----~~i~~~f~~a~~~~p   58 (131)
T pfam00004         1 LLLYGPPGTGKTTLAKAVA-----KELGAPF----IEISGSELVSK--------YVGESE-----KRLRELFEAAKKLAP   58 (131)
T ss_pred             CEEECCCCCCHHHHHHHHH-----HHHCCCC----EECCCCCCCCC--------CCCHHH-----HHHHHHHHHHHHCCC
T ss_conf             9878999999999999999-----9978985----33242012223--------345068-----889999999997499


Q ss_pred             CEEEEECCC----CCCCHHH--HHHHHHHHHHHHHHH----CCCEEEEECCCHHHHH
Q ss_conf             569993258----8988056--799999999999972----6984999748757976
Q gi|254780750|r  731 SFVILDEIG----RGTATLD--GLSIAWATIEYLHET----NRCRGLLATHFHELTD  777 (920)
Q Consensus       731 SLVllDElG----rGTst~D--G~aiA~aile~l~~~----~~~~~lfaTHy~eL~~  777 (920)
                      +.+++||+-    +...+.+  +..+..+.+..+-..    .+...+.+|.+.+.-+
T Consensus        59 ~Il~iDe~d~l~~~~~~~~~~~~~~~~~~ll~~ld~~~~~~~~v~~I~tTN~~~~ld  115 (131)
T pfam00004        59 CVIFIDEIDALAGSRGSGGDSESRRVVNQLLTELDGFTSSLSKVIVIAATNRPDKLD  115 (131)
T ss_pred             CEEEECHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEEEECCCHHHCC
T ss_conf             189831167775167888887513268789999850224688769999759904499


No 281
>PRK06835 DNA replication protein DnaC; Validated
Probab=94.47  E-value=0.4  Score=26.85  Aligned_cols=102  Identities=16%  Similarity=0.156  Sum_probs=56.4

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHHHCCCCC---CHHHCCCCCCCEEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHCC
Q ss_conf             99996778440789999999999999719853---035320682210567652376611385328999999999999589
Q gi|254780750|r  652 LWLLTGPNMGGKSTFLRQNALIVIMAQMGSYV---PASYAHIGIVDKLFSRVGSADNLASGRSTFMVEMIETASILNQAT  728 (920)
Q Consensus       652 ~~iiTGpNmgGKSt~lRqval~vilAQiG~fV---PA~~a~i~~~D~IftRiGa~D~l~~g~STF~vEm~e~~~IL~~at  728 (920)
                      =++++||-..|||-+.=.+|-.++-  -|--|   .|..    +++.|    -.  .-+.+...    ..+.-..+.+|.
T Consensus       185 nLlf~G~~G~GKTfLa~~IA~ell~--~g~sViy~ta~~----L~~~l----~~--~~~~~~~~----~~~~~~~l~~~D  248 (330)
T PRK06835        185 NLLFYGNTGTGKTFLSNCIAKELLD--RGKTVIYRTSDE----LIENL----RE--IRFNNDND----APELEDLLINCD  248 (330)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHHHH--CCCEEEEEEHHH----HHHHH----HH--HHCCCCCC----HHHHHHHHHHCC
T ss_conf             6698899999889999999999998--799499962999----99999----99--75457644----899999996189


Q ss_pred             CCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCH
Q ss_conf             985699932588988056799999999999972698499974875
Q gi|254780750|r  729 NQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFH  773 (920)
Q Consensus       729 ~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~  773 (920)
                         |.|||+||--..|.=..+.-+-++.+-... +..|+++|-+.
T Consensus       249 ---LLIIDDLG~E~~t~~~~~~Lf~iIN~R~~~-~k~tIITTNl~  289 (330)
T PRK06835        249 ---LLIIDDLGTESITEFSKTELFNLINKRLLM-NKKMIISTNLS  289 (330)
T ss_pred             ---EEEEECCCCCCCCHHHHHHHHHHHHHHHHC-CCCEEEECCCC
T ss_conf             ---899721034558868999999999999867-99979988999


No 282
>PRK13342 recombination factor protein RarA; Reviewed
Probab=94.41  E-value=0.41  Score=26.76  Aligned_cols=13  Identities=15%  Similarity=0.243  Sum_probs=4.8

Q ss_pred             HHHHHHHHHHHHH
Q ss_conf             1113456664334
Q gi|254780750|r  534 RFTTLELIDLENR  546 (920)
Q Consensus       534 Rf~t~eL~~l~~~  546 (920)
                      +|..|.-...+.+
T Consensus       393 ~fY~p~~~g~E~~  405 (417)
T PRK13342        393 RYYEPTERGFEKK  405 (417)
T ss_pred             EEECCCCCCHHHH
T ss_conf             4558999718999


No 283
>COG0497 RecN ATPase involved in DNA repair [DNA replication, recombination, and repair]
Probab=94.36  E-value=0.42  Score=26.69  Aligned_cols=113  Identities=19%  Similarity=0.312  Sum_probs=64.3

Q ss_pred             CCHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHC-CCEEEEECCCHHHHHHHHHCCCEEEE
Q ss_conf             53289999999999995899856999325889880567999999999999726-98499974875797664306885899
Q gi|254780750|r  710 RSTFMVEMIETASILNQATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETN-RCRGLLATHFHELTDLSKSLKRFHNA  788 (920)
Q Consensus       710 ~STF~vEm~e~~~IL~~at~~SLVllDElGrGTst~DG~aiA~aile~l~~~~-~~~~lfaTHy~eL~~l~~~~~~v~n~  788 (920)
                      .|-||.   -.+.|+.....---+|+||+--|-|-    +.|.+|-+.|..-. ++-+|..||.+.++.+++.       
T Consensus       437 LSRimL---Alk~i~~~~~~~ptlIFDEVD~GIsG----~~A~aVg~~L~~Ls~~~QVl~VTHlPQVAa~ad~-------  502 (557)
T COG0497         437 LSRIML---ALKVILSRKDDTPTLIFDEVDTGISG----RVAQAVGKKLRRLSEHHQVLCVTHLPQVAAMADT-------  502 (557)
T ss_pred             HHHHHH---HHHHHHHCCCCCCEEEEECCCCCCCH----HHHHHHHHHHHHHHCCCEEEEEECHHHHHHHHCC-------
T ss_conf             999999---99999716689985997464579975----9999999999998369649999357878752025-------


Q ss_pred             EEEEEE-ECCEEEEEEEEEECCCCCCHHHHHHHHCC---CCHHHHHHHHHHHHH
Q ss_conf             999996-09927787777447898877899999829---998999999999999
Q gi|254780750|r  789 TLQVSD-SNEGIIFLHKVIPGIADHSYGIQVGKLAG---LPNTVISRAYDILKT  838 (920)
Q Consensus       789 ~~~~~~-~~~~i~flykl~~G~~~~Sygi~vA~laG---~p~~vi~~A~~~~~~  838 (920)
                      |+-|.. ..++.|-. ++++= ...-===++|||.|   +-+..+..|+++++.
T Consensus       503 H~~V~K~~~~~~T~s-~V~~L-~~eeRveEiARMl~G~~iT~~a~a~AkeLL~~  554 (557)
T COG0497         503 HFLVEKESEDGRTES-RVRPL-DKEERVEEIARMLGGSEVTDEALAHAKELLAA  554 (557)
T ss_pred             EEEEEEECCCCCEEE-EEEEC-CHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHH
T ss_conf             589997247882677-63538-87678999999856843149999999999975


No 284
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism]
Probab=94.36  E-value=0.067  Score=32.62  Aligned_cols=136  Identities=25%  Similarity=0.262  Sum_probs=74.2

Q ss_pred             CEEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHH--------HCCCCCCHHHCCCCCCC---EEEEEEE
Q ss_conf             044434563587777664399996778440789999999999999--------71985303532068221---0567652
Q gi|254780750|r  633 PFIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMA--------QMGSYVPASYAHIGIVD---KLFSRVG  701 (920)
Q Consensus       633 ~fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilA--------QiG~fVPA~~a~i~~~D---~IftRiG  701 (920)
                      ..+=.|++|+.    ..+-|.-+=||.-+||||+||.+|=..--.        +-=.-||+..=.++.|=   .+|--|-
T Consensus        18 ~~al~~isl~i----~~Gef~tlLGPSGcGKTTlLR~IAGfe~p~~G~I~l~g~~i~~lpp~kR~ig~VFQ~YALFPHmt   93 (352)
T COG3842          18 FTAVDDISLDI----KKGEFVTLLGPSGCGKTTLLRMIAGFEQPSSGEILLDGEDITDVPPEKRPIGMVFQSYALFPHMT   93 (352)
T ss_pred             EEEEECCEEEE----CCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCEEEECCEECCCCCHHHCCCCEEECCCCCCCCCC
T ss_conf             26773214454----48868999899888889999999677788886599999998889942265232606766688885


Q ss_pred             CCCCCCCCCC-------H----HHHHHHHHHHH--------------------HH--HCCCCCEEEEECCCCCCCHHH--
Q ss_conf             3766113853-------2----89999999999--------------------99--589985699932588988056--
Q gi|254780750|r  702 SADNLASGRS-------T----FMVEMIETASI--------------------LN--QATNQSFVILDEIGRGTATLD--  746 (920)
Q Consensus       702 a~D~l~~g~S-------T----F~vEm~e~~~I--------------------L~--~at~~SLVllDElGrGTst~D--  746 (920)
                      -.||+.=|+.       .    ...||.+.-.+                    |-  -+.+-.+.|+||--   |..|  
T Consensus        94 V~~NVafGLk~~~~~~~~ei~~rV~e~L~lV~L~~~~~R~p~qLSGGQqQRVALARAL~~~P~vLLLDEPl---SaLD~k  170 (352)
T COG3842          94 VEENVAFGLKVRKKLKKAEIKARVEEALELVGLEGFADRKPHQLSGGQQQRVALARALVPEPKVLLLDEPL---SALDAK  170 (352)
T ss_pred             HHHHHHHHHHHCCCCCHHHHHHHHHHHHHHCCCHHHHHHCHHHHCHHHHHHHHHHHHHHCCCCHHHHCCCC---CCHHHH
T ss_conf             89975533310577877899999999998748544444276664827899999999742183544342740---023189


Q ss_pred             -HHHHHHHHHHHHHHHCCCEEEEECCCHHHH
Q ss_conf             -799999999999972698499974875797
Q gi|254780750|r  747 -GLSIAWATIEYLHETNRCRGLLATHFHELT  776 (920)
Q Consensus       747 -G~aiA~aile~l~~~~~~~~lfaTHy~eL~  776 (920)
                       ...+ ..-+..+++..+-.++|.||.++=+
T Consensus       171 LR~~m-r~Elk~lq~~~giT~i~VTHDqeEA  200 (352)
T COG3842         171 LREQM-RKELKELQRELGITFVYVTHDQEEA  200 (352)
T ss_pred             HHHHH-HHHHHHHHHHCCCEEEEEECCHHHH
T ss_conf             99999-9999999985597299997898998


No 285
>COG3950 Predicted ATP-binding protein involved in virulence [General function prediction only]
Probab=94.09  E-value=0.066  Score=32.70  Aligned_cols=38  Identities=18%  Similarity=0.057  Sum_probs=17.5

Q ss_pred             CEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCC-EEEEECCC
Q ss_conf             5699932588988056799999999999972698-49997487
Q gi|254780750|r  731 SFVILDEIGRGTATLDGLSIAWATIEYLHETNRC-RGLLATHF  772 (920)
Q Consensus       731 SLVllDElGrGTst~DG~aiA~aile~l~~~~~~-~~lfaTHy  772 (920)
                      -.||+||+-=--.|.    --.-|++.|...-.. ..+.+||-
T Consensus       297 givLiDeIdlflhP~----WQQqi~qkL~saFp~IQfIvstHs  335 (440)
T COG3950         297 GIVLIDEIDLFLHPK----WQQQINQKLLSAFPEIQFIVSTHS  335 (440)
T ss_pred             CEEEEEHHHHHCCHH----HHHHHHHHHHHHCHHHHHHHHCCC
T ss_conf             669742201102888----999999999864434500233388


No 286
>TIGR00618 sbcc exonuclease SbcC; InterPro: IPR004592 All proteins in this family for which functions are known are part of an exonuclease complex with sbcD homologs. This complex is involved in the initiation of recombination to regulate the levels of palindromic sequences in DNA. SbcC may have nuclease activity that is functionally related to one of the nuclease activities of the RecBCD enzyme (IPR004586 from INTERPRO).; GO: 0004527 exonuclease activity, 0006259 DNA metabolic process.
Probab=94.09  E-value=0.056  Score=33.21  Aligned_cols=72  Identities=24%  Similarity=0.321  Sum_probs=48.2

Q ss_pred             CCCCCCCHHHHHHH---HHHHHHH--HCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHH
Q ss_conf             61138532899999---9999999--58998569993258898805679999999999997269849997487579766
Q gi|254780750|r  705 NLASGRSTFMVEMI---ETASILN--QATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFHELTDL  778 (920)
Q Consensus       705 ~l~~g~STF~vEm~---e~~~IL~--~at~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~~l  778 (920)
                      .++.|. ||||-++   -+|..|.  +.|.=-+.+||| |-||=-.||.-=|.++|+.|-....|..=++.|-|++.+-
T Consensus       970 tlSGGE-~Fl~slSlaLAladl~~~~~~~~L~sLfiDE-GFGslD~~~~d~~~~~L~ai~~~~~~~iGv~SHv~~~~er 1046 (1063)
T TIGR00618       970 TLSGGE-TFLASLSLALALADLLSQRGGTALDSLFIDE-GFGSLDEDSLDRAVEILDAIKEDVAKMIGVISHVPEFRER 1046 (1063)
T ss_pred             CCCCHH-HHHHHHHHHHHHHHHHHHCCCHHHHHHHHCC-CCCCCCHHHHHHHHHHHHHHHHCCCCEEEEECCHHHHHHH
T ss_conf             344179-9999999999999998630551335543205-7777777789899999999884489558654075889742


No 287
>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein; InterPro: IPR005666   ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs.   ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain .    The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , .   The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , .   Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1).     These proteins are involved in the transmembrane transport of sulphate and thiosulphate.; GO: 0042626 ATPase activity coupled to transmembrane movement of substances, 0006810 transport, 0016020 membrane.
Probab=94.08  E-value=0.065  Score=32.72  Aligned_cols=149  Identities=27%  Similarity=0.378  Sum_probs=80.5

Q ss_pred             EEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHH--------HHHHHCCCCCCHHHCCCCCCC---EEEEEEECC
Q ss_conf             443456358777766439999677844078999999999--------999971985303532068221---056765237
Q gi|254780750|r  635 IANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALI--------VIMAQMGSYVPASYAHIGIVD---KLFSRVGSA  703 (920)
Q Consensus       635 VpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~--------vilAQiG~fVPA~~a~i~~~D---~IftRiGa~  703 (920)
                      +=+||+|..    .++++.=+=||--|||||+||.+|=+        .|--|=-+-+++..=.||-|=   .+|--+--.
T Consensus        15 al~~v~l~v----~~G~lvaLLGPSGSGKsTLLR~iAGLe~pd~G~I~~~G~D~t~~~~~~R~iGFVFQ~YAlF~HlTv~   90 (241)
T TIGR00968        15 ALDDVDLEV----PTGSLVALLGPSGSGKSTLLRVIAGLEQPDSGRIILNGRDATRVKLRDREIGFVFQHYALFKHLTVR   90 (241)
T ss_pred             EEEEEEEEE----CCCEEEEEECCCCCCHHHHHHHHHCCCCCCCCEEEEEECCCCCCCCCCCCCCEEEEHHHHCCCCCHH
T ss_conf             753455574----3852798546898737899999835799984269985200221320136212277001312565111


Q ss_pred             CCCCCCCCHH-----------------HHHHHHHHHH-----------------HH--HCCCCCEEEEECCCCCCCHHHH
Q ss_conf             6611385328-----------------9999999999-----------------99--5899856999325889880567
Q gi|254780750|r  704 DNLASGRSTF-----------------MVEMIETASI-----------------LN--QATNQSFVILDEIGRGTATLDG  747 (920)
Q Consensus       704 D~l~~g~STF-----------------~vEm~e~~~I-----------------L~--~at~~SLVllDElGrGTst~DG  747 (920)
                      |||+=|..-=                 ..+|.+.+..                 |-  -|-+-...||||-.-   ..|.
T Consensus        91 ~NiAFGL~~~p~~~k~~~~~~k~~V~~LL~lvqL~~l~~rYP~QLSGGQrQRvALARALAv~P~vLLLDEPFg---ALDA  167 (241)
T TIGR00968        91 DNIAFGLEIRPRREKHPKAKIKARVEELLELVQLEGLGDRYPNQLSGGQRQRVALARALAVEPQVLLLDEPFG---ALDA  167 (241)
T ss_pred             HHHCCCCEEECCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCCCEEEEECCHH---HHHH
T ss_conf             0100142230210267578899999999998746544312742035733789999988633981576208714---5428


Q ss_pred             ---HHHHHHHHHHHHHHCCCEEEEECCCH-HHHHHHHHCCCEEEEEEE
Q ss_conf             ---99999999999972698499974875-797664306885899999
Q gi|254780750|r  748 ---LSIAWATIEYLHETNRCRGLLATHFH-ELTDLSKSLKRFHNATLQ  791 (920)
Q Consensus       748 ---~aiA~aile~l~~~~~~~~lfaTHy~-eL~~l~~~~~~v~n~~~~  791 (920)
                         --+ .+=|..||+.+.-.++|.||.. |=.+.++..--+.+..++
T Consensus       168 kvRk~L-R~WLR~LH~e~~~T~VfVTHD~~EA~evAd~ivv~~~G~i~  214 (241)
T TIGR00968       168 KVRKEL-RAWLRKLHDEVHVTTVFVTHDQEEAMEVADRIVVLSNGKIE  214 (241)
T ss_pred             HHHHHH-HHHHHHHCCEEEEEEEEEECCHHHHHHHHHHHHHHCCCCEE
T ss_conf             999999-99998740305677999862858998887440132178278


No 288
>KOG0922 consensus
Probab=94.04  E-value=0.048  Score=33.71  Aligned_cols=29  Identities=7%  Similarity=0.086  Sum_probs=19.9

Q ss_pred             CCCCHHHHHHHHHHHHHCCCEEEEEEECC
Q ss_conf             65617669999999998898599995028
Q gi|254780750|r   84 CGVPVHTANHYIQKLIKIGHRIAICEQIE  112 (920)
Q Consensus        84 aGvP~~~l~~yl~~Lv~~GykVaiveQ~E  112 (920)
                      -+.|.......+=..|+..--+.|+-.|.
T Consensus        48 ~~LPI~~~r~~il~~ve~nqvlIviGeTG   76 (674)
T KOG0922          48 ESLPIYKYRDQILYAVEDNQVLIVIGETG   76 (674)
T ss_pred             CCCCHHHHHHHHHHHHHHCCEEEEECCCC
T ss_conf             15998999999999998787799984898


No 289
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional
Probab=93.98  E-value=0.062  Score=32.87  Aligned_cols=33  Identities=27%  Similarity=0.481  Sum_probs=23.3

Q ss_pred             EEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHH
Q ss_conf             4345635877776643999967784407899999999
Q gi|254780750|r  636 ANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNAL  672 (920)
Q Consensus       636 pNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval  672 (920)
                      =+|++|..    ..+.+..|-||.-+||||+||.++=
T Consensus        44 v~dVsl~I----~~GEi~~ivG~SGsGKSTLlr~i~g   76 (400)
T PRK10070         44 VKDASLAI----EEGEIFVIMGLSGSGKSTMVRLLNR   76 (400)
T ss_pred             EECCEEEE----CCCCEEEEECCCCCHHHHHHHHHHC
T ss_conf             97407688----7999999999998469999999975


No 290
>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD. This model describes the DndB protein encoded by an operon associated with a sulfur-containing modification to DNA. The operon is sporadically distributed in bacteria, much like some restriction enzyme operons. DndD is described as a putative ATPase. The small number of examples known so far include species from among the Firmicutes, Actinomycetes, Proteobacteria, and Cyanobacteria.
Probab=93.93  E-value=0.1  Score=31.34  Aligned_cols=36  Identities=17%  Similarity=0.126  Sum_probs=21.1

Q ss_pred             HCCEEECCCCCCCCCCCC--------------CCCCHHHHHHHHHHHHHC
Q ss_conf             181891078899888762--------------656176699999999988
Q gi|254780750|r   66 LGITLTKRGKHLGKDIPM--------------CGVPVHTANHYIQKLIKI  101 (920)
Q Consensus        66 L~i~lt~r~~~~~~~~pm--------------aGvP~~~l~~yl~~Lv~~  101 (920)
                      =+|+|....++.|+..-|              -+-+....+.|+..+++.
T Consensus        28 k~i~li~G~NG~GKTTll~Ai~~~LYG~~~~~~~~~~~~y~~~~~~~~n~   77 (650)
T TIGR03185        28 KPIILIGGLNGAGKTTLLDAIQLGLYGKRAYCSKRGNQSYEQYLHGYINR   77 (650)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHC
T ss_conf             98799977999978999999999956951003454544699999998612


No 291
>COG4138 BtuD ABC-type cobalamin transport system, ATPase component [Coenzyme metabolism]
Probab=93.89  E-value=0.51  Score=26.03  Aligned_cols=22  Identities=45%  Similarity=0.755  Sum_probs=17.3

Q ss_pred             CCCEEEEEECCCCCCHHHHHHH
Q ss_conf             6643999967784407899999
Q gi|254780750|r  648 NSGKLWLLTGPNMGGKSTFLRQ  669 (920)
Q Consensus       648 ~~~~~~iiTGpNmgGKSt~lRq  669 (920)
                      ..+-++-+-|||.+||||+|-.
T Consensus        23 ~aGe~~HliGPNGaGKSTLLA~   44 (248)
T COG4138          23 RAGEILHLVGPNGAGKSTLLAR   44 (248)
T ss_pred             CCCEEEEEECCCCCCHHHHHHH
T ss_conf             4660799987898658899999


No 292
>KOG0065 consensus
Probab=93.89  E-value=0.13  Score=30.52  Aligned_cols=112  Identities=28%  Similarity=0.347  Sum_probs=61.9

Q ss_pred             EEECCCCCCHHHHHHHHHHHHHHHHC--CCCCCHHHC--CCCCCCEEEEEEE---CCCCCCCCCCHH-------------
Q ss_conf             99677844078999999999999971--985303532--0682210567652---376611385328-------------
Q gi|254780750|r  654 LLTGPNMGGKSTFLRQNALIVIMAQM--GSYVPASYA--HIGIVDKLFSRVG---SADNLASGRSTF-------------  713 (920)
Q Consensus       654 iiTGpNmgGKSt~lRqval~vilAQi--G~fVPA~~a--~i~~~D~IftRiG---a~D~l~~g~STF-------------  713 (920)
                      =|-|++-+||||+|.-      |||=  |-+|--+=.  -.|..+.-|.|+-   .++||...+.|-             
T Consensus       821 ALMG~SGAGKTTLLdv------LA~R~t~G~I~Gdi~i~G~p~~q~tF~R~~GYvqQ~DiH~~~~TVrESL~fSA~LRlp  894 (1391)
T KOG0065         821 ALMGESGAGKTTLLDV------LAGRKTGGYIEGDILISGFPKDQETFARVSGYVEQQDIHSPELTVRESLRFSAALRLP  894 (1391)
T ss_pred             EHHCCCCCCHHHHHHH------HHCCCCCCEEEEEEEECCEECCHHHHCCCCCEEECCCCCCCCCCHHHHHHHHHHHCCC
T ss_conf             0124778765779999------8567446568757898883273665123101142256567540419899999997187


Q ss_pred             -----------------HHHHHHHHHHHH---------------------HCCCCCEEEEECCCCCCCHHHHHHHHHHHH
Q ss_conf             -----------------999999999999---------------------589985699932588988056799999999
Q gi|254780750|r  714 -----------------MVEMIETASILN---------------------QATNQSFVILDEIGRGTATLDGLSIAWATI  755 (920)
Q Consensus       714 -----------------~vEm~e~~~IL~---------------------~at~~SLVllDElGrGTst~DG~aiA~ail  755 (920)
                                       .+||.+.+..|-                     -|.|.||+.|||-   ||-.|.-| ||.|+
T Consensus       895 ~~v~~~ek~~yVe~Vi~lleL~~~~daiVG~~G~GLs~eQRKrLTIgVELvA~P~~ilFLDEP---TSGLDsqa-A~~i~  970 (1391)
T KOG0065         895 KEVSDEEKYEYVEEVIELLELKEYADALVGLPGSGLSTEQRKRLTIGVELVANPSSILFLDEP---TSGLDSQA-AAIVM  970 (1391)
T ss_pred             CCCCHHHHHHHHHHHHHHHCCHHHHHHHCCCCCCCCCHHHHCEEEEEEEEECCCCEEEEECCC---CCCCCHHH-HHHHH
T ss_conf             769978999999999998376256655506888888977832356899983287556885699---87745789-99999


Q ss_pred             HHH---HHHCCCEEEEECCCHHHH
Q ss_conf             999---972698499974875797
Q gi|254780750|r  756 EYL---HETNRCRGLLATHFHELT  776 (920)
Q Consensus       756 e~l---~~~~~~~~lfaTHy~eL~  776 (920)
                      +.+   .+. |=-.|.+-|=+...
T Consensus       971 ~~lrkla~t-GqtIlCTIHQPS~~  993 (1391)
T KOG0065         971 RFLRKLADT-GQTILCTIHQPSID  993 (1391)
T ss_pred             HHHHHHHHC-CCEEEEEECCCCHH
T ss_conf             999999864-88699981587089


No 293
>cd03241 ABC_RecN RecN ATPase involved in DNA repair; ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=93.86  E-value=0.52  Score=26.00  Aligned_cols=92  Identities=15%  Similarity=0.202  Sum_probs=52.9

Q ss_pred             HHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHC-CCEEEEECCCHHHHHHHHHCCCEEEEEEEEEEECC
Q ss_conf             99999995899856999325889880567999999999999726-98499974875797664306885899999996099
Q gi|254780750|r  719 ETASILNQATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETN-RCRGLLATHFHELTDLSKSLKRFHNATLQVSDSNE  797 (920)
Q Consensus       719 e~~~IL~~at~~SLVllDElGrGTst~DG~aiA~aile~l~~~~-~~~~lfaTHy~eL~~l~~~~~~v~n~~~~~~~~~~  797 (920)
                      -.+.++.....-..+++||+-.|.|-    ..|++|-+.|.+.. .+-++..||.+.++.+++.+     |.+.=...++
T Consensus       182 Alk~~~~~~~~~~tliFDEID~GigG----~~A~~vg~~l~~ls~~~QVi~ITHlpQvAa~ad~H-----~~V~K~~~~~  252 (276)
T cd03241         182 ALKAILARKDAVPTLIFDEIDTGISG----EVAQAVGKKLKELSRSHQVLCITHLPQVAAMADNH-----FLVEKEVEGG  252 (276)
T ss_pred             HHHHHHCCCCCCCEEEEECCCCCCCH----HHHHHHHHHHHHHHCCCEEEEEECHHHHHHCCCCE-----EEEEEEECCC
T ss_conf             99999627889985798445789898----99999999999984798799981779988413767-----9999980499


Q ss_pred             -EEEEEEEEEECCCCCCHHHHHHHHCC
Q ss_conf             -27787777447898877899999829
Q gi|254780750|r  798 -GIIFLHKVIPGIADHSYGIQVGKLAG  823 (920)
Q Consensus       798 -~i~flykl~~G~~~~Sygi~vA~laG  823 (920)
                       ..+-..+|    ....==-++|||.|
T Consensus       253 ~t~t~i~~L----~~~eRv~EiARMl~  275 (276)
T cd03241         253 RTVTKVREL----DKEERVEEIARMLS  275 (276)
T ss_pred             EEEEEEEEC----CHHHHHHHHHHHHC
T ss_conf             289999999----86089999999728


No 294
>cd03277 ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains.  Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins.  The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases.  The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences.  In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (for
Probab=93.81  E-value=0.069  Score=32.52  Aligned_cols=103  Identities=24%  Similarity=0.431  Sum_probs=55.2

Q ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHH-----HH---HHCCCCCC--HHHCC--CCCCC-----------------EE--E
Q ss_conf             64399996778440789999999999-----99---97198530--35320--68221-----------------05--6
Q gi|254780750|r  649 SGKLWLLTGPNMGGKSTFLRQNALIV-----IM---AQMGSYVP--ASYAH--IGIVD-----------------KL--F  697 (920)
Q Consensus       649 ~~~~~iiTGpNmgGKSt~lRqval~v-----il---AQiG~fVP--A~~a~--i~~~D-----------------~I--f  697 (920)
                      ..++-+|.|||-+|||+.+-.+++.-     +|   ..+|.||-  ++++.  |.+..                 |+  |
T Consensus        22 gp~lN~IiGpNGSGKSsIv~AI~lgLGG~p~~lgRa~~v~~fVK~G~~~~~iEIeL~~~~~~iqvdNLcqFLPQdrV~eF  101 (213)
T cd03277          22 GPSLNMIIGPNGSGKSSIVCAICLGLGGKPKLLGRAKKVGEFVKRGCDEGTIEIELYGNPGNIQVDNLCQFLPQDRVGEF  101 (213)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHCCCHHHCCCHHHHHHHHHCCCCCEEEEEEEECCCCCEEECCHHHHCCHHHHHHH
T ss_conf             99757998899887899999999881898000452656999985787642899999659997565405442762778887


Q ss_pred             EEE-----------ECCCC------CCCC---CCHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHHHH
Q ss_conf             765-----------23766------1138---532899999999999958998569993258898805679999999999
Q gi|254780750|r  698 SRV-----------GSADN------LASG---RSTFMVEMIETASILNQATNQSFVILDEIGRGTATLDGLSIAWATIEY  757 (920)
Q Consensus       698 tRi-----------Ga~D~------l~~g---~STF~vEm~e~~~IL~~at~~SLVllDElGrGTst~DG~aiA~aile~  757 (920)
                      +++           ++++-      .+.|   .||-+-=|     -|...|+.-+=++|||--|-++.----    |-++
T Consensus       102 a~l~p~eLLVKFRk~~~L~~L~~~~QSGGErsvst~~yll-----alQ~l~~~pFr~vDEINQgmD~~nEr~----v~~~  172 (213)
T cd03277         102 AKLSPIELLVKFREGEQLQELDPHHQSGGERSVSTMLYLL-----SLQELTRCPFRVVDEINQGMDPTNERK----VFDM  172 (213)
T ss_pred             HHCCHHHHHHHHHHHCCCCCCCHHHHHCCHHHHHHHHHHH-----HHHHHHCCCCEEEEHHHCCCCCHHHHH----HHHH
T ss_conf             7079799999998520355578778712055899999999-----997753499278534335798178999----9999


Q ss_pred             HHH
Q ss_conf             997
Q gi|254780750|r  758 LHE  760 (920)
Q Consensus       758 l~~  760 (920)
                      +.+
T Consensus       173 ~v~  175 (213)
T cd03277         173 LVE  175 (213)
T ss_pred             HHH
T ss_conf             999


No 295
>PRK02224 chromosome segregation protein; Provisional
Probab=93.81  E-value=0.071  Score=32.45  Aligned_cols=75  Identities=20%  Similarity=0.222  Sum_probs=42.4

Q ss_pred             CCCCCCCCHHHHHHHH--HHHHHHH-C---CCCCEEEEECCCCCCCHHHHHHH--HHHHHHHHHHHCCCEEEEECCCHHH
Q ss_conf             6611385328999999--9999995-8---99856999325889880567999--9999999997269849997487579
Q gi|254780750|r  704 DNLASGRSTFMVEMIE--TASILNQ-A---TNQSFVILDEIGRGTATLDGLSI--AWATIEYLHETNRCRGLLATHFHEL  775 (920)
Q Consensus       704 D~l~~g~STF~vEm~e--~~~IL~~-a---t~~SLVllDElGrGTst~DG~ai--A~aile~l~~~~~~~~lfaTHy~eL  775 (920)
                      +.++.|+.+...=-.-  ++.+|.. +   .+-.+++|||.   |.+.|...+  ...++..|.+......++.||-.+|
T Consensus       780 ~~LSGGE~~~~aLaLrlAl~~~l~~~~~g~~~~~~lilDE~---~~~LD~~~~~~l~~~l~~l~~~~~~qiiiITH~~el  856 (880)
T PRK02224        780 KQLSGGERALFNLSLRCAIYRLLAEGIGGDAPLPPLILDEP---TVFLDSGHVSQLVKLIEMMRRIGVEQIIVVSHDDEL  856 (880)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCEEEECC---CCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECHHHH
T ss_conf             88887899999999999999999873378888980788599---988798899999999999872899989999554889


Q ss_pred             HHHHHH
Q ss_conf             766430
Q gi|254780750|r  776 TDLSKS  781 (920)
Q Consensus       776 ~~l~~~  781 (920)
                      .+.++.
T Consensus       857 ~~~~d~  862 (880)
T PRK02224        857 IAAADH  862 (880)
T ss_pred             HHHCCE
T ss_conf             986896


No 296
>PRK01156 chromosome segregation protein; Provisional
Probab=93.81  E-value=0.063  Score=32.81  Aligned_cols=74  Identities=24%  Similarity=0.326  Sum_probs=41.9

Q ss_pred             CCCCCCCCHHHHHHHHHHHHHHH-CCCCCEEEEECCCCCCCHHHHH--HHHHHHHHHHHHH-CCC-EEEEECCCHHHHHH
Q ss_conf             66113853289999999999995-8998569993258898805679--9999999999972-698-49997487579766
Q gi|254780750|r  704 DNLASGRSTFMVEMIETASILNQ-ATNQSFVILDEIGRGTATLDGL--SIAWATIEYLHET-NRC-RGLLATHFHELTDL  778 (920)
Q Consensus       704 D~l~~g~STF~vEm~e~~~IL~~-at~~SLVllDElGrGTst~DG~--aiA~aile~l~~~-~~~-~~lfaTHy~eL~~l  778 (920)
                      +.|+.|++ |++=+.=.-.|.+- +.+-.+++|||.   |.+.|--  .-...+++++... ... .+++.||-.+|.+.
T Consensus       800 ~~LSGGE~-~~~aLaL~laL~~~~~~~~~~~ilDE~---~~~LD~~~~~~l~~~l~~~~~~~~~~~qi~IISH~~el~~~  875 (895)
T PRK01156        800 DSLSGGEK-TAVAFALRVAVAQFLNNDKSLLIMDEP---TAFLDEDRRTNLKDIIEYSLKDSSDIPQVIMISHHRELLSV  875 (895)
T ss_pred             CCCCHHHH-HHHHHHHHHHHHHHHHCCCCEEEEECC---CCCCCHHHHHHHHHHHHHHHHHCCCCCEEEEEECHHHHHHH
T ss_conf             67887799-999999999999998458995998599---87758778999999999998636898879998244889985


Q ss_pred             HHH
Q ss_conf             430
Q gi|254780750|r  779 SKS  781 (920)
Q Consensus       779 ~~~  781 (920)
                      .+.
T Consensus       876 ~d~  878 (895)
T PRK01156        876 ADV  878 (895)
T ss_pred             CCC
T ss_conf             893


No 297
>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair]
Probab=93.76  E-value=0.072  Score=32.41  Aligned_cols=73  Identities=21%  Similarity=0.309  Sum_probs=44.8

Q ss_pred             CCCCCCCCHHHHHHHH---HHHHHHHCCCCCEEEEECCCCCCCHH--HHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHH
Q ss_conf             6611385328999999---99999958998569993258898805--679999999999997269849997487579766
Q gi|254780750|r  704 DNLASGRSTFMVEMIE---TASILNQATNQSFVILDEIGRGTATL--DGLSIAWATIEYLHETNRCRGLLATHFHELTDL  778 (920)
Q Consensus       704 D~l~~g~STF~vEm~e---~~~IL~~at~~SLVllDElGrGTst~--DG~aiA~aile~l~~~~~~~~lfaTHy~eL~~l  778 (920)
                      +.++.|. ||++=+.=   .+..+..-++=.+.+|||-   |.+.  |+..-+..+++.+... +..+++.||-.+|.+.
T Consensus       814 ~~LSGGE-~~~~sLalrLALs~~~~~~~~l~~l~LDEp---f~~LD~e~l~~l~~~l~~i~~~-~~qiiIISH~eel~e~  888 (908)
T COG0419         814 KTLSGGE-RFLASLALRLALSDLLQGRARLELLFLDEP---FGTLDEERLEKLAEILEELLSD-GRQIIIISHVEELKER  888 (908)
T ss_pred             CCCCCHH-HHHHHHHHHHHHHHHHHCCCCCCEEEEECC---CCCCCHHHHHHHHHHHHHHHHC-CCEEEEEECHHHHHHH
T ss_conf             2048618-999999999999999724888882334289---8878989999999999999845-9979999566999985


Q ss_pred             HHH
Q ss_conf             430
Q gi|254780750|r  779 SKS  781 (920)
Q Consensus       779 ~~~  781 (920)
                      ++.
T Consensus       889 ~~~  891 (908)
T COG0419         889 ADV  891 (908)
T ss_pred             HCC
T ss_conf             075


No 298
>PTZ00243 ABC transporter; Provisional
Probab=93.75  E-value=0.54  Score=25.86  Aligned_cols=31  Identities=23%  Similarity=0.263  Sum_probs=16.2

Q ss_pred             EEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHH
Q ss_conf             44434563587777664399996778440789999
Q gi|254780750|r  634 FIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLR  668 (920)
Q Consensus       634 fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lR  668 (920)
                      .|=+|+++...   ...+ .=|-|+-.+||||++-
T Consensus      1324 ~VLk~Isf~I~---pGEK-VGIVGRTGSGKSSLi~ 1354 (1560)
T PTZ00243       1324 LVLRGVSFRIA---PREK-VGIVGRTGSGKSTLLL 1354 (1560)
T ss_pred             CCCCCEEEEEC---CCCE-EEEECCCCCHHHHHHH
T ss_conf             71057469988---9999-9998798743999999


No 299
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL; InterPro: IPR012701    Members of this family are the PhnL protein of C-P lyase systems for utilization of phosphonates. These systems resemble phosphonatase-based systems in having a three-component ABC transporter, where IPR005769 from INTERPRO is the permease, IPR005770 from INTERPRO is the phosphonates binding protein, and IPR012693 from INTERPRO is the ATP-binding cassette (ABC) protein. They differ, however, in having, typically, ten or more additional genes, many of which are believed to form a membrane-associated C-P lyase complex. This protein (PhnL) and the adjacent-encoded PhnK (IPR012700 from INTERPRO) resemble transporter ATP-binding proteins but are suggested, based on mutagenesis studies, to be part of this C-P lyase complex rather than part of a transporter per se ..
Probab=93.67  E-value=0.059  Score=33.03  Aligned_cols=32  Identities=34%  Similarity=0.587  Sum_probs=25.3

Q ss_pred             EEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHH
Q ss_conf             443456358777766439999677844078999999
Q gi|254780750|r  635 IANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQN  670 (920)
Q Consensus       635 VpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqv  670 (920)
                      |=++++|.-    +.+.+..|.||=-+||||+||++
T Consensus        23 Vl~~v~l~V----~aGEcv~L~G~SGaGKSTlLk~l   54 (224)
T TIGR02324        23 VLKNVSLTV----NAGECVALSGPSGAGKSTLLKSL   54 (224)
T ss_pred             ECCCCEEEE----ECCCEEEEECCCCCCHHHHHHHH
T ss_conf             006743787----36735885368887678999976


No 300
>PRK13409 putative ATPase RIL; Provisional
Probab=93.51  E-value=0.12  Score=30.65  Aligned_cols=16  Identities=31%  Similarity=0.657  Sum_probs=9.2

Q ss_pred             EEEEEECCCCCCCCCCHHH
Q ss_conf             5676523766113853289
Q gi|254780750|r  696 LFSRVGSADNLASGRSTFM  714 (920)
Q Consensus       696 IftRiGa~D~l~~g~STF~  714 (920)
                      +..=+|.+   -.|+|||+
T Consensus       367 iigIvG~N---GaGKTTLl  382 (590)
T PRK13409        367 VIGIVGPN---GIGKTTFV  382 (590)
T ss_pred             EEEEECCC---CCCHHHHH
T ss_conf             89998888---88789999


No 301
>pfam09818 ABC_ATPase Predicted ATPase of the ABC class. Members of this family include various bacterial predicted ABC class ATPases.
Probab=93.50  E-value=0.23  Score=28.70  Aligned_cols=48  Identities=23%  Similarity=0.263  Sum_probs=32.7

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHCCCCCCCEEEEEEECCC
Q ss_conf             99996778440789999999999999719853035320682210567652376
Q gi|254780750|r  652 LWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHIGIVDKLFSRVGSAD  704 (920)
Q Consensus       652 ~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a~i~~~D~IftRiGa~D  704 (920)
                      +-+|+|.+--||||+|+.+..=|.     -.||-+-=++-+.|.=-..|.|.|
T Consensus       245 ITlIvGGGyHGKSTLL~Ale~GVY-----nHipGDGRE~VvT~~~avKiRAED  292 (447)
T pfam09818       245 ITLIVGGGYHGKSTLLEALERGVY-----DHIPGDGREFVVTDPDAVKIRAED  292 (447)
T ss_pred             EEEEECCCCCCHHHHHHHHHHCCC-----CCCCCCCEEEEEECCCEEEEEECC
T ss_conf             699978987767889999982777-----778899807999659658888458


No 302
>PRK09112 DNA polymerase III subunit delta'; Validated
Probab=93.49  E-value=0.26  Score=28.22  Aligned_cols=119  Identities=22%  Similarity=0.224  Sum_probs=57.4

Q ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHHHHHHCC-CCCCHHHCCCCCCCEEEEEE--ECCCCC----------CCCCCHHHH
Q ss_conf             64399996778440789999999999999719-85303532068221056765--237661----------138532899
Q gi|254780750|r  649 SGKLWLLTGPNMGGKSTFLRQNALIVIMAQMG-SYVPASYAHIGIVDKLFSRV--GSADNL----------ASGRSTFMV  715 (920)
Q Consensus       649 ~~~~~iiTGpNmgGKSt~lRqval~vilAQiG-~fVPA~~a~i~~~D~IftRi--Ga~D~l----------~~g~STF~v  715 (920)
                      -.+.||+|||..-||+|+-+..|-.. +++-. +-.|+..+...+-..++.+|  |++-|+          .....|. +
T Consensus        44 l~HA~Lf~GP~GiGKaTlA~~~A~~L-l~~~~~~~~~~~~~~pd~~~~~~r~i~~g~hpdl~~i~r~~d~k~~~~~~~-I  121 (352)
T PRK09112         44 LHHALLFEGPEGIGKATLAFHLANHI-LSHPDPNEAPETLADPDPASPLWRQIAQGAHPNLLHLTRPFDEKTGKFKTA-I  121 (352)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHH-HCCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEEECCCCHHHHHHHCC-C
T ss_conf             65246535899808999999999998-669986668655678887877899997489999565534322021454335-7


Q ss_pred             HHHHHHHHHHHC------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHH-CCCEEEEECCCHH
Q ss_conf             999999999958------9985699932588988056799999999999972-6984999748757
Q gi|254780750|r  716 EMIETASILNQA------TNQSFVILDEIGRGTATLDGLSIAWATIEYLHET-NRCRGLLATHFHE  774 (920)
Q Consensus       716 Em~e~~~IL~~a------t~~SLVllDElGrGTst~DG~aiA~aile~l~~~-~~~~~lfaTHy~e  774 (920)
                      -..++..+.+..      ...-.||+||.-.=|.     .-|-|.++-|-+- .++..+++||+.+
T Consensus       122 ~vd~iR~l~~~~~~~~~~~~~kv~Iid~ad~m~~-----~aaNALLK~LEEPp~~~~fiLit~~~~  182 (352)
T PRK09112        122 TVDEIRRVTHFLSQTSGDGNWRIVIIDPADDMNR-----NAANAILKTLEEPPARALFILISHSSG  182 (352)
T ss_pred             CHHHHHHHHHHHCCCCCCCCEEEEEECCHHHHHH-----HHHHHHHHHHHCCCCCEEEEEEECCHH
T ss_conf             7799999999845488668806999818787469-----999999998534898748998869977


No 303
>pfam01580 FtsK_SpoIIIE FtsK/SpoIIIE family. FtsK has extensive sequence similarity to wide variety of proteins from prokaryotes and plasmids, termed the FtsK/SpoIIIE family. This domain contains a putative ATP binding P-loop motif.  It is found in the FtsK cell division protein from E. coli and the stage III sporulation protein E SpoIIIE which has roles in regulation of prespore specific gene expression in B. subtilis. A mutation in FtsK causes a temperature sensitive block in cell division and it is involved in peptidoglycan synthesis or modification. The SpoIIIE protein is implicated in intercellular chromosomal DNA transfer.
Probab=93.42  E-value=0.22  Score=28.77  Aligned_cols=119  Identities=24%  Similarity=0.249  Sum_probs=61.0

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHHHHH----CCCCCC-HHHCCCCCCCEE---EEEEECCCCCCCCCCHH---HHHHHHHH
Q ss_conf             99967784407899999999999997----198530-353206822105---67652376611385328---99999999
Q gi|254780750|r  653 WLLTGPNMGGKSTFLRQNALIVIMAQ----MGSYVP-ASYAHIGIVDKL---FSRVGSADNLASGRSTF---MVEMIETA  721 (920)
Q Consensus       653 ~iiTGpNmgGKSt~lRqval~vilAQ----iG~fVP-A~~a~i~~~D~I---ftRiGa~D~l~~g~STF---~vEm~e~~  721 (920)
                      ++|.|.-.+|||++||++-...++.+    +-.|+- .+...+..|..+   ++.+ + ++...-...+   ..||.+=.
T Consensus        41 ~Lv~G~tGsGKS~~l~~li~sl~~~~~p~~v~l~liD~K~~~~~~~~~~~h~~~~~-~-~d~e~~~~~l~~l~~em~rR~  118 (202)
T pfam01580        41 LLIAGATGSGKSTFLNTLILSLAARHSPEEVRLYLIDPKGGELAALEDLPHLLSAV-A-TDPEDALSALRALVAEMERRY  118 (202)
T ss_pred             EEEECCCCCCCCHHHHHHHHHHHHHCCCCEEEEEEECCCCCCHHHHHHCCCCCCCC-C-CCHHHHHHHHHHHHHHHHHHH
T ss_conf             89965899980099999999998737962069999748961267676356544337-6-899999999999999999999


Q ss_pred             HHHHHCC-------------------------CCCEEEEECCCCCC--CHHHHHHHHHHHHHHHHHHC---CCEEEEECC
Q ss_conf             9999589-------------------------98569993258898--80567999999999999726---984999748
Q gi|254780750|r  722 SILNQAT-------------------------NQSFVILDEIGRGT--ATLDGLSIAWATIEYLHETN---RCRGLLATH  771 (920)
Q Consensus       722 ~IL~~at-------------------------~~SLVllDElGrGT--st~DG~aiA~aile~l~~~~---~~~~lfaTH  771 (920)
                      .+++.+.                         +.-+|++||+.-=.  .+.|-..-+.+.+..|....   |...++||-
T Consensus       119 ~ll~~~g~~~i~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~~~l~~~~~~~~~~~~~~~l~~iar~GRa~GihlilatQ  198 (202)
T pfam01580       119 ALLKQLGVRSIEEYNGEIAEDILGGAGWLEELPPIVVIVDERAELMLAAPKDSEMRVEGALARLARMGRAAGIHLLLATQ  198 (202)
T ss_pred             HHHHHHCCCCHHHHHHHHHHHHHCCCCCCCCCCCEEEEEHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHCCEEEEEEEC
T ss_conf             99998388768999998664321245543347818986445999986555046899999999999988733829999818


Q ss_pred             CH
Q ss_conf             75
Q gi|254780750|r  772 FH  773 (920)
Q Consensus       772 y~  773 (920)
                      ++
T Consensus       199 rP  200 (202)
T pfam01580       199 RP  200 (202)
T ss_pred             CC
T ss_conf             99


No 304
>COG1106 Predicted ATPases [General function prediction only]
Probab=93.40  E-value=0.1  Score=31.35  Aligned_cols=50  Identities=24%  Similarity=0.254  Sum_probs=31.1

Q ss_pred             CCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHH
Q ss_conf             856999325889880567999999999999726984999748757976643
Q gi|254780750|r  730 QSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFHELTDLSK  780 (920)
Q Consensus       730 ~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~~l~~  780 (920)
                      .-.+++||+-+|=-+.-=.-+..++.... .+...-..++||..++-++.-
T Consensus       271 ~k~l~iDEie~~lHp~lm~~~l~~~~~~~-~~~niq~~~TTH~~e~id~~l  320 (371)
T COG1106         271 DKVLLIDEIENGLHPSLMILILETLEDKV-KNNNIQVFLTTHSTEFIDLLL  320 (371)
T ss_pred             CCEEEEEHHHHCCCHHHHHHHHHHHHHHC-CCCEEEEEEECCCHHHHHHHH
T ss_conf             74699503544208799999999987631-474378873100389999999


No 305
>TIGR01166 cbiO cobalt ABC transporter, ATP-binding protein; InterPro: IPR005876   ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs.   ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain .    The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , .   The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , .   Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1).     This entry represents the ATP binding subunit of the multisubunit cobalt transporter in bacteria and its equivalents in archaea. This superfamily includes two groups, one which catalyses the uptake of small molecules, including ions from the external milieu and the other group which is engaged in the efflux of small molecular weight compounds and ions from within the cell. Energy derived from the hydrolysis of ATP drives both the process of uptake and efflux.; GO: 0006824 cobalt ion transport, 0009276 1-2nm peptidoglycan-based cell wall.
Probab=93.38  E-value=0.063  Score=32.83  Aligned_cols=114  Identities=31%  Similarity=0.360  Sum_probs=62.9

Q ss_pred             CCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHCCC--------------------C-----CCCEEEE-EEE
Q ss_conf             6643999967784407899999999999997198530353206--------------------8-----2210567-652
Q gi|254780750|r  648 NSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHI--------------------G-----IVDKLFS-RVG  701 (920)
Q Consensus       648 ~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a~i--------------------~-----~~D~Ift-RiG  701 (920)
                      ..+++.-|=|||-+||||+|+-.        -|.-=|-+-+.+                    .     |=|+||+ +|.
T Consensus        16 ~~G~~~aLlG~NGaGKsTLl~~L--------nG~LrP~~G~v~~dG~~l~YsrkgL~~~R~~V~~VfQdPDDQlF~a~V~   87 (190)
T TIGR01166        16 ERGEVLALLGANGAGKSTLLLHL--------NGLLRPQSGKVLLDGEPLDYSRKGLLEVRQRVGLVFQDPDDQLFAADVD   87 (190)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHH--------CCCCCCCCCEEEECCEECCCCCHHHHHHCCEEEEEEECHHHHCCCCCCC
T ss_conf             05716898728998578998874--------3677797555876785403572446752503003762634420267622


Q ss_pred             CCCCCCC-----CCCHHHHH-----------H----------------HHH--HHHHHHCCCCCEEEEECCCCCCCHHHH
Q ss_conf             3766113-----85328999-----------9----------------999--999995899856999325889880567
Q gi|254780750|r  702 SADNLAS-----GRSTFMVE-----------M----------------IET--ASILNQATNQSFVILDEIGRGTATLDG  747 (920)
Q Consensus       702 a~D~l~~-----g~STF~vE-----------m----------------~e~--~~IL~~at~~SLVllDElGrGTst~DG  747 (920)
                       +| ++=     |.|-=-||           |                ..+  |-++  |=+---.||||--.|=++ +|
T Consensus        88 -~D-VaFGPlNLGL~e~Ev~~RV~eAL~~vg~~~~~~rp~h~LS~GekkRvAIAGAv--AM~Pd~l~LDEPTAGLDp-~G  162 (190)
T TIGR01166        88 -QD-VAFGPLNLGLSEAEVERRVREALTAVGISGLEERPTHLLSGGEKKRVAIAGAV--AMRPDVLLLDEPTAGLDP-AG  162 (190)
T ss_pred             -CC-CCCCCCCCCCCHHHHHHHHHHHHHHCCHHHHHHCCHHHCCCCCHHHHHHHHHH--HHCCCEEEEECCCCCCCH-HH
T ss_conf             -10-03354567337157678789999860632244122411558613577777588--616634664278889787-47


Q ss_pred             HHHHHHHHHHHHHHCCCEEEEECCCHHH
Q ss_conf             9999999999997269849997487579
Q gi|254780750|r  748 LSIAWATIEYLHETNRCRGLLATHFHEL  775 (920)
Q Consensus       748 ~aiA~aile~l~~~~~~~~lfaTHy~eL  775 (920)
                      ..=-.++++.|.+. |--++||||.=+|
T Consensus       163 ~~q~~~~l~~L~~~-G~tvv~STHDvdL  189 (190)
T TIGR01166       163 AEQLLAILRRLRAE-GTTVVISTHDVDL  189 (190)
T ss_pred             HHHHHHHHHHHHHC-CCEEEEEECCCCC
T ss_conf             99999998878723-9989997253201


No 306
>PRK10246 exonuclease subunit SbcC; Provisional
Probab=93.35  E-value=0.097  Score=31.43  Aligned_cols=95  Identities=21%  Similarity=0.368  Sum_probs=54.6

Q ss_pred             CCCCC----HHHCCCCCCCEEEEE-EECCCCCCCCCCHHHHHHH---HHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHH
Q ss_conf             98530----353206822105676-5237661138532899999---999999958998569993258898805679999
Q gi|254780750|r  680 GSYVP----ASYAHIGIVDKLFSR-VGSADNLASGRSTFMVEMI---ETASILNQATNQSFVILDEIGRGTATLDGLSIA  751 (920)
Q Consensus       680 G~fVP----A~~a~i~~~D~IftR-iGa~D~l~~g~STF~vEm~---e~~~IL~~at~~SLVllDElGrGTst~DG~aiA  751 (920)
                      |-|.-    -+...|-|+|.--+. +-....|+.|. ||++=+.   -+|.++..-..=-...||| |-||=-.|++-.|
T Consensus       919 gry~l~r~~~~gL~l~V~D~~~g~~~R~v~TLSGGE-tF~aSLALALgLsdvvq~~~~ldtlFIDE-GFGSLD~e~Ld~a  996 (1047)
T PRK10246        919 GRYLLQRKASEALELEVVDTWQADAVRDTRTLSGGE-SFLVSLALALALSDLVSHKTRIDSLFLDE-GFGTLDSETLDTA  996 (1047)
T ss_pred             CCEEEEECCCCCCEEEEEECCCCCCEECCCCCCHHH-HHHHHHHHHHHHHHHHHCCCCCCCEEECC-CCCCCCHHHHHHH
T ss_conf             872687617999827998857899746897887259-99999999999999984899888465679-9777698899999


Q ss_pred             HHHHHHHHHHCCCEEEEECCCHHHHH
Q ss_conf             99999999726984999748757976
Q gi|254780750|r  752 WATIEYLHETNRCRGLLATHFHELTD  777 (920)
Q Consensus       752 ~aile~l~~~~~~~~lfaTHy~eL~~  777 (920)
                      ..+|+.|... +-.+-+.||-.+|.+
T Consensus       997 ~~aL~~L~~~-gR~VGIISHV~ELke 1021 (1047)
T PRK10246        997 LDALDALNAS-GKTIGVISHVEAMKE 1021 (1047)
T ss_pred             HHHHHHHHHC-CCEEEEECCHHHHHH
T ss_conf             9999999968-898999888788998


No 307
>cd01394 radB RadB. The archaeal protein radB shares similarity radA, the archaeal functional homologue to the bacterial RecA. The precise function of radB is unclear.
Probab=93.26  E-value=0.64  Score=25.30  Aligned_cols=119  Identities=15%  Similarity=0.156  Sum_probs=59.6

Q ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHHHHHHCC---CCCCHHHCCCCCCCEEE----EEEECCCCCC-CCCCHHHHHHHHH
Q ss_conf             64399996778440789999999999999719---85303532068221056----7652376611-3853289999999
Q gi|254780750|r  649 SGKLWLLTGPNMGGKSTFLRQNALIVIMAQMG---SYVPASYAHIGIVDKLF----SRVGSADNLA-SGRSTFMVEMIET  720 (920)
Q Consensus       649 ~~~~~iiTGpNmgGKSt~lRqval~vilAQiG---~fVPA~~a~i~~~D~If----tRiGa~D~l~-~g~STF~vEm~e~  720 (920)
                      .+++.+|.||--.||||++=|+|..+.  .-|   .||-.+.+.-.-+.+|.    -++  .|++. .....| .|+...
T Consensus        18 ~G~it~i~G~pG~GKStl~lq~a~~~~--~~g~~v~YidtE~~~~er~~qi~~~~~~~~--~~~i~v~~~~~~-~~~~~~   92 (218)
T cd01394          18 RGTVTQVYGPPGTGKTNIAIQLAVETA--GQGKKVAYIDTEGLSSERFRQIAGDRPERA--ASSIIVFEPMDF-NEQGRA   92 (218)
T ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHHH--HCCCEEEEEECCCCCCHHHHHHHHHHHHHH--HCCCEEECCCCH-HHHHHH
T ss_conf             887999989999849999999999986--369869999665567699999987536665--305146267876-889999


Q ss_pred             HHHHHH--CCCCCEEEEECCC---------CCCCHHHHHHHHHH--HHHHHHHHCCCEEEEECCC
Q ss_conf             999995--8998569993258---------89880567999999--9999997269849997487
Q gi|254780750|r  721 ASILNQ--ATNQSFVILDEIG---------RGTATLDGLSIAWA--TIEYLHETNRCRGLLATHF  772 (920)
Q Consensus       721 ~~IL~~--at~~SLVllDElG---------rGTst~DG~aiA~a--ile~l~~~~~~~~lfaTHy  772 (920)
                      -..+..  ...-+||++|=+-         +..+...-..++.+  .+..+.++.++-++++-|-
T Consensus        93 i~~~~~~~~~~~~lvViDSi~tl~~~e~~~~~~~~~~~r~l~~~~~~L~~~Ak~~~~~vil~nqV  157 (218)
T cd01394          93 IQETETFADEKVDLVVVDSATALYRLELGDDDTTIKNYRELAKQLTFLLWLARKHDVAVVITNQV  157 (218)
T ss_pred             HHHHHHHHHCCCCEEEEECCHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCEEEEEEEE
T ss_conf             99999764147729999140455455406896479999999999999999987669889999215


No 308
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism]
Probab=93.24  E-value=0.11  Score=31.08  Aligned_cols=130  Identities=25%  Similarity=0.283  Sum_probs=68.4

Q ss_pred             EEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCC------------HHHCCCCCCC---EEEE
Q ss_conf             444345635877776643999967784407899999999999997198530------------3532068221---0567
Q gi|254780750|r  634 FIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVP------------ASYAHIGIVD---KLFS  698 (920)
Q Consensus       634 fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVP------------A~~a~i~~~D---~Ift  698 (920)
                      -|=.+|++..    ..+.+..|-||--|||||+||.+..+--.- -|.-.-            +-.-++|.|=   .+|-
T Consensus        16 ~VLkgi~l~v----~~Gevv~iiGpSGSGKSTlLRclN~LE~~~-~G~I~i~g~~~~~~~~~~~~R~~vGmVFQ~fnLFP   90 (240)
T COG1126          16 EVLKGISLSV----EKGEVVVIIGPSGSGKSTLLRCLNGLEEPD-SGSITVDGEDVGDKKDILKLRRKVGMVFQQFNLFP   90 (240)
T ss_pred             EEECCCCEEE----CCCCEEEEECCCCCCHHHHHHHHHCCCCCC-CCEEEECCEECCCHHHHHHHHHHCCEECCCCCCCC
T ss_conf             7764851167----389789998999998889999997786887-86499998722545469999985576624665465


Q ss_pred             EEECCCCCCC------CCCHHHHHHHHHH----------------------------HHHH-HCCCCCEEEEECCCCCCC
Q ss_conf             6523766113------8532899999999----------------------------9999-589985699932588988
Q gi|254780750|r  699 RVGSADNLAS------GRSTFMVEMIETA----------------------------SILN-QATNQSFVILDEIGRGTA  743 (920)
Q Consensus       699 RiGa~D~l~~------g~STF~vEm~e~~----------------------------~IL~-~at~~SLVllDElGrGTs  743 (920)
                      .+-+-||+.-      |.|.=  |-.+.|                            .|-| -|-.--+.|+||.   ||
T Consensus        91 H~TvleNv~lap~~v~~~~k~--eA~~~A~~lL~~VGL~dka~~yP~qLSGGQqQRVAIARALaM~P~vmLFDEP---TS  165 (240)
T COG1126          91 HLTVLENVTLAPVKVKKLSKA--EAREKALELLEKVGLADKADAYPAQLSGGQQQRVAIARALAMDPKVMLFDEP---TS  165 (240)
T ss_pred             CCHHHHHHHHHHHHHCCCCHH--HHHHHHHHHHHHCCCHHHHHHCCCCCCCHHHHHHHHHHHHCCCCCEEEECCC---CC
T ss_conf             532988877753997298999--9999999999986955666539510480788999999987179988863697---54


Q ss_pred             HHHHHHH--HHHHHHHHHHHCCCEEEEECCCHH
Q ss_conf             0567999--999999999726984999748757
Q gi|254780750|r  744 TLDGLSI--AWATIEYLHETNRCRGLLATHFHE  774 (920)
Q Consensus       744 t~DG~ai--A~aile~l~~~~~~~~lfaTHy~e  774 (920)
                      ..|---+  .-.++..|.+. +-..+..||--.
T Consensus       166 ALDPElv~EVL~vm~~LA~e-GmTMivVTHEM~  197 (240)
T COG1126         166 ALDPELVGEVLDVMKDLAEE-GMTMIIVTHEMG  197 (240)
T ss_pred             CCCHHHHHHHHHHHHHHHHC-CCEEEEEECHHH
T ss_conf             37988999999999999976-986999950367


No 309
>PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional
Probab=93.23  E-value=0.56  Score=25.74  Aligned_cols=33  Identities=33%  Similarity=0.428  Sum_probs=24.9

Q ss_pred             EEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHH
Q ss_conf             4443456358777766439999677844078999999
Q gi|254780750|r  634 FIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQN  670 (920)
Q Consensus       634 fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqv  670 (920)
                      ++=+|+++..    ..+...-|.||+.+||||+++-+
T Consensus       337 ~~L~~isl~i----~~Ge~vaiVG~SGsGKSTL~~LL  369 (547)
T PRK10522        337 FSVGPINLTI----KRGELLFLIGGNGSGKSTLAMLL  369 (547)
T ss_pred             CCCCCEEEEE----CCCCEEEEECCCCCCHHHHHHHH
T ss_conf             7207804798----59988999899999779999998


No 310
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily. Members of this protein are marked as probable ATPases by the nucleotide binding P-loop motif GXXGXGKTT, a motif DEAQ similar to the DEAD/H box of helicases, and extensive homology to ATPases of MSHA-type pilus systems and to GspA proteins associated with type II protein secretion systems.
Probab=93.22  E-value=0.27  Score=28.06  Aligned_cols=83  Identities=17%  Similarity=0.304  Sum_probs=41.5

Q ss_pred             CEEEEEECCCCCCHHHHHHHHHHHHHHHHCC-C-CCCHH--HCCCC---CCCEEEEEEECCCCCCCCCCHHHHHHHHHHH
Q ss_conf             4399996778440789999999999999719-8-53035--32068---2210567652376611385328999999999
Q gi|254780750|r  650 GKLWLLTGPNMGGKSTFLRQNALIVIMAQMG-S-YVPAS--YAHIG---IVDKLFSRVGSADNLASGRSTFMVEMIETAS  722 (920)
Q Consensus       650 ~~~~iiTGpNmgGKSt~lRqval~vilAQiG-~-fVPA~--~a~i~---~~D~IftRiGa~D~l~~g~STF~vEm~e~~~  722 (920)
                      ..+.+|||+-.+||||++|..     +.+.. . ++++-  ...++   ++..|....|...+ ..+.....-.+.+.-.
T Consensus        43 ~g~~lltGe~GtGKTtllr~l-----~~~l~~~~~~~~~i~~~~l~~~~ll~~i~~~lg~~~~-~~~~~~~~~~l~~~L~  116 (269)
T TIGR03015        43 EGFILITGEVGAGKTTLIRNL-----LKRLDQERVVAAKLVNTRVDAEDLLRMVAADFGLETE-GRDKAALLRELEDFLI  116 (269)
T ss_pred             CCEEEEECCCCCCHHHHHHHH-----HHHCCCCCEEEEEECCCCCCHHHHHHHHHHHCCCCCC-CCCHHHHHHHHHHHHH
T ss_conf             965999729989889999999-----9845934548999769999999999999998598988-9899999999999999


Q ss_pred             HHHHCCCCCEEEEECC
Q ss_conf             9995899856999325
Q gi|254780750|r  723 ILNQATNQSFVILDEI  738 (920)
Q Consensus       723 IL~~at~~SLVllDEl  738 (920)
                      -+.....+-++|+||-
T Consensus       117 ~~~~~g~~~vliIDEA  132 (269)
T TIGR03015       117 EQFAAGKRALLVVDEA  132 (269)
T ss_pred             HHHHCCCCEEEEEECH
T ss_conf             9996699469997242


No 311
>pfam03796 DnaB_C DnaB-like helicase C terminal domain. The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork. Although the mechanism by which DnaB both couples ATP hydrolysis to translocation along DNA and denatures the duplex is unknown, a change in the quaternary structure of the protein involving dimerization of the N-terminal domain has been observed and may occur during the enzymatic cycle. This C-terminal domain contains an ATP-binding site and is therefore probably the site of ATP hydrolysis.
Probab=93.18  E-value=0.59  Score=25.56  Aligned_cols=116  Identities=17%  Similarity=0.170  Sum_probs=54.3

Q ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHCCCCC---CCEEE---EEEECCCCCCCCCCHHHHHHHHHHH
Q ss_conf             64399996778440789999999999999719853035320682---21056---7652376611385328999999999
Q gi|254780750|r  649 SGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHIGI---VDKLF---SRVGSADNLASGRSTFMVEMIETAS  722 (920)
Q Consensus       649 ~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a~i~~---~D~If---tRiGa~D~l~~g~STF~vEm~e~~~  722 (920)
                      .+.+.+|.|+-..|||+++-++|....+.| |-.|--=+.+++.   ..|++   +++- .+++..|.-+ ..|+.....
T Consensus        18 ~G~l~vi~g~pg~GKS~~~~~~a~~~a~~~-g~~Vl~~slEm~~~~~~~R~~a~~~~v~-~~~i~~~~~~-~~~~~~~~~   94 (186)
T pfam03796        18 KGDLIIIAARPSMGKTAFALNIARNAALKQ-DKPVLFFSLEMSAEQLAERLLSSESRIS-SSKLRSGQLS-DEDWERLAE   94 (186)
T ss_pred             CCCEEEEEECCCCCHHHHHHHHHHHHHHHC-CCCEEEECCCCCHHHHHHHHHHHHHCCC-HHHHHCCCHH-HHHHHHHHH
T ss_conf             881799996799987999999999999970-9966875475529999999999862676-5554125121-679999999


Q ss_pred             HHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCH
Q ss_conf             999589985699932588988056799999999999972698499974875
Q gi|254780750|r  723 ILNQATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFH  773 (920)
Q Consensus       723 IL~~at~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~  773 (920)
                      ........-+.+-|. + +++..+-    .+.++++....++..+|.=|.+
T Consensus        95 ~~~~~~~~~l~i~~~-~-~~t~~~i----~~~i~~~~~~~~~~~vvvDyl~  139 (186)
T pfam03796        95 AAGELSEAPLYIDDT-P-GLSLSEL----RAQARRLKREHGLGLIVIDYLQ  139 (186)
T ss_pred             HHHHHHCCCEEEECC-C-CCCHHHH----HHHHHHHHHHCCCCEEEEEHHH
T ss_conf             999985398688479-9-9989999----9999999985599889974898


No 312
>TIGR02169 SMC_prok_A chromosome segregation protein SMC; InterPro: IPR011891   The SMC (structural maintenance of chromosomes) family of proteins, exist in virtually all organisms including both bacteria and archaea. The SMC proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms and form three types of heterodimer (SMC1SMC3, SMC2SMC4, SMC5SMC6), which are core components of large multiprotein complexes. The best known complexes are cohesin, which is responsible for sister-chromatid cohesion, and condensin, which is required for full chromosome condensation in mitosis.     SMCs are generally present as single proteins in bacteria, and as at least six distinct proteins in eukaryotes. The proteins range in size from approximately 110 to 170 kDa, and share a five-domain structure, with globular N- and C-terminal (IPR003395 from INTERPRO) domains separated by a long (circa 100 nm or 900 residues) coiled coil segment in the centre of which is a globular ''hinge'' domain, characterised by a set of four highly conserved glycine residues that are typical of flexible regions in a protein. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T), which by mutational studies has been shown to be essential in several proteins. The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif (XXXXD, where X is any hydrophobic residue), and a LSGG motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases .    All SMC proteins appear to form dimers, either forming homodimers with themselves, as in the case of prokaryotic SMC proteins, or heterodimers between different but related SMC proteins. The dimers are arranged in an antiparallel alignment. This orientation brings the N- and C-terminal globular domains (from either different or identical protamers) together, which unites an ATP binding site (Walker A motif) within the N-terminal domain with a Walker B motif (DA box) within the C-terminal domain, to form a potentially functional ATPase. Protein interaction and microscopy data suggest that SMC dimers form a ring-like structure which might embrace DNA molecules. Non-SMC subunits associate with the SMC amino- and carboxy-terminal domains. The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences.   SMCs share not only sequence similarity but also structural similarity with ABC proteins. SMC proteins function together with other proteins in a range of chromosomal transactions, including chromosome condensation, sister-chromatid cohesion, recombination, DNA repair and epigenetic silencing of gene expression .    This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by IPR011890 from INTERPRO. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent ..
Probab=93.06  E-value=0.04  Score=34.27  Aligned_cols=21  Identities=0%  Similarity=0.059  Sum_probs=12.9

Q ss_pred             CEEEEE--ECCHHHHHHHHHHCC
Q ss_conf             559996--058789999985229
Q gi|254780750|r  173 GIFKIS--TSNHDRLISDIMRID  193 (920)
Q Consensus       173 G~~~~~--~~~~d~l~~~L~~l~  193 (920)
                      .-|++.  .++..++.+.|+++.
T Consensus       131 SyY~lNG~~~~l~ei~d~L~~~g  153 (1202)
T TIGR02169       131 SYYYLNGKSVRLSEIHDFLAAAG  153 (1202)
T ss_pred             EEEEECCCCCCHHHHHHHHHHCC
T ss_conf             88887082035766899998617


No 313
>cd03276 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains.  Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins.  The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases.  The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences.  In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (for
Probab=92.99  E-value=0.1  Score=31.19  Aligned_cols=24  Identities=25%  Similarity=0.329  Sum_probs=20.1

Q ss_pred             CEEEEEECCCCCCHHHHHHHHHHH
Q ss_conf             439999677844078999999999
Q gi|254780750|r  650 GKLWLLTGPNMGGKSTFLRQNALI  673 (920)
Q Consensus       650 ~~~~iiTGpNmgGKSt~lRqval~  673 (920)
                      .++-+|.|||-+|||+.|-.+++.
T Consensus        21 p~lN~IiG~NGsGKSsIl~AI~lg   44 (198)
T cd03276          21 PRVNFIVGNNGSGKSAILTALTIG   44 (198)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHHH
T ss_conf             982899889999889999999986


No 314
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed
Probab=92.94  E-value=0.55  Score=25.77  Aligned_cols=23  Identities=26%  Similarity=0.468  Sum_probs=14.2

Q ss_pred             CHHHHHHHHCCCCHHHHHHHHHHHH
Q ss_conf             7789999982999899999999999
Q gi|254780750|r  813 SYGIQVGKLAGLPNTVISRAYDILK  837 (920)
Q Consensus       813 Sygi~vA~laG~p~~vi~~A~~~~~  837 (920)
                      .|.-.+++  .+++..|.+=++.++
T Consensus       682 ~Yr~~l~~--~l~~~~i~~L~~~l~  704 (726)
T PRK13341        682 DYRQAVGT--NLEEEVLCNLDELLT  704 (726)
T ss_pred             HHHHHHHC--CCCHHHHHHHHHHHH
T ss_conf             49999853--299999999999999


No 315
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning]
Probab=92.90  E-value=0.12  Score=30.79  Aligned_cols=47  Identities=28%  Similarity=0.415  Sum_probs=32.3

Q ss_pred             CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHH--CCCEEEEECCCHHHHHH
Q ss_conf             9985699932588988056799999999999972--69849997487579766
Q gi|254780750|r  728 TNQSFVILDEIGRGTATLDGLSIAWATIEYLHET--NRCRGLLATHFHELTDL  778 (920)
Q Consensus       728 t~~SLVllDElGrGTst~DG~aiA~aile~l~~~--~~~~~lfaTHy~eL~~l  778 (920)
                      ..-.+.|-||-   |...| -.+||-|+.-|.+.  .|..++.|||..+|.+-
T Consensus       154 ~~P~vLlADEP---TGNLD-p~~s~~im~lfeeinr~GtTVl~ATHd~~lv~~  202 (223)
T COG2884         154 NQPAVLLADEP---TGNLD-PDLSWEIMRLFEEINRLGTTVLMATHDLELVNR  202 (223)
T ss_pred             CCCCEEEECCC---CCCCC-HHHHHHHHHHHHHHHHCCCEEEEEECHHHHHHH
T ss_conf             69876860488---78888-588999999999986448579997160999975


No 316
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed
Probab=92.80  E-value=0.74  Score=24.83  Aligned_cols=33  Identities=24%  Similarity=0.402  Sum_probs=24.6

Q ss_pred             EEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHH
Q ss_conf             4443456358777766439999677844078999999
Q gi|254780750|r  634 FIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQN  670 (920)
Q Consensus       634 fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqv  670 (920)
                      .|-+|+++..    ..+...-|.||+.+||||+++-+
T Consensus       364 ~vL~~is~~i----~~Ge~vaIVG~SGsGKSTl~~LL  396 (588)
T PRK11174        364 TLAGPLNFTL----PAGQRVALVGPSGAGKTSLLNAL  396 (588)
T ss_pred             EECCCEEEEE----CCCCEEEEECCCCCCHHHHHHHH
T ss_conf             5103646997----49978999899986499999999


No 317
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein; InterPro: IPR005670   This is a family of phosphate transport system permease proteins.; GO: 0005315 inorganic phosphate transmembrane transporter activity, 0015114 phosphate transmembrane transporter activity, 0006817 phosphate transport, 0016020 membrane.
Probab=92.76  E-value=0.11  Score=30.97  Aligned_cols=121  Identities=31%  Similarity=0.414  Sum_probs=64.6

Q ss_pred             EEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHCC--C-----CCCCEEE------EEEE
Q ss_conf             4434563587777664399996778440789999999999999719853035320--6-----8221056------7652
Q gi|254780750|r  635 IANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAH--I-----GIVDKLF------SRVG  701 (920)
Q Consensus       635 VpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a~--i-----~~~D~If------tRiG  701 (920)
                      +=.||+|..    ....+--|=||=-+|||||||++=-.      .=-||--..+  +     -|+|.-+      .|||
T Consensus        16 AL~~i~~~I----~~n~vTAlIGPSGCGKSTlLR~lNRM------nDl~~~~r~~G~v~f~G~dIy~~~~D~~~LR~~vG   85 (248)
T TIGR00972        16 ALKNINLDI----PKNQVTALIGPSGCGKSTLLRSLNRM------NDLVPGVRIEGKVLFDGQDIYDKKIDVVELRKRVG   85 (248)
T ss_pred             EEECCCCEE----CCCEEEEEECCCCCCHHHHHHHHHHH------HHHCCCEEEEEEEEECCCCCCCCCCCHHHHHHHCC
T ss_conf             862156200----37705898778898678999998877------64078816888898645114565668788762258


Q ss_pred             C------------CCCCCCCCCHH-------HHHHHHHHHHHHHC------------CCCC-------------------
Q ss_conf             3------------76611385328-------99999999999958------------9985-------------------
Q gi|254780750|r  702 S------------ADNLASGRSTF-------MVEMIETASILNQA------------TNQS-------------------  731 (920)
Q Consensus       702 a------------~D~l~~g~STF-------~vEm~e~~~IL~~a------------t~~S-------------------  731 (920)
                      -            -|||+=|.=+.       +-|..|.|  |+.|            ..-|                   
T Consensus        86 MVFQ~PNPFpmSIydNiayG~r~~G~~~K~~L~e~Ve~s--L~~AALWDEVKD~L~~sa~~LSGGQQQRLCIARalA~eP  163 (248)
T TIGR00972        86 MVFQKPNPFPMSIYDNIAYGPRLHGIKDKKELDEIVEES--LKKAALWDEVKDRLHDSALGLSGGQQQRLCIARALAVEP  163 (248)
T ss_pred             CCCCCCCCCCCCHHHHHHHHHHHCCCCCHHHHHHHHHHH--HHHCCCHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHCCC
T ss_conf             521478978840556754524521633778999999999--861687135524213588978726889999998752488


Q ss_pred             -EEEEECCCCCCCHHHHHHHHHHHHHHHHHHC-CCEE-EEECCC
Q ss_conf             -6999325889880567999999999999726-9849-997487
Q gi|254780750|r  732 -FVILDEIGRGTATLDGLSIAWATIEYLHETN-RCRG-LLATHF  772 (920)
Q Consensus       732 -LVllDElGrGTst~DG~aiA~aile~l~~~~-~~~~-lfaTHy  772 (920)
                       -+||||-   ||..|=+|  -+-+|.|+... +.+| +..||=
T Consensus       164 eVlLlDEP---TSALDPIa--T~~IEeLi~eLk~~YTivIVTHn  202 (248)
T TIGR00972       164 EVLLLDEP---TSALDPIA--TGKIEELIQELKKKYTIVIVTHN  202 (248)
T ss_pred             CEECCCCC---CCCCCHHH--HHHHHHHHHHHHHCCEEEEEECC
T ss_conf             52105788---87578778--99999999987652979988177


No 318
>COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones]
Probab=92.68  E-value=0.61  Score=25.47  Aligned_cols=45  Identities=24%  Similarity=0.318  Sum_probs=26.7

Q ss_pred             CCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCC-CEEEEECCCHHHHHHH
Q ss_conf             98569993258898805679999999999997269-8499974875797664
Q gi|254780750|r  729 NQSFVILDEIGRGTATLDGLSIAWATIEYLHETNR-CRGLLATHFHELTDLS  779 (920)
Q Consensus       729 ~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~-~~~lfaTHy~eL~~l~  779 (920)
                      .-+++|+||---|=++.-    ...+++-|.++.+ -..||+||-  |+.++
T Consensus       492 dapl~lLDEPTegLD~~T----E~~vL~ll~~~~~~kTll~vTHr--L~~le  537 (573)
T COG4987         492 DAPLWLLDEPTEGLDPIT----ERQVLALLFEHAEGKTLLMVTHR--LRGLE  537 (573)
T ss_pred             CCCEEEECCCCCCCCHHH----HHHHHHHHHHHHCCCEEEEEECC--CCCHH
T ss_conf             798688448866678643----99999999998459859999645--42176


No 319
>PRK00064 recF recombination protein F; Reviewed
Probab=92.68  E-value=0.13  Score=30.46  Aligned_cols=59  Identities=10%  Similarity=0.079  Sum_probs=34.0

Q ss_pred             HCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHCCCEEEEEEE
Q ss_conf             589985699932588988056799999999999972698499974875797664306885899999
Q gi|254780750|r  726 QATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFHELTDLSKSLKRFHNATLQ  791 (920)
Q Consensus       726 ~at~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~~l~~~~~~v~n~~~~  791 (920)
                      ......++|||++...=+..=   . .+++++|.+. ++=++++|=-.+  .+.......+++||+
T Consensus       297 ~~~~~PIlLlDDv~sELD~~r---~-~~ll~~l~~~-~~QvfiT~td~~--~~~~~~~~~~~FhVe  355 (355)
T PRK00064        297 ETGEAPILLLDDVASELDDGR---R-AALLETLIAL-GAQVFITATDLE--GFDALWENAKIFHVE  355 (355)
T ss_pred             HHCCCCEEEEECCHHCCCHHH---H-HHHHHHHHHC-CCEEEEECCCHH--HHHHHHCCCCEEEEC
T ss_conf             549997899948300169999---9-9999998747-986999757878--876554348489969


No 320
>COG1193 Mismatch repair ATPase (MutS family) [DNA replication, recombination, and repair]
Probab=92.67  E-value=0.0024  Score=43.48  Aligned_cols=119  Identities=26%  Similarity=0.355  Sum_probs=78.0

Q ss_pred             CEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHCCCCCCCEEEEEEECCCCCCCCCCHHHHHHHH-HHHHHHHCC
Q ss_conf             4399996778440789999999999999719853035320682210567652376611385328999999-999999589
Q gi|254780750|r  650 GKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHIGIVDKLFSRVGSADNLASGRSTFMVEMIE-TASILNQAT  728 (920)
Q Consensus       650 ~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a~i~~~D~IftRiGa~D~l~~g~STF~vEm~e-~~~IL~~at  728 (920)
                      ..+.+++|-|-+||+++++...-++.+|++|..||++.|+..+.+-|+ .+.. ..+..+...|-.-+.+ ....+..+.
T Consensus       532 ~e~~~l~~~~s~~~~~l~e~~~~~~~~a~~~~~~~~~~a~~e~~~~~~-~~~~-~~~~~~~~~~e~~~~~~~~~~~~~~~  609 (753)
T COG1193         532 DEVELLTGANSGGKTSLLELKAQIVVLAHMGLPVPAEEAKVEAVDEVK-FLKK-KKGILDAGAFESTLKDKKNKVLPEAK  609 (753)
T ss_pred             HHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHH-HHHHHHHHHHHHHHHHHHCCCCCCCC
T ss_conf             999999776433326799999999999972138999999988999999-8646-47778898899874542134586334


Q ss_pred             CCCEEEEECCCCCCCHHHHHHHHH--HHHHHHHHHCCCEEEEECCC
Q ss_conf             985699932588988056799999--99999997269849997487
Q gi|254780750|r  729 NQSFVILDEIGRGTATLDGLSIAW--ATIEYLHETNRCRGLLATHF  772 (920)
Q Consensus       729 ~~SLVllDElGrGTst~DG~aiA~--aile~l~~~~~~~~lfaTHy  772 (920)
                      .+.|++.||+--=| ..-|.++-.  ...+++++. +...++.+|-
T Consensus       610 ~~~l~~gDev~~~t-~e~G~v~~i~a~~~e~~v~~-g~~kv~V~~~  653 (753)
T COG1193         610 KRKLKLGDEVEVIT-GEPGAVVKIIAGILEALVQS-GILKVIVSHL  653 (753)
T ss_pred             CCCCEECCEEEEEC-CCCCCEEEEECCCCEEEEEC-CEEEEEEEHH
T ss_conf             55751345357605-88510356532676468760-4069997526


No 321
>PRK09361 radB DNA repair and recombination protein RadB; Provisional
Probab=92.59  E-value=0.79  Score=24.63  Aligned_cols=121  Identities=13%  Similarity=0.132  Sum_probs=59.8

Q ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHHHHHH-CCCCCCHHHCCCCCCCEEEEEE-E-CCCCCCC-CCCHHHHH---HHHHH
Q ss_conf             643999967784407899999999999997-1985303532068221056765-2-3766113-85328999---99999
Q gi|254780750|r  649 SGKLWLLTGPNMGGKSTFLRQNALIVIMAQ-MGSYVPASYAHIGIVDKLFSRV-G-SADNLAS-GRSTFMVE---MIETA  721 (920)
Q Consensus       649 ~~~~~iiTGpNmgGKSt~lRqval~vilAQ-iG~fVPA~~a~i~~~D~IftRi-G-a~D~l~~-g~STF~vE---m~e~~  721 (920)
                      .+++..|+||--+||||+.=|++..+.... --.||-++.+...-+..|..+- . ..+++.- .-++|.-+   +....
T Consensus        22 ~G~itei~G~pG~GKTtl~lq~a~~~~~~g~~vlYidtE~~~~er~~qi~~~~~~~~~~~i~~~~~~~~~~~~~~i~~~~  101 (224)
T PRK09361         22 RGTITQIYGPPGSGKTNICIQLAVEAARQGKKVIYIDTEGLSPERFKQIAGEDFEELLSNIIIFEPSSFEEQREAIQKAE  101 (224)
T ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEECCCCCCHHHHHHHHCCCHHHHHHCCEEECCCCHHHHHHHHHHHH
T ss_conf             88799998999985999999999999974990999678767889999985657345420614724798899999999999


Q ss_pred             HHHHHCCCCCEEEEECCCC--------CCCHHHHH-HHHH--HHHHHHHHHCCCEEEEECCC
Q ss_conf             9999589985699932588--------98805679-9999--99999997269849997487
Q gi|254780750|r  722 SILNQATNQSFVILDEIGR--------GTATLDGL-SIAW--ATIEYLHETNRCRGLLATHF  772 (920)
Q Consensus       722 ~IL~~at~~SLVllDElGr--------GTst~DG~-aiA~--aile~l~~~~~~~~lfaTHy  772 (920)
                      .+.+  ..-.||++|=+--        +..+ ... .++.  ..|..+.++.++-++|+-|-
T Consensus       102 ~~~~--~~~~lvVIDSi~~~~~~e~~~~~~~-~~~~~l~~~~~~L~~~a~~~~~~vvl~nqV  160 (224)
T PRK09361        102 KIAK--ENVGLIVLDSATSLYRLELDDNDNS-KLNRELGKQISHLLSLARKHNIAVVITNQV  160 (224)
T ss_pred             HHHH--CCCCEEEEECCHHHEEHHCCCCCCH-HHHHHHHHHHHHHHHHHHHCCCEEEEEEEE
T ss_conf             8750--5873899962301000001457658-999999999999999999719869999668


No 322
>pfam00910 RNA_helicase RNA helicase. This family includes RNA helicases thought to be involved in duplex unwinding during viral RNA replication. Members of this family are found in a variety of single stranded RNA viruses.
Probab=92.57  E-value=0.54  Score=25.85  Aligned_cols=64  Identities=30%  Similarity=0.388  Sum_probs=44.2

Q ss_pred             EEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHCCCCCCCEEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEE
Q ss_conf             99677844078999999999999971985303532068221056765237661138532899999999999958998569
Q gi|254780750|r  654 LLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHIGIVDKLFSRVGSADNLASGRSTFMVEMIETASILNQATNQSFV  733 (920)
Q Consensus       654 iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a~i~~~D~IftRiGa~D~l~~g~STF~vEm~e~~~IL~~at~~SLV  733 (920)
                      .|.||.-.|||++.+.+|-.+.=+          ...+.-+++|+|- ..|+-..|.                 +..--|
T Consensus         2 ~l~G~~G~GKS~~a~~la~~~~~~----------~~~~~~~~~Y~~~-~~~~~wdgY-----------------~gq~vv   53 (105)
T pfam00910         2 WLYGPPGCGKSTLAKYLARALLDH----------LGLPKKDSVYSRN-PDDDFWDGY-----------------TGQPVV   53 (105)
T ss_pred             EEECCCCCCHHHHHHHHHHHHHHH----------HCCCCCCCEEECC-CCCCCCCCC-----------------CCCEEE
T ss_conf             897999898899999999999998----------3778789779678-877656788-----------------998579


Q ss_pred             EEECCCCCCCHH
Q ss_conf             993258898805
Q gi|254780750|r  734 ILDEIGRGTATL  745 (920)
Q Consensus       734 llDElGrGTst~  745 (920)
                      ++||+|+-.+..
T Consensus        54 i~DD~~~~~~~~   65 (105)
T pfam00910        54 IIDDFGQNPDGP   65 (105)
T ss_pred             EEECCCCCCCCC
T ss_conf             996577788862


No 323
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional
Probab=92.54  E-value=0.32  Score=27.53  Aligned_cols=27  Identities=15%  Similarity=0.236  Sum_probs=11.9

Q ss_pred             CCCCCHHHHHHHHHHHHHCCCEEEEEE
Q ss_conf             265617669999999998898599995
Q gi|254780750|r   83 MCGVPVHTANHYIQKLIKIGHRIAICE  109 (920)
Q Consensus        83 maGvP~~~l~~yl~~Lv~~GykVaive  109 (920)
                      |...|.+++..-+..-++.+-.|+|+-
T Consensus         1 m~~LPi~~~~~~i~~~l~~~~~~vl~a   27 (812)
T PRK11664          1 MSSLPVAAVLPELLTALKTAPQVLLKA   27 (812)
T ss_pred             CCCCCHHHHHHHHHHHHHHCCEEEEEE
T ss_conf             998984789999999999799799990


No 324
>pfam05496 RuvB_N Holliday junction DNA helicase ruvB N-terminus. The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair. Branch migration is catalysed by the RuvB protein that is targeted to the Holliday junction by the structure specific RuvA protein. This family contains the N-terminal region of the protein.
Probab=92.51  E-value=0.56  Score=25.75  Aligned_cols=62  Identities=27%  Similarity=0.257  Sum_probs=41.3

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHCCCCCCCEEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHCCCCCE
Q ss_conf             99967784407899999999999997198530353206822105676523766113853289999999999995899856
Q gi|254780750|r  653 WLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHIGIVDKLFSRVGSADNLASGRSTFMVEMIETASILNQATNQSF  732 (920)
Q Consensus       653 ~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a~i~~~D~IftRiGa~D~l~~g~STF~vEm~e~~~IL~~at~~SL  732 (920)
                      +|++||-..||||+-|-+|-.     ++|-.-+              ..+ .        -.-+..+...++.+...+.+
T Consensus        53 ~lf~GPPG~GKTTlAriiAk~-----~~~~~~~--------------~s~-~--------~i~~~~di~~~l~~~~~~~I  104 (234)
T pfam05496        53 VLLYGPPGLGKTTLANIIANE-----MGVNIRI--------------TSG-P--------ALEKPGDLAAILTNLEPGDV  104 (234)
T ss_pred             EEEECCCCCCHHHHHHHHHHH-----HCCCEEE--------------ECC-H--------HHHHHHHHHHHHHHCCCCCE
T ss_conf             788789999888999999984-----0875376--------------142-6--------66438999999984589988


Q ss_pred             EEEECCCCCC
Q ss_conf             9993258898
Q gi|254780750|r  733 VILDEIGRGT  742 (920)
Q Consensus       733 VllDElGrGT  742 (920)
                      +.+||+-|=+
T Consensus       105 LFIDEIHr~n  114 (234)
T pfam05496       105 LFIDEIHRLN  114 (234)
T ss_pred             EEEECHHHCC
T ss_conf             9996654358


No 325
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism]
Probab=92.46  E-value=0.24  Score=28.45  Aligned_cols=35  Identities=34%  Similarity=0.468  Sum_probs=26.5

Q ss_pred             EEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHH
Q ss_conf             444345635877776643999967784407899999999
Q gi|254780750|r  634 FIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNAL  672 (920)
Q Consensus       634 fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval  672 (920)
                      ..=.||++..    ..+.+..|-||.-+||||+||.+.=
T Consensus        18 ~aL~~Vnl~I----~~GE~VaiIG~SGaGKSTLLR~lng   52 (258)
T COG3638          18 QALKDVNLEI----NQGEMVAIIGPSGAGKSTLLRSLNG   52 (258)
T ss_pred             EEEEEEEEEE----CCCCEEEEECCCCCCHHHHHHHHHC
T ss_conf             6663576775----7986899987888868999999866


No 326
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein; InterPro: IPR012693   ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs.   ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain .    The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , .   The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , .   Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1).     Phosphonates are a class of phosphorus-containing organic compound with a stable direct C-P bond rather than a C-O-P linkage. A number of bacterial species have operons, typically about 14 genes in size, with genes for ATP-dependent transport of phosphonates, degradation, and regulation of the expression of the system. Members of this protein family are the ATP-binding cassette component of tripartite ABC transporters of phosphonates.; GO: 0005524 ATP binding, 0015416 phosphonate transmembrane-transporting ATPase activity, 0015716 phosphonate transport, 0016020 membrane.
Probab=92.46  E-value=0.13  Score=30.58  Aligned_cols=30  Identities=37%  Similarity=0.552  Sum_probs=21.5

Q ss_pred             EEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHH
Q ss_conf             4563587777664399996778440789999999
Q gi|254780750|r  638 DCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNA  671 (920)
Q Consensus       638 di~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqva  671 (920)
                      ||+|..    ..+-|..|=||=-+||||+||++=
T Consensus        20 ~inl~i----~~GE~~~~IG~SGAGKSTLLR~iN   49 (253)
T TIGR02315        20 NINLEI----NPGEFVAVIGPSGAGKSTLLRCIN   49 (253)
T ss_pred             EECCEE----ECCEEEEEECCCCCCHHHHHHHHH
T ss_conf             311434----165179997378872679998775


No 327
>smart00763 AAA_PrkA PrkA AAA domain. This is a family of PrkA bacterial and archaeal serine kinases approximately 630 residues long. This is the N-terminal AAA domain.
Probab=92.43  E-value=0.15  Score=30.06  Aligned_cols=18  Identities=39%  Similarity=0.724  Sum_probs=6.6

Q ss_pred             EEEEEECCCCCCHHHHHH
Q ss_conf             399996778440789999
Q gi|254780750|r  651 KLWLLTGPNMGGKSTFLR  668 (920)
Q Consensus       651 ~~~iiTGpNmgGKSt~lR  668 (920)
                      +++++-||+.|||||+.+
T Consensus        79 ~IllL~GPvGsGKStl~~   96 (361)
T smart00763       79 QILYLLGPVGGGKSSLVE   96 (361)
T ss_pred             EEEEEECCCCCCHHHHHH
T ss_conf             699998899887799999


No 328
>TIGR00602 rad24 checkpoint protein rad24; InterPro: IPR004582    To be effective as a mechanism that preserves genomic integrity, the DNA damage checkpoint must be extremely sensitive in its ability to detect DNA damage. In Saccharomyces cerevisiae the Ddc1/Rad17/Mec3 complex and Rad24 are DNA damage checkpoint components which may promote checkpoint activation by "sensing" DNA damage directly . Rad24 shares sequence homology with RF-c, a protein that recognises DNA template/RNA primer hybrids during DNA replication. The Ddc1 complex has structural homology to proliferating-cell nuclear antigen (PCNA), which clamps onto DNA and confers processivity to DNA polymerases delta and epsilon. Rad24 is postulated to recognise DNA lesions and then recruit the Ddc1 complex to generate checkpoint signals. ; GO: 0006281 DNA repair, 0007049 cell cycle, 0005634 nucleus.
Probab=92.38  E-value=0.12  Score=30.62  Aligned_cols=39  Identities=18%  Similarity=0.149  Sum_probs=18.0

Q ss_pred             EEECCHHHCCEEEEECCCCCCCCHHHHHHCCCCCCHHHHHHHH
Q ss_conf             1425133201545412787764127876301234337899998
Q gi|254780750|r  290 LFIDSAARSNLEILRTLSGSREQSLLKTIDYSITGAGGRLFAE  332 (920)
Q Consensus       290 m~LD~~Tl~nLEI~~~~~g~~~gSL~~~Ln~t~T~~G~RlLr~  332 (920)
                      |+|...-+.|||=.+|.+.-.---+|.    ..|-||+-+|.+
T Consensus       250 ~~~te~~~~nlegdNnq~kfGir~~F~----~~~IM~~~il~~  288 (670)
T TIGR00602       250 IIITESELNNLEGDNNQDKFGIRLLFP----AVTIMNKEILEE  288 (670)
T ss_pred             EEEECCCCCCCCCCCCCHHCCCCCCCC----HHHHHHHHHHCC
T ss_conf             997124344457755510104101352----577752665407


No 329
>TIGR02012 tigrfam_recA protein RecA; InterPro: IPR001553   The recA gene product is a multifunctional enzyme that plays a role in homologous recombination, DNA repair and induction of the SOS response . In homologous recombination, the protein functions as a DNA-dependent ATPase, promoting synapsis, heteroduplex formation and strand exchange between homologous DNAs . RecA also acts as a protease cofactor that promotes autodigestion of the lexA product and phage repressors. The proteolytic inactivation of the lexA repressor by an activated form of recA may cause a derepression of the 20 or so genes involved in the SOS response, which regulates DNA repair, induced mutagenesis, delayed cell division and prophage induction in response to DNA damage .    RecA is a protein of about 350 amino-acid residues. Its sequence is very well conserved , ,  among eubacterial species. It is also found in the chloroplast of plants . RecA-like proteins are found in archaea and diverse eukaryotic organisms, like fission yeast, mouse or human. In the filament visualised by X-ray crystallography, -strand 3, the loop C-terminal to -strand 2, and alpha-helix D of the core domain form one surface that packs against alpha-helix A and -strand 0 (the N-terminal domain) of an adjacent monomer during polymerisation [Lusetti and Cox, Annu. Rev. Biochem. 2002. 71:71-100.]. The core ATP-binding site domain is well conserved, with 14 invariant residues. It contains the nucleotide binding loop between -strand 1 and alpha-helix C. The Escherichia coli sequence GPESSGKT matches the consensus sequence of amino acids (G/A)XXXXGK(T/S) for the Walker A box (also referred to as the P-loop) found in a number of nucleoside triphosphate (NTP)-binding proteins. Another nucleotide binding motif, the Walker B box is found at -strand 4 in the RecA structure. The Walker B box is characterised by four hydrophobic amino acids followed by an acidic residue (usually aspartate). Nucleotide specificity and additional ATP binding interactions are contributed by the amino acid residues at -strand 2 and the loop C-terminal to that strand, all of which are greater than 90
Probab=92.37  E-value=0.17  Score=29.64  Aligned_cols=133  Identities=19%  Similarity=0.279  Sum_probs=85.5

Q ss_pred             EEEEEEECCCCCCCCCEEEEEECCCCCCHHHH-HHHHHHHHHHHHCCCCCCHHHCCCCCCCEEEEE-EECC-CCCCCCCC
Q ss_conf             44345635877776643999967784407899-999999999997198530353206822105676-5237-66113853
Q gi|254780750|r  635 IANDCDLSCPNDKNSGKLWLLTGPNMGGKSTF-LRQNALIVIMAQMGSYVPASYAHIGIVDKLFSR-VGSA-DNLASGRS  711 (920)
Q Consensus       635 VpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~-lRqval~vilAQiG~fVPA~~a~i~~~D~IftR-iGa~-D~l~~g~S  711 (920)
                      +.-|+-||..+- ..+|+.=|.||-.|||||+ |.-||-++=.--.-.||-|++|-    |..|++ +|.. |+|.-.|-
T Consensus        41 l~LD~AlG~GG~-P~GRi~EiYGpESsGKTTLal~~iA~~Qk~Gg~~afiDAEHAl----D~~YA~~LGv~~~~L~~sQP  115 (322)
T TIGR02012        41 LALDLALGVGGL-PKGRIIEIYGPESSGKTTLALHVIAEAQKAGGVAAFIDAEHAL----DPVYAKKLGVDIDNLLVSQP  115 (322)
T ss_pred             HHHHHHHCCCCC-CCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEECHHHC----CHHHHHHHCCCHHHHEEECC
T ss_conf             134355167989-8750799854898847899999999997439838998451303----77889983645247112088


Q ss_pred             HHHHHHHHHHHHHHHCCCCCEEEEECCCCCC----------CHHHHHH--HHHHHHHHH---HHHCCCEEEEECCC
Q ss_conf             2899999999999958998569993258898----------8056799--999999999---97269849997487
Q gi|254780750|r  712 TFMVEMIETASILNQATNQSFVILDEIGRGT----------ATLDGLS--IAWATIEYL---HETNRCRGLLATHF  772 (920)
Q Consensus       712 TF~vEm~e~~~IL~~at~~SLVllDElGrGT----------st~DG~a--iA~aile~l---~~~~~~~~lfaTHy  772 (920)
                      -.--.-.|+...|-+++.=-+|++|-+-.=|          +..-|+.  |-.--|..|   +++..+.++|.--.
T Consensus       116 d~GE~ALeI~~~L~rSgAvD~iVvDSVAAL~P~aEieGemgd~~~Gl~ARLMS~ALRKl~g~~~k~~t~~iFiNQ~  191 (322)
T TIGR02012       116 DTGEQALEIAETLVRSGAVDIIVVDSVAALVPKAEIEGEMGDSHVGLQARLMSQALRKLTGALSKSNTTLIFINQI  191 (322)
T ss_pred             CCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCEEEEEEHH
T ss_conf             8714699999998723761179973400138712317543544232578889999998887653205237640022


No 330
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda. Members of this protein family are Hda (Homologous to DnaA). These proteins are about half the length of DnaA and homologous over length of Hda. In the model species Escherichia coli, the initiation of DNA replication requires DnaA bound to ATP rather than ADP; Hda helps facilitate the conversion of DnaA-ATP to DnaA-ADP.
Probab=92.37  E-value=0.84  Score=24.44  Aligned_cols=96  Identities=16%  Similarity=0.187  Sum_probs=52.4

Q ss_pred             CEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHCCCCCCCEEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHCCC
Q ss_conf             43999967784407899999999999997198530353206822105676523766113853289999999999995899
Q gi|254780750|r  650 GKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHIGIVDKLFSRVGSADNLASGRSTFMVEMIETASILNQATN  729 (920)
Q Consensus       650 ~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a~i~~~D~IftRiGa~D~l~~g~STF~vEm~e~~~IL~~at~  729 (920)
                      .+.+.|.||-.+|||.+++.+|- .+.+. |-            ..+|..          ...|+-.+.   .++..-..
T Consensus        38 ~~~l~i~G~~GsGKTHLl~a~~~-~~~~~-~~------------~~~yl~----------~~~~~~~~~---~~l~~l~~   90 (226)
T TIGR03420        38 DRFLYLWGESGSGKSHLLQAACA-AAEER-GK------------SAIYLP----------LAELAQADP---EVLEGLEQ   90 (226)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHH-HHHCC-CC------------CEEEEC----------HHHHHHHHH---HHHHHCCC
T ss_conf             88699989999988999999999-98626-99------------579952----------999877539---99972744


Q ss_pred             CCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCH
Q ss_conf             85699932588988056799999999999972698499974875
Q gi|254780750|r  730 QSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFH  773 (920)
Q Consensus       730 ~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~  773 (920)
                      -.++++|.+-+=....+.--.-+-+..++.+. ++..+++.+.+
T Consensus        91 ~d~l~iDDi~~i~~~~~~e~~lF~l~N~~~~~-~~~ilits~~~  133 (226)
T TIGR03420        91 ADLVCLDDVEAIAGQPEWQEALFHLYNRVREA-GGRLLIAGRAA  133 (226)
T ss_pred             CCEEEEECHHHHCCCHHHHHHHHHHHHHHHHH-CCEEEEECCCC
T ss_conf             89999966333437837899999999999865-28289867888


No 331
>COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane]
Probab=92.28  E-value=0.18  Score=29.38  Aligned_cols=127  Identities=24%  Similarity=0.359  Sum_probs=64.5

Q ss_pred             EEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHCCCCCCCEEEE--EEEC--------C
Q ss_conf             44434563587777664399996778440789999999999999719853035320682210567--6523--------7
Q gi|254780750|r  634 FIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHIGIVDKLFS--RVGS--------A  703 (920)
Q Consensus       634 fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a~i~~~D~Ift--RiGa--------~  703 (920)
                      ++=+||++..    ..+-.+=|-|+|-+||||+||-++        |.+-|-+ -++.+--+|..  -+|+        .
T Consensus        41 ~aL~disf~i----~~Ge~vGiiG~NGaGKSTLlklia--------Gi~~Pt~-G~v~v~G~v~~li~lg~Gf~pelTGr  107 (249)
T COG1134          41 WALKDISFEI----YKGERVGIIGHNGAGKSTLLKLIA--------GIYKPTS-GKVKVTGKVAPLIELGAGFDPELTGR  107 (249)
T ss_pred             EEECCCEEEE----ECCCEEEEECCCCCCHHHHHHHHH--------CCCCCCC-CEEEECCEEEHHHHCCCCCCCCCCHH
T ss_conf             8752735886----079899898789985899999995--------8717988-25998146705644156778542058


Q ss_pred             CCC-----CCCCCH-----HHHHHHHHHHH----------------------HHHCCCCCEEEEEC-CCCCCCHHHHHHH
Q ss_conf             661-----138532-----89999999999----------------------99589985699932-5889880567999
Q gi|254780750|r  704 DNL-----ASGRST-----FMVEMIETASI----------------------LNQATNQSFVILDE-IGRGTATLDGLSI  750 (920)
Q Consensus       704 D~l-----~~g~ST-----F~vEm~e~~~I----------------------L~~at~~SLVllDE-lGrGTst~DG~ai  750 (920)
                      ||+     ..|.|.     .+-|..|-|.+                      +.-+.+---.|+|| |+-|+.++---|+
T Consensus       108 eNi~l~~~~lG~~~~ei~~~~~eIieFaELG~fi~~PvktYSSGM~aRLaFsia~~~~pdILllDEvlavGD~~F~~K~~  187 (249)
T COG1134         108 ENIYLRGLILGLTRKEIDEKVDEIIEFAELGDFIDQPVKTYSSGMYARLAFSVATHVEPDILLLDEVLAVGDAAFQEKCL  187 (249)
T ss_pred             HHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHCCHHHCCHHHHHHHHHHHHHHCCCCEEEEEHHHHCCCHHHHHHHH
T ss_conf             78999999846669999988899999987788761744112588999988875331378789986134407799999999


Q ss_pred             HHHHHHHHHHHCCCEEEEECCCHHHH
Q ss_conf             99999999972698499974875797
Q gi|254780750|r  751 AWATIEYLHETNRCRGLLATHFHELT  776 (920)
Q Consensus       751 A~aile~l~~~~~~~~lfaTHy~eL~  776 (920)
                      .  -++.+.++ ....+|++|-+...
T Consensus       188 ~--rl~e~~~~-~~tiv~VSHd~~~I  210 (249)
T COG1134         188 E--RLNELVEK-NKTIVLVSHDLGAI  210 (249)
T ss_pred             H--HHHHHHHC-CCEEEEEECCHHHH
T ss_conf             9--99999975-98799997887999


No 332
>COG1480 Predicted membrane-associated HD superfamily hydrolase [General function prediction only]
Probab=92.26  E-value=0.58  Score=25.61  Aligned_cols=76  Identities=14%  Similarity=0.277  Sum_probs=47.4

Q ss_pred             HHHHHHHHHHHHHHCCCE---EEEECCCHHHHHHHHHCCCEEEEEEEEEEECCEEEEEEEEEECCC------CCCHHHHH
Q ss_conf             999999999999726984---999748757976643068858999999960992778777744789------88778999
Q gi|254780750|r  748 LSIAWATIEYLHETNRCR---GLLATHFHELTDLSKSLKRFHNATLQVSDSNEGIIFLHKVIPGIA------DHSYGIQV  818 (920)
Q Consensus       748 ~aiA~aile~l~~~~~~~---~lfaTHy~eL~~l~~~~~~v~n~~~~~~~~~~~i~flykl~~G~~------~~Sygi~v  818 (920)
                      ..||.|-++.+    ||-   +-.++|||++..+.+-.--+.| .|.-...      ..++.|-.|      .-+.|.+.
T Consensus       498 AnLAEaAa~~I----Gan~lLaRVgayYHDIGK~~rP~~FiEN-Q~~g~N~------Hd~lsP~lSa~II~sHv~eGv~m  566 (700)
T COG1480         498 ANLAEAAAEEI----GANSLLARVGAYYHDIGKMKRPLFFIEN-QMGGKNP------HDDLSPQLSALIIISHVKEGVEM  566 (700)
T ss_pred             HHHHHHHHHHH----CCCHHHHHHHHHHHHCCCCCCCCCCCCC-CCCCCCC------CCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             77899999983----8863888887877501022588641111-1389997------66478788899999851568999


Q ss_pred             HHHCCCCHHHHHHHHH
Q ss_conf             9982999899999999
Q gi|254780750|r  819 GKLAGLPNTVISRAYD  834 (920)
Q Consensus       819 A~laG~p~~vi~~A~~  834 (920)
                      ||..|+|++|++-+.+
T Consensus       567 ar~y~lPq~iidii~e  582 (700)
T COG1480         567 AREYKLPQEIIDIIPE  582 (700)
T ss_pred             HHHCCCCHHHHHHHHH
T ss_conf             9983997799999998


No 333
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional
Probab=92.24  E-value=0.43  Score=26.59  Aligned_cols=33  Identities=24%  Similarity=0.216  Sum_probs=24.7

Q ss_pred             EEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHH
Q ss_conf             4443456358777766439999677844078999999
Q gi|254780750|r  634 FIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQN  670 (920)
Q Consensus       634 fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqv  670 (920)
                      +|=+|+++..    ..+...-|.||+.+||||+++-+
T Consensus       356 ~vL~~isl~I----~~G~~vaiVG~SGsGKSTL~~LL  388 (581)
T PRK11176        356 PALRNINFKI----PAGKTVALVGRSGSGKSTIANLL  388 (581)
T ss_pred             CCCCCCCCCC----CCCCEEECCCCCCCCHHHHHHHH
T ss_conf             2010663357----99944312289998678999999


No 334
>COG4604 CeuD ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism]
Probab=92.22  E-value=0.22  Score=28.83  Aligned_cols=72  Identities=29%  Similarity=0.321  Sum_probs=41.1

Q ss_pred             CCEEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHCCCCCCCEEEEEEECCCCCCCCCC
Q ss_conf             70444345635877776643999967784407899999999999997198530353206822105676523766113853
Q gi|254780750|r  632 KPFIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHIGIVDKLFSRVGSADNLASGRS  711 (920)
Q Consensus       632 ~~fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a~i~~~D~IftRiGa~D~l~~g~S  711 (920)
                      ..-|-+|+++..    ..+.+-=|-|||.+||||+|-.++=         .+|.++-++.+= .        -++   .+
T Consensus        13 ~~~vl~~isl~i----~~g~iTs~IGPNGAGKSTLLS~~sR---------L~~~d~G~i~i~-g--------~~~---~~   67 (252)
T COG4604          13 TKVVLDDVSLDI----PKGGITSIIGPNGAGKSTLLSMMSR---------LLKKDSGEITID-G--------LEL---TS   67 (252)
T ss_pred             CEEEECCCEEEE----CCCCEEEEECCCCCCHHHHHHHHHH---------HCCCCCCEEEEE-E--------EEC---CC
T ss_conf             777653614541----5886368888998648889999998---------526678638981-1--------662---56


Q ss_pred             HHHHHHHHHHHHHHHCC
Q ss_conf             28999999999999589
Q gi|254780750|r  712 TFMVEMIETASILNQAT  728 (920)
Q Consensus       712 TF~vEm~e~~~IL~~at  728 (920)
                      |=--|+...-.||++..
T Consensus        68 ~~s~~LAk~lSILkQ~N   84 (252)
T COG4604          68 TPSKELAKKLSILKQEN   84 (252)
T ss_pred             CCHHHHHHHHHHHHHHC
T ss_conf             87699999988987632


No 335
>KOG0057 consensus
Probab=92.21  E-value=0.87  Score=24.30  Aligned_cols=122  Identities=24%  Similarity=0.294  Sum_probs=68.1

Q ss_pred             EEEECCCCCCHHHHHHHHHHH-------------------HHHHHCCCCCCHHHCCC--CCCCEE-E-------------
Q ss_conf             999677844078999999999-------------------99997198530353206--822105-6-------------
Q gi|254780750|r  653 WLLTGPNMGGKSTFLRQNALI-------------------VIMAQMGSYVPASYAHI--GIVDKL-F-------------  697 (920)
Q Consensus       653 ~iiTGpNmgGKSt~lRqval~-------------------vilAQiG~fVPA~~a~i--~~~D~I-f-------------  697 (920)
                      .=|-|+|.+||||++|.+==.                   -=+-|+=.|||-++.-+  +++-.| |             
T Consensus       381 VaIvG~nGsGKSTilr~LlrF~d~sG~I~IdG~dik~~~~~SlR~~Ig~VPQd~~LFndTIl~NI~YGn~sas~eeV~e~  460 (591)
T KOG0057         381 VAIVGSNGSGKSTILRLLLRFFDYSGSILIDGQDIKEVSLESLRQSIGVVPQDSVLFNDTILYNIKYGNPSASDEEVVEA  460 (591)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHCCCCCEEECCEEHHHHCHHHHHHHEEEECCCCCCCCHHHHHHHHCCCCCCCHHHHHHH
T ss_conf             98978999878899999999744688599987337650757765221676776643006599886328987688999999


Q ss_pred             -EEEECCC---CCCCCCCHHHH---------HHHHHH---HHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             -7652376---61138532899---------999999---9999589985699932588988056799999999999972
Q gi|254780750|r  698 -SRVGSAD---NLASGRSTFMV---------EMIETA---SILNQATNQSFVILDEIGRGTATLDGLSIAWATIEYLHET  761 (920)
Q Consensus       698 -tRiGa~D---~l~~g~STF~v---------Em~e~~---~IL~~at~~SLVllDElGrGTst~DG~aiA~aile~l~~~  761 (920)
                       -|-|-+|   ++..|.+|---         |+..++   .+|++|-   .+++||-   ||..|-.+= ..+++.+.+.
T Consensus       461 ~k~a~~hd~i~~l~~GY~T~VGerG~~LSGGekQrvslaRa~lKda~---Il~~DEa---TS~LD~~TE-~~i~~~i~~~  533 (591)
T KOG0057         461 CKRAGLHDVISRLPDGYQTLVGERGLMLSGGEKQRVSLARAFLKDAP---ILLLDEA---TSALDSETE-REILDMIMDV  533 (591)
T ss_pred             HHHCCCHHHHHHCCCCCHHHHHHCCCCCCCCHHHHHHHHHHHHCCCC---EEEECCC---CCCCCHHHH-HHHHHHHHHH
T ss_conf             99728378887366630326753444256406789999999845898---6886376---532365669-9999999875


Q ss_pred             CCC-EEEEECCCHHHHHHHHH
Q ss_conf             698-49997487579766430
Q gi|254780750|r  762 NRC-RGLLATHFHELTDLSKS  781 (920)
Q Consensus       762 ~~~-~~lfaTHy~eL~~l~~~  781 (920)
                      ... .++|.-|-|.+..-.+.
T Consensus       534 ~~~rTvI~IvH~l~ll~~~Dk  554 (591)
T KOG0057         534 MSGRTVIMIVHRLDLLKDFDK  554 (591)
T ss_pred             CCCCEEEEEEECCHHHHCCCE
T ss_conf             179769999963034750888


No 336
>COG4615 PvdE ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism]
Probab=92.20  E-value=0.44  Score=26.54  Aligned_cols=151  Identities=21%  Similarity=0.257  Sum_probs=73.9

Q ss_pred             CCCEEC-CCCCCEEECCCCCHHHHHHHHHCCCCCEEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHC
Q ss_conf             851210-4787140000468058876310287704443456358777766439999677844078999999999999971
Q gi|254780750|r  601 YCRPII-DNSTNFIVKDGRHPIVEKTLKQQSSKPFIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQM  679 (920)
Q Consensus       601 y~rP~i-~~~~~l~i~~gRHPviE~~l~~~~~~~fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQi  679 (920)
                      +-+|+- -+=..+++++-|-.-.        ...|--|-|+|..    ..+-+..|+|-|.+||||+++-        -.
T Consensus       311 ~~~~q~~p~~~~lelrnvrfay~--------~~~FhvgPiNl~i----krGelvFliG~NGsGKST~~~L--------Lt  370 (546)
T COG4615         311 FPRPQAFPDWKTLELRNVRFAYQ--------DNAFHVGPINLTI----KRGELVFLIGGNGSGKSTLAML--------LT  370 (546)
T ss_pred             CCCCCCCCCCCCCEEEEEEECCC--------CCCCEECCEEEEE----ECCCEEEEECCCCCCHHHHHHH--------HH
T ss_conf             88877687545201320020367--------6552115613687----3373899988899638899999--------97


Q ss_pred             CCCCCHHHCC---------------CCCCCEEEEEEECCCCCCCCCC-------HHHHHHHHHHH---------------
Q ss_conf             9853035320---------------6822105676523766113853-------28999999999---------------
Q gi|254780750|r  680 GSYVPASYAH---------------IGIVDKLFSRVGSADNLASGRS-------TFMVEMIETAS---------------  722 (920)
Q Consensus       680 G~fVPA~~a~---------------i~~~D~IftRiGa~D~l~~g~S-------TF~vEm~e~~~---------------  722 (920)
                      |.|-|-+--.               =++|..||++.---|.+..+.-       +|..+-.|.++               
T Consensus       371 GL~~PqsG~I~ldg~pV~~e~ledYR~LfSavFsDyhLF~~ll~~e~~as~q~i~~~LqrLel~~ktsl~d~~fs~~kLS  450 (546)
T COG4615         371 GLYQPQSGEILLDGKPVSAEQLEDYRKLFSAVFSDYHLFDQLLGPEGKASPQLIEKWLQRLELAHKTSLNDGRFSNLKLS  450 (546)
T ss_pred             HCCCCCCCCEEECCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHEECCCCCCCCCCC
T ss_conf             06688888266789348844789999999999645652687629656798678999999998766500057863200045


Q ss_pred             ---------HHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEE-CCCH
Q ss_conf             ---------99958998569993258898805679999999999997269849997-4875
Q gi|254780750|r  723 ---------ILNQATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLA-THFH  773 (920)
Q Consensus       723 ---------IL~~at~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfa-THy~  773 (920)
                               ++--.-+|-..++||--.--+|.=.-- -|-++--+.+. .-+|+|| ||.-
T Consensus       451 tGQkKRlAll~AllEeR~Ilv~DEWAADQDPaFRR~-FY~~lLp~LK~-qGKTI~aIsHDd  509 (546)
T COG4615         451 TGQKKRLALLLALLEERDILVLDEWAADQDPAFRRE-FYQVLLPLLKE-QGKTIFAISHDD  509 (546)
T ss_pred             CCHHHHHHHHHHHHHHCCEEEEEHHHCCCCHHHHHH-HHHHHHHHHHH-HCCEEEEEECCC
T ss_conf             305878999999973098688601212467599999-99998599997-098599994473


No 337
>pfam05707 Zot Zonular occludens toxin (Zot). This family consists of bacterial and viral proteins which are very similar to the Zonular occludens toxin (Zot). Zot is elaborated by bacteriophages present in toxigenic strains of Vibrio cholerae. Zot is a single polypeptide chain of 44.8 kDa, with the ability to reversibly alter intestinal epithelial tight junctions, allowing the passage of macromolecules through mucosal barriers
Probab=92.15  E-value=0.88  Score=24.26  Aligned_cols=108  Identities=14%  Similarity=0.146  Sum_probs=50.9

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHCCCC-C-CCEEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHCCC
Q ss_conf             9999677844078999999999999971985303532068-2-2105676523766113853289999999999995899
Q gi|254780750|r  652 LWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHIG-I-VDKLFSRVGSADNLASGRSTFMVEMIETASILNQATN  729 (920)
Q Consensus       652 ~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a~i~-~-~D~IftRiGa~D~l~~g~STF~vEm~e~~~IL~~at~  729 (920)
                      +.+|||.+-+|||-+.=+--++--+ .-|..|-+.   |+ + .|+|....|..      ...|+ |..+....-+....
T Consensus         2 I~litG~pGsGKS~~aV~~~i~~al-~~GR~V~tN---I~gL~~~~~~~~~~~~------~~~~~-~~~~~~~~w~~~p~   70 (183)
T pfam05707         2 IYLITGKPGSGKTLEAVSYHILPAL-KKGRKVITN---IDGLNLERFPKVFGED------VRERL-EDIGYMDPWRTYPK   70 (183)
T ss_pred             EEEEECCCCCCCCHHHHHHHHHHHH-HCCCEEEEC---CCCCCCHHCCCCCCCC------CCCCC-CCCCCCHHHCCCCC
T ss_conf             7999359999622999999999998-789989987---8653522101223444------54320-00012223314999


Q ss_pred             CCEEEEECCCC-----CCCHHHHHHHHHHHHHHHHH--HCCCEEEEECCCHHH
Q ss_conf             85699932588-----98805679999999999997--269849997487579
Q gi|254780750|r  730 QSFVILDEIGR-----GTATLDGLSIAWATIEYLHE--TNRCRGLLATHFHEL  775 (920)
Q Consensus       730 ~SLVllDElGr-----GTst~DG~aiA~aile~l~~--~~~~~~lfaTHy~eL  775 (920)
                      .|||++||.++     ++...+     -..+++|..  +-|--.+|.|.-..+
T Consensus        71 g~liViDE~~~~~~~r~~~~~~-----~~~i~~l~~HRH~G~DiiliTQ~~~~  118 (183)
T pfam05707        71 GALLVIDEAQTWFPSRRGGDKV-----PPVLDAFSTHRHLGWDIILITQNPSK  118 (183)
T ss_pred             CCEEEEECCHHHCCCCCCCCCC-----CHHHHHHHHCCCCCCEEEEEECCHHH
T ss_conf             8799998976554887778888-----38999999807788208999189799


No 338
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated
Probab=92.09  E-value=0.9  Score=24.21  Aligned_cols=159  Identities=21%  Similarity=0.293  Sum_probs=86.6

Q ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHHHHHHCC---CCCCHHHCCCCCCCEE--EEEEECCCCCCCCCCHH-HHHHHHHHH
Q ss_conf             64399996778440789999999999999719---8530353206822105--67652376611385328-999999999
Q gi|254780750|r  649 SGKLWLLTGPNMGGKSTFLRQNALIVIMAQMG---SYVPASYAHIGIVDKL--FSRVGSADNLASGRSTF-MVEMIETAS  722 (920)
Q Consensus       649 ~~~~~iiTGpNmgGKSt~lRqval~vilAQiG---~fVPA~~a~i~~~D~I--ftRiGa~D~l~~g~STF-~vEm~e~~~  722 (920)
                      .+.+..+-||-..||||.+==+|--..|.+=+   .+|-++.-+|+=++++  |++|=       |..-. .-.-.|...
T Consensus       175 ~ggV~alVGPTGVGKTTTiAKLAAr~~l~~g~~kVaLIT~DTYRIgAvEQLktYa~Il-------gvPv~vv~~~~eL~~  247 (404)
T PRK06995        175 RGGVFALVGPTGVGKTTTTAKLAARCVMRHGASKVALLTTDSYRIGGHEQLRIYGKIL-------GVPVHAVKDAADLRL  247 (404)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHC-------CCEEEEECCHHHHHH
T ss_conf             4755898668887637589999999999838983799976875478999999999875-------955999599999999


Q ss_pred             HHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCC----EEEE-ECCCHHHHHHHHHCCCEEEEEEEEEEECC
Q ss_conf             999589985699932588988056799999999999972698----4999-74875797664306885899999996099
Q gi|254780750|r  723 ILNQATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRC----RGLL-ATHFHELTDLSKSLKRFHNATLQVSDSNE  797 (920)
Q Consensus       723 IL~~at~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~----~~lf-aTHy~eL~~l~~~~~~v~n~~~~~~~~~~  797 (920)
                      .|.....+-|||||=-||  |..|-. .. --++.|......    ++|= +|++..|.+....+..+...         
T Consensus       248 aL~~l~~~dlILIDTaGr--s~rD~~-~~-e~l~~l~~~~~~~~~~LVLsat~~~~dl~~i~~~f~~~~~~---------  314 (404)
T PRK06995        248 ALAELRNKHIVLIDTVGM--SQRDRM-VS-EQIAMLHGAGAPVQRLLLLNATSHGDTLNEVVQAYRGPGLA---------  314 (404)
T ss_pred             HHHHHCCCCEEEEECCCC--CCCCHH-HH-HHHHHHHHCCCCCEEEEEECCCCCHHHHHHHHHHHCCCCCC---------
T ss_conf             999708999999809998--976888-99-99999973578852899977989999999999984469998---------


Q ss_pred             EEEEEEEEEECCCCCCHH--HHHHHHCCCCHHHHHH
Q ss_conf             277877774478988778--9999982999899999
Q gi|254780750|r  798 GIIFLHKVIPGIADHSYG--IQVGKLAGLPNTVISR  831 (920)
Q Consensus       798 ~i~flykl~~G~~~~Syg--i~vA~laG~p~~vi~~  831 (920)
                      +++|+ ||=+-.   |||  ++++-..++|-.-+-.
T Consensus       315 ~~I~T-KLDEt~---~~G~iln~~~~~~lPlsy~T~  346 (404)
T PRK06995        315 GCILT-KLDEAA---SLGGALDTVIRHKLPLHYVSN  346 (404)
T ss_pred             EEEEE-CCCCCC---CHHHHHHHHHHHCCCEEEECC
T ss_conf             39983-040679---723999999997898599818


No 339
>COG3044 Predicted ATPase of the ABC class [General function prediction only]
Probab=91.97  E-value=0.18  Score=29.34  Aligned_cols=21  Identities=38%  Similarity=0.509  Sum_probs=18.5

Q ss_pred             EEEEECCCCCCHHHHHHHHHH
Q ss_conf             999967784407899999999
Q gi|254780750|r  652 LWLLTGPNMGGKSTFLRQNAL  672 (920)
Q Consensus       652 ~~iiTGpNmgGKSt~lRqval  672 (920)
                      +.+|||||.-||||++-.+.-
T Consensus       244 it~ItG~nfhGKTTLl~Aie~  264 (554)
T COG3044         244 ITLITGGNFHGKTTLLTAIER  264 (554)
T ss_pred             EEEEECCCCCCHHHHHHHHHH
T ss_conf             389855876662689999972


No 340
>KOG0743 consensus
Probab=91.92  E-value=0.85  Score=24.39  Aligned_cols=145  Identities=19%  Similarity=0.360  Sum_probs=83.9

Q ss_pred             CCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHCCCCCCCEEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHC
Q ss_conf             66439999677844078999999999999971985303532068221056765237661138532899999999999958
Q gi|254780750|r  648 NSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHIGIVDKLFSRVGSADNLASGRSTFMVEMIETASILNQA  727 (920)
Q Consensus       648 ~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a~i~~~D~IftRiGa~D~l~~g~STF~vEm~e~~~IL~~a  727 (920)
                      .-.|-.++.||-..||||++-.      |        |......|+|==.|-++..|              |+..+|..+
T Consensus       233 awKRGYLLYGPPGTGKSS~IaA------m--------An~L~ydIydLeLt~v~~n~--------------dLr~LL~~t  284 (457)
T KOG0743         233 AWKRGYLLYGPPGTGKSSFIAA------M--------ANYLNYDIYDLELTEVKLDS--------------DLRHLLLAT  284 (457)
T ss_pred             CCCCCCEEECCCCCCHHHHHHH------H--------HHHCCCCEEEEEECCCCCCH--------------HHHHHHHHC
T ss_conf             5000412047999988899999------9--------72058736774400236838--------------999999728


Q ss_pred             CCCCEEEEECCC-------CCCC---HHHH--HHHHHH-HHHHHHHHC--CC----EEEEECCCHHHHHHHHHCCCEEEE
Q ss_conf             998569993258-------8988---0567--999999-999999726--98----499974875797664306885899
Q gi|254780750|r  728 TNQSFVILDEIG-------RGTA---TLDG--LSIAWA-TIEYLHETN--RC----RGLLATHFHELTDLSKSLKRFHNA  788 (920)
Q Consensus       728 t~~SLVllDElG-------rGTs---t~DG--~aiA~a-ile~l~~~~--~~----~~lfaTHy~eL~~l~~~~~~v~n~  788 (920)
                      +++|.|+|--|-       |+..   .++|  .-+..+ .|..+ +-.  -|    -++|+|.|.|=-+-+--.|    .
T Consensus       285 ~~kSIivIEDIDcs~~l~~~~~~~~~~~~~~~~~VTlSGLLNfi-DGlwSscg~ERIivFTTNh~EkLDPALlRp----G  359 (457)
T KOG0743         285 PNKSILLIEDIDCSFDLRERRKKKKENFEGDLSRVTLSGLLNFL-DGLWSSCGDERIIVFTTNHKEKLDPALLRP----G  359 (457)
T ss_pred             CCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCEEEHHHHHHHH-CCCCCCCCCCEEEEEECCCHHHCCHHHCCC----C
T ss_conf             99718999612432304434555664546776606647756641-343004887349999468710068866288----7


Q ss_pred             EEEEEEECCEEEEEEEEEECCCCC-CHHHHHHHHCCCCHHHHHHHHHHHHHHHH
Q ss_conf             999996099277877774478988-77899999829998999999999999987
Q gi|254780750|r  789 TLQVSDSNEGIIFLHKVIPGIADH-SYGIQVGKLAGLPNTVISRAYDILKTFEK  841 (920)
Q Consensus       789 ~~~~~~~~~~i~flykl~~G~~~~-Sygi~vA~laG~p~~vi~~A~~~~~~le~  841 (920)
                      .|+           +++--|-|.- .|-.-...-.|+|+     ...+..++|+
T Consensus       360 RmD-----------mhI~mgyCtf~~fK~La~nYL~~~~-----~h~L~~eie~  397 (457)
T KOG0743         360 RMD-----------MHIYMGYCTFEAFKTLASNYLGIEE-----DHRLFDEIER  397 (457)
T ss_pred             CCE-----------EEEECCCCCHHHHHHHHHHHCCCCC-----CCHHHHHHHH
T ss_conf             522-----------5667266987999999998338988-----7306799998


No 341
>COG4161 ArtP ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism]
Probab=91.86  E-value=0.25  Score=28.30  Aligned_cols=36  Identities=39%  Similarity=0.639  Sum_probs=25.9

Q ss_pred             EEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             4434563587777664399996778440789999999999
Q gi|254780750|r  635 IANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIV  674 (920)
Q Consensus       635 VpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~v  674 (920)
                      +--||+|+++    ++..+++-||-.+||||++|..-|+-
T Consensus        17 ~lfdi~l~~~----~getlvllgpsgagkssllr~lnlle   52 (242)
T COG4161          17 ALFDITLDCP----EGETLVLLGPSGAGKSSLLRVLNLLE   52 (242)
T ss_pred             EEEEEEECCC----CCCEEEEECCCCCCHHHHHHHHHHHH
T ss_conf             0035532268----89779997788876467999988871


No 342
>KOG0979 consensus
Probab=91.77  E-value=0.24  Score=28.53  Aligned_cols=68  Identities=19%  Similarity=0.222  Sum_probs=32.3

Q ss_pred             CCCEEEEEECCCHHHHHHHHHHHHHHHCCEEECCCCCCCCCCC-------CCCCCHH-HHHHHHHHHHHCCCEEEEEEE
Q ss_conf             9929999808822200799999998618189107889988876-------2656176-699999999988985999950
Q gi|254780750|r   40 PDSLVFYRMGDFYELFFDDALLASRCLGITLTKRGKHLGKDIP-------MCGVPVH-TANHYIQKLIKIGHRIAICEQ  110 (920)
Q Consensus        40 ~D~il~fr~G~FYE~f~~DA~~aa~~L~i~lt~r~~~~~~~~p-------maGvP~~-~l~~yl~~Lv~~GykVaiveQ  110 (920)
                      |..|+=+++-.|-..=+ =-..-.+-||+.+.+-  +.|+.--       .+|=|.. --.+-+.-.|.+|-.+|-+|=
T Consensus        19 ~GsIvrI~l~NF~Ty~~-~e~~pgpsLNmIiGpN--GSGKSSiVcAIcLglgG~Pk~lGRak~VgeyIK~G~~~g~IEI   94 (1072)
T KOG0979          19 DGSIVRIELHNFLTYDH-TEFLPGPSLNMIIGPN--GSGKSSIVCAICLGLGGKPKLLGRAKKVGEYIKRGEDEGYIEI   94 (1072)
T ss_pred             CCCEEEEEEEEEEEEEE-EEECCCCCEEEEECCC--CCCCHHHHHHHHHHCCCCHHHCCCHHHHHHHHHCCCCCCEEEE
T ss_conf             98669999740044433-3443788612687789--8970488999999727974431435579999964776636999


No 343
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism]
Probab=91.65  E-value=0.23  Score=28.57  Aligned_cols=32  Identities=31%  Similarity=0.570  Sum_probs=16.2

Q ss_pred             EEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHH
Q ss_conf             443456358777766439999677844078999999
Q gi|254780750|r  635 IANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQN  670 (920)
Q Consensus       635 VpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqv  670 (920)
                      +-+|++|..    ..+-++++-||--+||||.||++
T Consensus        16 av~~v~l~I----~~gef~vliGpSGsGKTTtLkMI   47 (309)
T COG1125          16 AVDDVNLTI----EEGEFLVLIGPSGSGKTTTLKMI   47 (309)
T ss_pred             EEEEEEEEE----CCCEEEEEECCCCCCHHHHHHHH
T ss_conf             332225776----59728999878997578799999


No 344
>pfam00931 NB-ARC NB-ARC domain.
Probab=91.45  E-value=0.68  Score=25.11  Aligned_cols=174  Identities=14%  Similarity=0.115  Sum_probs=84.9

Q ss_pred             CCCEEEEEECCCCCCHHHHHHHHHHHHHH---HHCCCCCCHHH--CCCCCCCEEEEEEECCCCCCCCCCHHHHHHHHHHH
Q ss_conf             66439999677844078999999999999---97198530353--20682210567652376611385328999999999
Q gi|254780750|r  648 NSGKLWLLTGPNMGGKSTFLRQNALIVIM---AQMGSYVPASY--AHIGIVDKLFSRVGSADNLASGRSTFMVEMIETAS  722 (920)
Q Consensus       648 ~~~~~~iiTGpNmgGKSt~lRqval~vil---AQiG~fVPA~~--a~i~~~D~IftRiGa~D~l~~g~STF~vEm~e~~~  722 (920)
                      ++-+++=|.|+-.-||||+.|.+.=-.-.   -..-++|....  -...+...|+.+++..+.    .+.+. +..+.+.
T Consensus        17 ~~~~vI~I~G~gGiGKTtLA~~v~~~~~i~~~F~~~~wv~vs~~~~~~~i~~~i~~~l~~~~~----~~~~~-~~~~l~~   91 (285)
T pfam00931        17 ENLGVVGIVGMGGVGKTTLAKQIYNDDSVGGHFDSVAWVVVSKTYTEFRLQKDILQELGLDDS----DWVEK-NESELAV   91 (285)
T ss_pred             CCCEEEEEECCCCCCHHHHHHHHHCCHHHHHCCCEEEEEEECCCCCHHHHHHHHHHHHCCCCC----CCCCC-CHHHHHH
T ss_conf             895399988999563999999997165565059838999979766689999999998566654----55557-8999999


Q ss_pred             HHHH--CCCCCEEEEECCCCCCCHHHHHHHHHH-HHHHHH-HHCCCEEEEECCCHHHHHHHHHCCCEEEEEEEEEEECCE
Q ss_conf             9995--899856999325889880567999999-999999-726984999748757976643068858999999960992
Q gi|254780750|r  723 ILNQ--ATNQSFVILDEIGRGTATLDGLSIAWA-TIEYLH-ETNRCRGLLATHFHELTDLSKSLKRFHNATLQVSDSNEG  798 (920)
Q Consensus       723 IL~~--at~~SLVllDElGrGTst~DG~aiA~a-ile~l~-~~~~~~~lfaTHy~eL~~l~~~~~~v~n~~~~~~~~~~~  798 (920)
                      .|+.  .+++-||++|-+...   .+     |- +...+- ...||+.|++|...+++......  ...+.+..-..++.
T Consensus        92 ~l~~~L~~kr~LiVLDDVw~~---~~-----~~~l~~~~~~~~~gSrIIvTTR~~~V~~~~~~~--~~~~~l~~L~~~es  161 (285)
T pfam00931        92 KIKEALLRKRFLLVLDDVWEK---ND-----WDKIGVPFPDGENGSRVIVTTRSESVAGRMGGT--SKPHEVESLEPEES  161 (285)
T ss_pred             HHHHHHCCCCEEEEECCCCCH---HH-----HHHHHCCCCCCCCCCEEEEECCCHHHHHHCCCC--CCEEECCCCCHHHH
T ss_conf             999997279669996388878---99-----999734575789982799855758999873788--83476168987999


Q ss_pred             E-EEEEEEEECCCC-----CCHHHHHHH-HCCCCHHHHHHHHHHH
Q ss_conf             7-787777447898-----877899999-8299989999999999
Q gi|254780750|r  799 I-IFLHKVIPGIAD-----HSYGIQVGK-LAGLPNTVISRAYDIL  836 (920)
Q Consensus       799 i-~flykl~~G~~~-----~Sygi~vA~-laG~p~~vi~~A~~~~  836 (920)
                      . .|..+.-.+..+     ...|-++++ ..|+|-.+.--|..+.
T Consensus       162 ~~Lf~~~a~~~~~~~~~~l~~~~~~Iv~~C~GlPLai~~lg~~L~  206 (285)
T pfam00931       162 WELFSNKVFEKELPPCPELEEVAKEIVEKCKGLPLALKVLGGLLA  206 (285)
T ss_pred             HHHHHHHHCCCCCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHC
T ss_conf             999999846898999767999999999985899499999999971


No 345
>PRK09519 recA recombinase A; Reviewed
Probab=91.42  E-value=0.53  Score=25.94  Aligned_cols=10  Identities=20%  Similarity=0.557  Sum_probs=4.6

Q ss_pred             CCCHHHHHHH
Q ss_conf             9998999999
Q gi|254780750|r  823 GLPNTVISRA  832 (920)
Q Consensus       823 G~p~~vi~~A  832 (920)
                      |+.+.+|+.|
T Consensus       719 GVe~g~vrKs  728 (790)
T PRK09519        719 GVDQGLIRKS  728 (790)
T ss_pred             CCCCCEEECC
T ss_conf             3200401025


No 346
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism]
Probab=91.34  E-value=1.1  Score=23.64  Aligned_cols=126  Identities=24%  Similarity=0.268  Sum_probs=65.1

Q ss_pred             CEEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHCCCCCC------------CEEEEEE
Q ss_conf             0444345635877776643999967784407899999999999997198530353206822------------1056765
Q gi|254780750|r  633 PFIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHIGIV------------DKLFSRV  700 (920)
Q Consensus       633 ~fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a~i~~~------------D~IftRi  700 (920)
                      .-|=.++.|..    ..+.++.|-||--+||||+||+++-        .-=|-+ -++-++            ..|..||
T Consensus        21 ~~Ild~v~l~V----~~Gei~~iiGgSGsGKStlLr~I~G--------ll~P~~-GeI~i~G~~i~~ls~~~~~~ir~r~   87 (263)
T COG1127          21 RVILDGVDLDV----PRGEILAILGGSGSGKSTLLRLILG--------LLRPDK-GEILIDGEDIPQLSEEELYEIRKRM   87 (263)
T ss_pred             EEEECCCEEEE----CCCCEEEEECCCCCCHHHHHHHHHC--------CCCCCC-CEEEECCCCHHCCCHHHHHHHHHHE
T ss_conf             77862731355----0781899988988689999999856--------578988-7599847641104988999998435


Q ss_pred             EC---CCCCCCCCCHH------HH--------HHHHHH-----------------------------HHHH-HCCCCCEE
Q ss_conf             23---76611385328------99--------999999-----------------------------9999-58998569
Q gi|254780750|r  701 GS---ADNLASGRSTF------MV--------EMIETA-----------------------------SILN-QATNQSFV  733 (920)
Q Consensus       701 Ga---~D~l~~g~STF------~v--------Em~e~~-----------------------------~IL~-~at~~SLV  733 (920)
                      |-   +--|+...+.|      |-        ++.|++                             .+-| -|..-.|+
T Consensus        88 GvlFQ~gALFssltV~eNVafplre~~~lp~~~i~~lv~~KL~~VGL~~~~~~~~PsELSGGM~KRvaLARAialdPell  167 (263)
T COG1127          88 GVLFQQGALFSSLTVFENVAFPLREHTKLPESLIRELVLMKLELVGLRGAAADLYPSELSGGMRKRVALARAIALDPELL  167 (263)
T ss_pred             EEEEECCCCCCCCCHHHHHHEEHHHHCCCCHHHHHHHHHHHHHHCCCCHHHHHHCCHHHCCHHHHHHHHHHHHHCCCCEE
T ss_conf             17860561235565457310006864259999999999999986499856666393320435889999999986498779


Q ss_pred             EEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCC
Q ss_conf             993258898805679999999999997269849997487
Q gi|254780750|r  734 ILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHF  772 (920)
Q Consensus       734 llDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy  772 (920)
                      ++||--.|-+|.--..|. ..+..|-+..++.++..||.
T Consensus       168 ~~DEPtsGLDPI~a~~~~-~LI~~L~~~lg~T~i~VTHD  205 (263)
T COG1127         168 FLDEPTSGLDPISAGVID-ELIRELNDALGLTVIMVTHD  205 (263)
T ss_pred             EECCCCCCCCCCHHHHHH-HHHHHHHHHHCCEEEEEECC
T ss_conf             855997788830277999-99999998639879999777


No 347
>COG4717 Uncharacterized conserved protein [Function unknown]
Probab=91.29  E-value=0.15  Score=30.08  Aligned_cols=89  Identities=20%  Similarity=0.231  Sum_probs=48.4

Q ss_pred             HHHCCCCCCCEEEEEEECC---CCC----CCCCCHHHHHHHHH-H----------HHHHHCCCCCE-EEEECCCCCCCHH
Q ss_conf             3532068221056765237---661----13853289999999-9----------99995899856-9993258898805
Q gi|254780750|r  685 ASYAHIGIVDKLFSRVGSA---DNL----ASGRSTFMVEMIET-A----------SILNQATNQSF-VILDEIGRGTATL  745 (920)
Q Consensus       685 A~~a~i~~~D~IftRiGa~---D~l----~~g~STF~vEm~e~-~----------~IL~~at~~SL-VllDElGrGTst~  745 (920)
                      |...=.++.|.=||+|-.+   |+|    ..|.|-|..|++.- +          -|---.+.-+| +|+|-+.   -++
T Consensus       863 A~~~F~hlT~G~Yt~Iy~~e~~d~I~V~~~~G~~~~~~ELSqgT~EQLYlAlRfali~~~~~~~~LP~i~DD~f---VhF  939 (984)
T COG4717         863 ASEFFMHLTDGRYTGIYTQEDKDSIIVEHRAGGSKLAEELSQGTKEQLYLALRFALIHEVRTREPLPFIADDIF---VHF  939 (984)
T ss_pred             HHHHHHHCCCCCEEEEECCCCCCEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEECCCH---HCC
T ss_conf             99998642488523665356776058872365523589883657999999999988863135788875632300---005


Q ss_pred             HHHHHHHHHHHHHHHHC-CCEEEEECCCHHHHH
Q ss_conf             67999999999999726-984999748757976
Q gi|254780750|r  746 DGLSIAWATIEYLHETN-RCRGLLATHFHELTD  777 (920)
Q Consensus       746 DG~aiA~aile~l~~~~-~~~~lfaTHy~eL~~  777 (920)
                      |- .=+..++++|.+.. +--+++=||..+.++
T Consensus       940 D~-~R~~r~~e~l~dls~~~QviYFTCHe~~~d  971 (984)
T COG4717         940 DD-ERAKRMLELLADLSEGNQVIYFTCHEHTCD  971 (984)
T ss_pred             CH-HHHHHHHHHHHHHCCCCEEEEEEECHHHHC
T ss_conf             88-899999999997355780799970366541


No 348
>cd03242 ABC_RecF RecF is a recombinational DNA repair ATPase that maintains replication in the presence of DNA damage.  When replication is prematurely disrupted by DNA damage, several recF pathway gene products play critical roles processing the arrested replication fork, allowing it to resume and complete its task.  This CD represents the nucleotide binding domain of RecF.  RecF  belongs to a large superfamily of ABC transporters involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases with a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=91.17  E-value=0.23  Score=28.61  Aligned_cols=30  Identities=10%  Similarity=0.081  Sum_probs=15.2

Q ss_pred             CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             9985699932588988056799999999999972
Q gi|254780750|r  728 TNQSFVILDEIGRGTATLDGLSIAWATIEYLHET  761 (920)
Q Consensus       728 t~~SLVllDElGrGTst~DG~aiA~aile~l~~~  761 (920)
                      .....+|+|++..-=+..-    ..++++.|.+.
T Consensus       209 ~~~PilLlDDi~seLD~~r----~~~l~~~l~~~  238 (270)
T cd03242         209 GEYPVLLLDDVLAELDLGR----QAALLDAIEGR  238 (270)
T ss_pred             CCCCEEEECCHHHHHCHHH----HHHHHHHHCCC
T ss_conf             9997899723155409999----99999987018


No 349
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional
Probab=90.85  E-value=1.2  Score=23.32  Aligned_cols=127  Identities=20%  Similarity=0.293  Sum_probs=71.9

Q ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHHHHHHCC---CCCCHHHCCCCCCCE--EEEEE-ECCCCCCCCCCHHHHHHHHHHH
Q ss_conf             64399996778440789999999999999719---853035320682210--56765-2376611385328999999999
Q gi|254780750|r  649 SGKLWLLTGPNMGGKSTFLRQNALIVIMAQMG---SYVPASYAHIGIVDK--LFSRV-GSADNLASGRSTFMVEMIETAS  722 (920)
Q Consensus       649 ~~~~~iiTGpNmgGKSt~lRqval~vilAQiG---~fVPA~~a~i~~~D~--IftRi-Ga~D~l~~g~STF~vEm~e~~~  722 (920)
                      .+-+.-+-||-..||+|.+=-+|--..|-+=-   .+|-.+..+||-+++  +|.|| |-.=.+..       +-.|+..
T Consensus       347 ~gGv~AlvGpTGvGKTTT~aKlAa~~~~~~g~~~valit~DtyRiga~eQL~~y~~ilgvpv~~~~-------~~~~l~~  419 (557)
T PRK12727        347 RGGVIALVGPTGAGKTTTIAKLAQRFAAQHAPRDVALVTTDTQRVGGREQLHSYGRQLGIAVHEAD-------SAESLLD  419 (557)
T ss_pred             CCCEEEEECCCCCCCHHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHHHHHHCCEEEEEC-------CHHHHHH
T ss_conf             076478743777673117999999999973998189997266408799999999998397579828-------9999999


Q ss_pred             HHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHH--HCC-CEEEE-ECCCHHHHHHHHHCCCEE
Q ss_conf             99958998569993258898805679999999999997--269-84999-748757976643068858
Q gi|254780750|r  723 ILNQATNQSFVILDEIGRGTATLDGLSIAWATIEYLHE--TNR-CRGLL-ATHFHELTDLSKSLKRFH  786 (920)
Q Consensus       723 IL~~at~~SLVllDElGrGTst~DG~aiA~aile~l~~--~~~-~~~lf-aTHy~eL~~l~~~~~~v~  786 (920)
                      .|..-..+.|||||-.|+|-.  |-.-  ..-+..|..  .++ .++|= +||+..|.+....+..+.
T Consensus       420 ~l~~l~~~~lvliDTaG~~~r--d~~~--~~~~~~l~~~~~~~~~Lvl~a~~~~~~l~~~~~~~~~~~  483 (557)
T PRK12727        420 LLERLRDYKLVLIDTAGMGQR--DRAL--AAQLNWLRAARQVTSLLVLPANAHFSDLDEVVRRFAHAK  483 (557)
T ss_pred             HHHHHCCCCEEEEECCCCCCC--CHHH--HHHHHHHHCCCCCCEEEEEECCCCHHHHHHHHHHHCCCC
T ss_conf             999836999899949998846--9999--999998751477635999968899899999999853799


No 350
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit; InterPro: IPR005892   ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs.   ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain .    The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , .   The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , .   Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1).     This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea. This transport system belong to the larger ATP-Binding Cassette (ABC) transporter superfamily. The characteristic feature of these transporters is the obligatory coupling of ATP hydrolysis to substrate translocation.   Functionally, this transport system is involved in osmoregulation. Under conditions of stress, the organism recruits this transport system to accumulate glycine betaine and other solutes which offer osmo-protection. It has been demonstrated that glycine betaine uptake is accompanied by symport with sodium ions. The locus has been named variously as proU or opuA. A gene library from L. lactis functionally complements an Escherichia coli proU mutant. The complementing locus is similar to a opuA locus in Bacillus subtlis. This clarifies the differences in nomenclature.; GO: 0005524 ATP binding, 0015171 amino acid transmembrane transporter activity, 0006865 amino acid transport, 0016020 membrane.
Probab=90.84  E-value=0.27  Score=28.11  Aligned_cols=11  Identities=18%  Similarity=0.706  Sum_probs=6.4

Q ss_pred             CEECCCCCCEE
Q ss_conf             12104787140
Q gi|254780750|r  603 RPIIDNSTNFI  613 (920)
Q Consensus       603 rP~i~~~~~l~  613 (920)
                      -|+++++..+.
T Consensus       339 vpVVDE~~~~~  349 (372)
T TIGR01186       339 VPVVDEDQRLV  349 (372)
T ss_pred             EEEECCCCCEE
T ss_conf             66661456458


No 351
>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional
Probab=90.76  E-value=0.3  Score=27.75  Aligned_cols=33  Identities=18%  Similarity=0.147  Sum_probs=25.3

Q ss_pred             EEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHH
Q ss_conf             4434563587777664399996778440789999999
Q gi|254780750|r  635 IANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNA  671 (920)
Q Consensus       635 VpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqva  671 (920)
                      +=+|++|..    ..+.++=|-|+|-+||||++|.+.
T Consensus        22 Av~~Vsf~i----~~GEilgivGeSGsGKSTl~~~il   54 (327)
T PRK11022         22 AVDRISYSV----KQGEVVGIVGESGSGKSVSSLAIM   54 (327)
T ss_pred             EEECEEEEE----CCCCEEEEECCCCCHHHHHHHHHH
T ss_conf             984418798----899999999999878999999997


No 352
>COG4674 Uncharacterized ABC-type transport system, ATPase component [General function prediction only]
Probab=90.75  E-value=0.11  Score=31.06  Aligned_cols=45  Identities=18%  Similarity=0.184  Sum_probs=29.4

Q ss_pred             CCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHH
Q ss_conf             985699932588988056799999999999972698499974875797
Q gi|254780750|r  729 NQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFHELT  776 (920)
Q Consensus       729 ~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~  776 (920)
                      +--|.|+||--.|-.-.+-...|. .+..|.  .+|..+..-|.-+..
T Consensus       165 ~P~lLLlDEPvAGMTd~Et~~tae-Ll~~la--~~hsilVVEHDM~Fv  209 (249)
T COG4674         165 DPKLLLLDEPVAGMTDAETEKTAE-LLKSLA--GKHSILVVEHDMGFV  209 (249)
T ss_pred             CCCEEEECCCCCCCCHHHHHHHHH-HHHHHH--CCCEEEEEECCHHHH
T ss_conf             886788558657885788999999-999873--174499994537999


No 353
>pfam02463 SMC_N RecF/RecN/SMC N terminal domain. This domain is found at the N terminus of SMC proteins. The SMC (structural maintenance of chromosomes) superfamily proteins have ATP-binding domains at the N- and C-termini, and two extended coiled-coil domains separated by a hinge in the middle. The eukaryotic SMC proteins form two kind of heterodimers: the SMC1/SMC3 and the SMC2/SMC4 types. These heterodimers constitute an essential part of higher order complexes, which are involved in chromatin and DNA dynamics. This family also includes the RecF and RecN proteins that are involved in DNA metabolism and recombination.
Probab=90.60  E-value=0.29  Score=27.87  Aligned_cols=12  Identities=0%  Similarity=-0.050  Sum_probs=4.6

Q ss_pred             CCHHHHHHHHHH
Q ss_conf             587899999852
Q gi|254780750|r  180 SNHDRLISDIMR  191 (920)
Q Consensus       180 ~~~d~l~~~L~~  191 (920)
                      ++..++.+.|..
T Consensus       117 ~~~~dv~~ll~~  128 (1162)
T pfam02463       117 VTKKDVAELLES  128 (1162)
T ss_pred             CCHHHHHHHHHH
T ss_conf             379999999997


No 354
>COG4637 Predicted ATPase [General function prediction only]
Probab=90.58  E-value=0.36  Score=27.21  Aligned_cols=124  Identities=20%  Similarity=0.185  Sum_probs=68.4

Q ss_pred             EECCCCCCHHHHHHHHH---HHHHHHHCCCCCCH-HHCCCCCC-----CEEEEEEECCC-----CCCCCCCHHHHHHHHH
Q ss_conf             96778440789999999---99999971985303-53206822-----10567652376-----6113853289999999
Q gi|254780750|r  655 LTGPNMGGKSTFLRQNA---LIVIMAQMGSYVPA-SYAHIGIV-----DKLFSRVGSAD-----NLASGRSTFMVEMIET  720 (920)
Q Consensus       655 iTGpNmgGKSt~lRqva---l~vilAQiG~fVPA-~~a~i~~~-----D~IftRiGa~D-----~l~~g~STF~vEm~e~  720 (920)
                      =||-||+-==-+||++.   .-.|.|-+- .+|- ...+-.|.     .=.|+.=|-.|     -++.|.=-||.    .
T Consensus       207 ~tG~nlAs~l~~lR~t~~D~~q~i~~v~~-aFpG~~~~~~~P~~~g~~~l~~~d~~~~~P~~~~eLSDGTlRfl~----l  281 (373)
T COG4637         207 PTGDNLASVLYTLRETHPDIFQLIEAVMD-AFPGIRLLEPKPGEDGRIELKWQDRGFLDPFRDRELSDGTLRFLA----L  281 (373)
T ss_pred             CCHHHHHHHHHHHHHHCCHHHHHHHHHHH-CCCCCHHCCCCCCCCCEEEEEECCCCCCCCHHHHHCCCCHHHHHH----H
T ss_conf             85455999999998708209999999886-079712135898767258999616666675044203533899999----9


Q ss_pred             HHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHCCCEE
Q ss_conf             999995899856999325889880567999999999999726984999748757976643068858
Q gi|254780750|r  721 ASILNQATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFHELTDLSKSLKRFH  786 (920)
Q Consensus       721 ~~IL~~at~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~~l~~~~~~v~  786 (920)
                      +..|-+-.+.-|+++||---+--|.==-++|.-+-++=  + .+-++++||-.+|....+..+.+.
T Consensus       282 ~t~Llsp~~p~ll~ldEPE~sLHP~lL~~La~~~~sAa--k-~sQv~VsTHS~rLl~~~e~~~v~~  344 (373)
T COG4637         282 ATLLLSPRPPPLLLLDEPETSLHPDLLPALAELMRSAA--K-RSQVIVSTHSPRLLNAVEEHSVFW  344 (373)
T ss_pred             HHHHCCCCCCCEEEECCCCCCCCHHHHHHHHHHHHHHH--C-CCEEEEEECCHHHHHHCCCCCEEE
T ss_conf             99983999996267458523358769999999999862--0-551899827799995356364588


No 355
>TIGR02533 type_II_gspE general secretory pathway protein E; InterPro: IPR013369    GspE, the E protein of the type II secretion system, is also referred to as the main terminal branch of the general secretion pathway. ; GO: 0005524 ATP binding, 0008565 protein transporter activity, 0015628 protein secretion by the type II secretion system, 0015627 type II protein secretion system complex.
Probab=90.47  E-value=0.16  Score=29.88  Aligned_cols=19  Identities=42%  Similarity=0.600  Sum_probs=16.7

Q ss_pred             EEEEECCCCCCHHHHHHHH
Q ss_conf             9999677844078999999
Q gi|254780750|r  652 LWLLTGPNMGGKSTFLRQN  670 (920)
Q Consensus       652 ~~iiTGpNmgGKSt~lRqv  670 (920)
                      +.|+|||=-|||||.|=..
T Consensus       247 IiLVTGPTGSGKtTTLYaa  265 (495)
T TIGR02533       247 IILVTGPTGSGKTTTLYAA  265 (495)
T ss_pred             EEEECCCCCCCHHHHHHHH
T ss_conf             1884177898525889999


No 356
>pfam01637 Arch_ATPase Archaeal ATPase. This family contain a conserved P-loop motif that is involved in binding ATP. This family is almost exclusively found in archaebacteria and particularly in Methanococcus jannaschii that encodes sixteen members of this family.
Probab=90.28  E-value=1.3  Score=22.97  Aligned_cols=24  Identities=25%  Similarity=0.385  Sum_probs=20.2

Q ss_pred             CCEEEEEECCCCCCHHHHHHHHHH
Q ss_conf             643999967784407899999999
Q gi|254780750|r  649 SGKLWLLTGPNMGGKSTFLRQNAL  672 (920)
Q Consensus       649 ~~~~~iiTGpNmgGKSt~lRqval  672 (920)
                      ...+.+|+||=..|||++++.++-
T Consensus        19 ~~~~ivi~G~RR~GKTsLi~~~~~   42 (223)
T pfam01637        19 TYPIIVVYGPRRCGKTALLREFLE   42 (223)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHH
T ss_conf             971899986887879999999998


No 357
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional
Probab=90.18  E-value=0.79  Score=24.63  Aligned_cols=89  Identities=17%  Similarity=0.274  Sum_probs=46.9

Q ss_pred             CCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCC---CCCHHHCCCCCCCEEE--EE-EECCCCCCCCCCHHHHHHHHHH
Q ss_conf             6643999967784407899999999999997198---5303532068221056--76-5237661138532899999999
Q gi|254780750|r  648 NSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGS---YVPASYAHIGIVDKLF--SR-VGSADNLASGRSTFMVEMIETA  721 (920)
Q Consensus       648 ~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~---fVPA~~a~i~~~D~If--tR-iGa~D~l~~g~STF~vEm~e~~  721 (920)
                      ..+++.++-|||.+||||.+==.|-  .+.+-|-   .|.|+..+.+-+|++-  .+ +|.  .+..+.+  -.++....
T Consensus       204 ~~g~VIaLVGvnGvGKTTTiAKLA~--~l~~~gkkV~LVAaDTFRaAAiEQLk~~g~rlgV--pV~~~~d--pa~l~~av  277 (407)
T PRK12726        204 SNHRIISLIGQTGVGKTTTLVKLGW--QLLKQNRTVGFITTDTFRSGAVEQFQGYADKLDV--ELIVATS--PAELEEAV  277 (407)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHH--HHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCC--EEEEECC--HHHHHHHH
T ss_conf             3690899989998978999999999--9997799179997066778899999999999796--4998188--89999999


Q ss_pred             HHHHHCCCCCEEEEECCCCCC
Q ss_conf             999958998569993258898
Q gi|254780750|r  722 SILNQATNQSFVILDEIGRGT  742 (920)
Q Consensus       722 ~IL~~at~~SLVllDElGrGT  742 (920)
                      .-+..+...-+||+|=-||--
T Consensus       278 ~~~a~~~~~DvVIIDTAGRl~  298 (407)
T PRK12726        278 QYMTYVNCVDHILIDTVGRNY  298 (407)
T ss_pred             HHHHHCCCCCEEEEECCCCCC
T ss_conf             999862899989996999881


No 358
>PRK04296 thymidine kinase; Provisional
Probab=90.17  E-value=1.1  Score=23.70  Aligned_cols=147  Identities=20%  Similarity=0.249  Sum_probs=71.6

Q ss_pred             CEEEEEECCCCCCHHHHHHHHHHHHHHHH--CCCCCCHHHCCCCCCCEEEEEEECCC-CCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             43999967784407899999999999997--19853035320682210567652376-6113853289999999999995
Q gi|254780750|r  650 GKLWLLTGPNMGGKSTFLRQNALIVIMAQ--MGSYVPASYAHIGIVDKLFSRVGSAD-NLASGRSTFMVEMIETASILNQ  726 (920)
Q Consensus       650 ~~~~iiTGpNmgGKSt~lRqval~vilAQ--iG~fVPA~~a~i~~~D~IftRiGa~D-~l~~g~STF~vEm~e~~~IL~~  726 (920)
                      +++-+||||=.|||||-|=+.+-..-.|.  +=.|.|+---+.+- +.|-||.|..- .+.-..+   .++.+.-.....
T Consensus         2 g~L~~i~GpMfSGKTteLi~~~~~~~~~gkkvl~~kp~~D~Ry~~-~~I~Sh~g~~~~~~~v~~~---~~i~~~~~~~~~   77 (197)
T PRK04296          2 AKLYFIYGAMNSGKSTELLQRAYNYEERGMKVLVFTPAIDDRYGE-GKVVSRIGLSREAILISSD---TDIFELIEEEHE   77 (197)
T ss_pred             CEEEEEECCCCCHHHHHHHHHHHHHHHCCCEEEEEEECCCCCCCC-CCEECCCCCEEEEEEECCH---HHHHHHHHHHHC
T ss_conf             559999934278889999999999998799599998534465777-8578678983468994878---999999987630


Q ss_pred             CCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCC---CEEEEECC----CHHHHHH---HHHCCCEEEEEEEEEEEC
Q ss_conf             8998569993258898805679999999999997269---84999748----7579766---430688589999999609
Q gi|254780750|r  727 ATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNR---CRGLLATH----FHELTDL---SKSLKRFHNATLQVSDSN  796 (920)
Q Consensus       727 at~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~---~~~lfaTH----y~eL~~l---~~~~~~v~n~~~~~~~~~  796 (920)
                      ...-..|.+||.=-=+. .+    ...+++.+.+...   |.+|=.+.    |.....|   ++....+...+...   +
T Consensus        78 ~~~~dvI~IDEaQFf~~-~~----i~~~~~~~~~~~~~Viv~GLd~Df~~~~F~~~~~Li~~Ad~V~kl~a~C~~C---g  149 (197)
T PRK04296         78 GGKIDCVLIDEAQFLDK-EQ----VVQLAEVVDDLGIPVICYGLDTDFRGEPFEGSPYLLALADKVTELKAICVHC---G  149 (197)
T ss_pred             CCCCCEEEECCHHCCCH-HH----HHHHHHHHHHCCCEEEEEEECCCCCCCCCHHHHHHHHHCCCEEEEEEECCCC---C
T ss_conf             47856899720212798-99----9999999983185899976503302486543999997268099974397789---9


Q ss_pred             CEEEEEEEEEEC
Q ss_conf             927787777447
Q gi|254780750|r  797 EGIIFLHKVIPG  808 (920)
Q Consensus       797 ~~i~flykl~~G  808 (920)
                      ..=+|.+|+.+|
T Consensus       150 ~~A~fs~R~~~~  161 (197)
T PRK04296        150 RKATMTQRLING  161 (197)
T ss_pred             CEEEEEEEECCC
T ss_conf             931017999489


No 359
>pfam08298 AAA_PrkA PrkA AAA domain. This is a family of PrkA bacterial and archaeal serine kinases approximately 630 residues long. This is the N-terminal AAA domain.
Probab=90.11  E-value=0.31  Score=27.67  Aligned_cols=21  Identities=33%  Similarity=0.577  Sum_probs=10.8

Q ss_pred             CCEEEEEECCCCCCHHHHHHH
Q ss_conf             643999967784407899999
Q gi|254780750|r  649 SGKLWLLTGPNMGGKSTFLRQ  669 (920)
Q Consensus       649 ~~~~~iiTGpNmgGKSt~lRq  669 (920)
                      ..+++++-||+.|||||+.+.
T Consensus        84 ~kqIllL~GPVGsGKSsl~e~  104 (358)
T pfam08298        84 RKQILYLLGPVGGGKSSLAER  104 (358)
T ss_pred             CEEEEEEECCCCCCHHHHHHH
T ss_conf             105899977898775899999


No 360
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair]
Probab=90.11  E-value=1.4  Score=22.87  Aligned_cols=107  Identities=24%  Similarity=0.225  Sum_probs=57.0

Q ss_pred             EEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHCC-----------CCCCCEEEEEEECCCCCCCCCCHHHHHHHH
Q ss_conf             399996778440789999999999999719853035320-----------682210567652376611385328999999
Q gi|254780750|r  651 KLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAH-----------IGIVDKLFSRVGSADNLASGRSTFMVEMIE  719 (920)
Q Consensus       651 ~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a~-----------i~~~D~IftRiGa~D~l~~g~STF~vEm~e  719 (920)
                      ..+++.||.-.||+|...-+|     ..++|..|-....           .+-... |..+.++|.=..  + ..+|  +
T Consensus        25 halL~~Gp~G~Gktt~a~~lA-----~~l~~~~~~~~~~~~~~~~~~~~~~~~~~d-~lel~~s~~~~~--~-i~~~--~   93 (325)
T COG0470          25 HALLFYGPPGVGKTTAALALA-----KELLCENPTGLLPCGHCRSCKLIPAGNHPD-FLELNPSDLRKI--D-IIVE--Q   93 (325)
T ss_pred             CCEEEECCCCCCHHHHHHHHH-----HHHCCCCCCCCCCCCHHHHHHHHCCCCCCC-EEEECCCCCCCC--C-CHHH--H
T ss_conf             610037999997899999999-----996586643345520022444320256886-599773213333--0-0699--9


Q ss_pred             HHHHHHHC------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHH-CCCEEEEECCCH
Q ss_conf             99999958------9985699932588988056799999999999972-698499974875
Q gi|254780750|r  720 TASILNQA------TNQSFVILDEIGRGTATLDGLSIAWATIEYLHET-NRCRGLLATHFH  773 (920)
Q Consensus       720 ~~~IL~~a------t~~SLVllDElGrGTst~DG~aiA~aile~l~~~-~~~~~lfaTHy~  773 (920)
                      +..+.+..      +..=+||+||.-+-|.  |.   |-|.+..+.+. ..++.+++||+.
T Consensus        94 vr~~~~~~~~~~~~~~~kviiidead~mt~--~A---~nallk~lEep~~~~~~il~~n~~  149 (325)
T COG0470          94 VRELAEFLSESPLEGGYKVVIIDEADKLTE--DA---ANALLKTLEEPPKNTRFILITNDP  149 (325)
T ss_pred             HHHHHHHCCCCCCCCCCEEEEEECCCCCCH--HH---HHHHHHHCCCCCCCEEEEEEECCH
T ss_conf             999998604465667726999732032698--88---876754332488871699974985


No 361
>pfam00265 TK Thymidine kinase.
Probab=90.08  E-value=0.6  Score=25.52  Aligned_cols=142  Identities=17%  Similarity=0.169  Sum_probs=70.1

Q ss_pred             CEEEEEECCCCCCHHHHHHHHHHHHHHHHCC--CCCCHHHCCCCCCCEEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHC
Q ss_conf             4399996778440789999999999999719--85303532068221056765237661138532899999999999958
Q gi|254780750|r  650 GKLWLLTGPNMGGKSTFLRQNALIVIMAQMG--SYVPASYAHIGIVDKLFSRVGSADNLASGRSTFMVEMIETASILNQA  727 (920)
Q Consensus       650 ~~~~iiTGpNmgGKSt~lRqval~vilAQiG--~fVPA~~a~i~~~D~IftRiGa~D~l~~g~STF~vEm~e~~~IL~~a  727 (920)
                      +++-+|+||=-|||||-|=+.+-..-.++--  .+-|+.--+.+- +.|-||.|..=.   ..........+...++  .
T Consensus         1 G~L~~i~GpMfsGKTteLi~~~~~~~~~gkkvl~i~p~~D~R~~~-~~i~Sh~g~~~~---~~~~~~~~~~~~~~~~--~   74 (175)
T pfam00265         1 GSIELIIGPMFSGKSTELIRRVYRYQLAQYKCVVIKYAIDNRYGT-GKVVTHDGISME---AKLIKTSLLDDIKDII--S   74 (175)
T ss_pred             CEEEEEECCCCCHHHHHHHHHHHHHHHCCCEEEEEEECCCCCCCC-CEEECCCCCCCC---CEECCCCHHHHHHHHH--C
T ss_conf             949999925177899999999999998799399994611277899-969889998114---5673653199999864--3


Q ss_pred             CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEE---CC-----CHHHHHH---HHHCCCEEEEEEEEEEEC
Q ss_conf             998569993258898805679999999999997269849997---48-----7579766---430688589999999609
Q gi|254780750|r  728 TNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLA---TH-----FHELTDL---SKSLKRFHNATLQVSDSN  796 (920)
Q Consensus       728 t~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfa---TH-----y~eL~~l---~~~~~~v~n~~~~~~~~~  796 (920)
                      .+-..|++||.---+    .   ...+++.+.+. +-.++.+   +-     |.+...|   ++....+.-.++..   +
T Consensus        75 ~~~dvI~IDEaQFf~----~---l~~~~~~~~~~-~~~Viv~GLd~D~~~~~F~~i~~Li~~Ad~V~kl~a~C~~C---g  143 (175)
T pfam00265        75 NTIHVVGIDEAQFFD----D---IVEFCETMANL-GKIVIVAGLDGDFQRKPFGNILNLLPLAEKVTKLKAVCMKC---Y  143 (175)
T ss_pred             CCCCEEEEEHHHHHH----H---HHHHHHHHHHC-CCEEEEEEEECCCCCCCCHHHHHHHHHCCEEEEEEEEECCC---C
T ss_conf             687899983377526----4---89999999967-99499987503011585447999996279699980493899---9


Q ss_pred             CEEEEEEEEEEC
Q ss_conf             927787777447
Q gi|254780750|r  797 EGIIFLHKVIPG  808 (920)
Q Consensus       797 ~~i~flykl~~G  808 (920)
                      ..-+|.+|+..+
T Consensus       144 ~~A~~t~R~~~~  155 (175)
T pfam00265       144 KDASFTKRLNNE  155 (175)
T ss_pred             CEEEEEEEECCC
T ss_conf             961068988599


No 362
>COG4778 PhnL ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism]
Probab=90.05  E-value=0.4  Score=26.86  Aligned_cols=33  Identities=39%  Similarity=0.580  Sum_probs=25.4

Q ss_pred             EEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHH
Q ss_conf             4434563587777664399996778440789999999
Q gi|254780750|r  635 IANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNA  671 (920)
Q Consensus       635 VpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqva  671 (920)
                      |-++++++.    +.+-+.++.||-.+||||+||+.=
T Consensus        26 V~~~vslsV----~aGECvvL~G~SG~GKStllr~LY   58 (235)
T COG4778          26 VLRNVSLSV----NAGECVVLHGPSGSGKSTLLRSLY   58 (235)
T ss_pred             EEECEEEEE----CCCCEEEEECCCCCCHHHHHHHHH
T ss_conf             340415776----375079966898876889999998


No 363
>KOG1970 consensus
Probab=89.97  E-value=0.27  Score=28.11  Aligned_cols=25  Identities=24%  Similarity=0.398  Sum_probs=13.0

Q ss_pred             CCCCCHHHHHHHHHHHHHHHHCCCC
Q ss_conf             7844078999999999999971985
Q gi|254780750|r  658 PNMGGKSTFLRQNALIVIMAQMGSY  682 (920)
Q Consensus       658 pNmgGKSt~lRqval~vilAQiG~f  682 (920)
                      |--||++.++|..+-+.+.--||=.
T Consensus       516 p~ig~~~~avr~~~gi~~~~di~d~  540 (634)
T KOG1970         516 PRIGLLTVAVRNCAGISFINDIGDL  540 (634)
T ss_pred             CCCCCHHHHHHCCCCCHHHHHCCCC
T ss_conf             0014304655415530133303656


No 364
>KOG0996 consensus
Probab=89.87  E-value=1.4  Score=22.74  Aligned_cols=13  Identities=15%  Similarity=0.376  Sum_probs=7.9

Q ss_pred             CCEEEEEEEEECC
Q ss_conf             8455458999775
Q gi|254780750|r  124 SLVRRNVVRLVTP  136 (920)
Q Consensus       124 ~~v~R~Vt~IiTp  136 (920)
                      |+|.-..|.||-|
T Consensus       104 GPFHksFtaIvGP  116 (1293)
T KOG0996         104 GPFHKSFTAIVGP  116 (1293)
T ss_pred             CCCCCCCEEEECC
T ss_conf             6778773156789


No 365
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism]
Probab=89.81  E-value=0.37  Score=27.08  Aligned_cols=127  Identities=29%  Similarity=0.296  Sum_probs=63.9

Q ss_pred             EEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCC------C----------CCCHHHCCCCCCCEEEE
Q ss_conf             4434563587777664399996778440789999999999999719------8----------53035320682210567
Q gi|254780750|r  635 IANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMG------S----------YVPASYAHIGIVDKLFS  698 (920)
Q Consensus       635 VpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG------~----------fVPA~~a~i~~~D~Ift  698 (920)
                      |=.|++|..    ..+.|.-|-||--+||||+||-+|=+.- .+.|      -          ||+=+.+-+|.      
T Consensus        18 vl~~i~L~v----~~GEfvsilGpSGcGKSTLLriiAGL~~-p~~G~V~~~g~~v~~p~~~~~~vFQ~~~LlPW------   86 (248)
T COG1116          18 VLEDINLSV----EKGEFVAILGPSGCGKSTLLRLIAGLEK-PTSGEVLLDGRPVTGPGPDIGYVFQEDALLPW------   86 (248)
T ss_pred             EECCCEEEE----CCCCEEEEECCCCCCHHHHHHHHHCCCC-CCCCEEEECCCCCCCCCCCEEEEECCCCCCCH------
T ss_conf             760503587----7997999989997889999999968787-77755998882157899877999266764514------


Q ss_pred             EEECCCCCCC-----------------------CCCHHH--------HHHHHHHHHHH-HCCCCCEEEEECCCCCCCHHH
Q ss_conf             6523766113-----------------------853289--------99999999999-589985699932588988056
Q gi|254780750|r  699 RVGSADNLAS-----------------------GRSTFM--------VEMIETASILN-QATNQSFVILDEIGRGTATLD  746 (920)
Q Consensus       699 RiGa~D~l~~-----------------------g~STF~--------vEm~e~~~IL~-~at~~SLVllDElGrGTst~D  746 (920)
                       .-+.||+.-                       |.+-|.        -=|.+=..|.| -+++--+.||||-.--=+..-
T Consensus        87 -~Tv~~NV~l~l~~~~~~~~e~~~~a~~~L~~VgL~~~~~~~P~qLSGGMrQRVaiARAL~~~P~lLLlDEPFgALDalT  165 (248)
T COG1116          87 -LTVLDNVALGLELRGKSKAEARERAKELLELVGLAGFEDKYPHQLSGGMRQRVAIARALATRPKLLLLDEPFGALDALT  165 (248)
T ss_pred             -HHHHHHHEEHHHCCCCCHHHHHHHHHHHHHHCCCCCHHHCCCCCCCHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHH
T ss_conf             -6688443504412565617689999999997597421016960018479999999999714999798769741201999


Q ss_pred             HHHHHHHHHHHHHHHCCCEEEEECCCHH
Q ss_conf             7999999999999726984999748757
Q gi|254780750|r  747 GLSIAWATIEYLHETNRCRGLLATHFHE  774 (920)
Q Consensus       747 G~aiA~aile~l~~~~~~~~lfaTHy~e  774 (920)
                      -..+ +--+..|++..+..++|.||.-+
T Consensus       166 R~~l-q~~l~~lw~~~~~TvllVTHdi~  192 (248)
T COG1116         166 REEL-QDELLRLWEETRKTVLLVTHDVD  192 (248)
T ss_pred             HHHH-HHHHHHHHHHHCCEEEEEECCHH
T ss_conf             9999-99999999964988999908989


No 366
>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning]
Probab=89.78  E-value=0.32  Score=27.58  Aligned_cols=17  Identities=24%  Similarity=0.280  Sum_probs=8.6

Q ss_pred             EEECCCCCHHHHHHHHH
Q ss_conf             40000468058876310
Q gi|254780750|r  612 FIVKDGRHPIVEKTLKQ  628 (920)
Q Consensus       612 l~i~~gRHPviE~~l~~  628 (920)
                      +.+...++.-||..++.
T Consensus       525 i~v~~~y~~Aie~alG~  541 (1163)
T COG1196         525 IKVKEKYETALEAALGN  541 (1163)
T ss_pred             CCCCHHHHHHHHHHHCC
T ss_conf             26065799999999563


No 367
>TIGR01194 cyc_pep_trnsptr cyclic peptide transporter; InterPro: IPR005898   ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs.   ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain .    The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , .   The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , .   Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1).     Bacteria have elaborate pathways for the production of toxins and secondary metabolites. Many such compounds, including syringomycin and pyoverdine are synthesized on non-ribosomal templates consisting of a multienzyme complex. On several occasions the proteins of the complex and transporter protein are present on the same operon. Often times these compounds cross the biological membrane by specific transporters. This model describes a family of cyclic peptide transporters in bacteria. Syringomycin is an amphipathic, cyclic lipodepsipeptide when inserted into host causes formation of channels, permeable to a variety of cations. On the other hand, pyoverdine is a cyclic octa-peptidyl dihydroxyquinoline, which is efficient in sequestering iron for uptake.; GO: 0005524 ATP binding, 0015197 peptide transporter activity, 0015833 peptide transport, 0016021 integral to membrane.
Probab=89.73  E-value=0.39  Score=26.88  Aligned_cols=58  Identities=33%  Similarity=0.470  Sum_probs=36.7

Q ss_pred             CEEECCCCCHHHHHHHHHCCCCCEE--EEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHH
Q ss_conf             1400004680588763102877044--434563587777664399996778440789999999999999719853035
Q gi|254780750|r  611 NFIVKDGRHPIVEKTLKQQSSKPFI--ANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPAS  686 (920)
Q Consensus       611 ~l~i~~gRHPviE~~l~~~~~~~fV--pNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~  686 (920)
                      .+++++-|---    -..++..+|-  |-|..+      .++.+.-|-|-|.+||||+.|-.        +|.|.|-+
T Consensus       337 S~~L~~V~~~~----~~~~~S~~F~LGPI~L~I------~~G~~VyIVG~NGCGK~TL~K~l--------~GLY~PQ~  396 (555)
T TIGR01194       337 SLELKDVRYSY----KDVESSEGFALGPIDLRI------ASGDLVYIVGENGCGKSTLIKLL--------LGLYIPQE  396 (555)
T ss_pred             CEEEECEECCC----CCCCCCCCCCCCCCCCEE------ECCCEEEEECCCCCCHHHHHHHH--------HHCCCCCC
T ss_conf             20210000478----888888884217611257------43528999648897389999999--------72587876


No 368
>TIGR01420 pilT_fam twitching motility protein; InterPro: IPR006321   These represent the PilT subfamily of proteins related to GspE, a protein involved in type II secretion (also called the General Secretion Pathway). PilT is an apparent cytosolic ATPase associated with type IV pilus systems. It is not required for pilin biogenesis, but is required for twitching motility and social gliding behaviors, shown in some species, powered by pilus retraction . Members of this family may be found in some species that do not have type IV pili but have related structures for DNA uptake and natural transformation. ; GO: 0005524 ATP binding, 0006810 transport.
Probab=89.65  E-value=0.22  Score=28.81  Aligned_cols=65  Identities=28%  Similarity=0.272  Sum_probs=35.5

Q ss_pred             HHHHHHHHHHHHHHHHHC-C---------CCCEECCCCCCEEECCCCCH--HHHHHHHHCCCCCEEEEEEEECCCCCCCC
Q ss_conf             998677887788877525-8---------85121047871400004680--58876310287704443456358777766
Q gi|254780750|r  582 VIAIIDISIALAILAKEQ-N---------YCRPIIDNSTNFIVKDGRHP--IVEKTLKQQSSKPFIANDCDLSCPNDKNS  649 (920)
Q Consensus       582 ~ia~lD~l~SlA~~a~~~-~---------y~rP~i~~~~~l~i~~gRHP--viE~~l~~~~~~~fVpNdi~l~~~~~~~~  649 (920)
                      .=.++||.++++.+++=. |         .|.=. ..+....+++.+=|  |+..+..                    ..
T Consensus        68 ~~~E~Dfs~~~~~~~RfRvN~f~QRg~~a~vlR~-ip~~Ip~fe~LGLP~~v~~~~a~--------------------~~  126 (350)
T TIGR01420        68 ENGELDFSFSLPGLARFRVNAFKQRGGVALVLRL-IPSKIPTFEELGLPRPVLRELAE--------------------RP  126 (350)
T ss_pred             HCCCCCEEEEECCCCEEEEHHHHHCCHHHHHHHH-CCCCCCCHHHCCCCHHHHHHHHH--------------------CC
T ss_conf             5066444663067322122032350006423231-15346216663798789999983--------------------66


Q ss_pred             CEEEEEECCCCCCHHHHH
Q ss_conf             439999677844078999
Q gi|254780750|r  650 GKLWLLTGPNMGGKSTFL  667 (920)
Q Consensus       650 ~~~~iiTGpNmgGKSt~l  667 (920)
                      .-+.|+|||=-|||||.|
T Consensus       127 ~GLiLVTGPTGSGKSTTl  144 (350)
T TIGR01420       127 RGLILVTGPTGSGKSTTL  144 (350)
T ss_pred             CCCEEEECCCCCCHHHHH
T ss_conf             993898768898678999


No 369
>PRK06851 hypothetical protein; Provisional
Probab=89.65  E-value=0.42  Score=26.70  Aligned_cols=54  Identities=19%  Similarity=0.142  Sum_probs=35.2

Q ss_pred             CCCCEEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHCCCCC
Q ss_conf             877044434563587777664399996778440789999999999999719853035320682
Q gi|254780750|r  630 SSKPFIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHIGI  692 (920)
Q Consensus       630 ~~~~fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a~i~~  692 (920)
                      +...||+|=+.       +-.+..+|.|.--+||||+|+.++-.+.-  -|..|=.=.|-+-|
T Consensus       202 G~v~~i~~l~~-------~~~~~y~ikG~pGtGKstlL~~i~~~A~~--~G~dvevyhc~fdP  255 (368)
T PRK06851        202 GAVDHVPSLTE-------GVKNRYFLKGRPGTGKSTMLKKVAKAAEE--RGLDVEVYHCPFDP  255 (368)
T ss_pred             CHHHHHHHHHH-------CCCEEEEECCCCCCCHHHHHHHHHHHHHH--CCCEEEEEECCCCC
T ss_conf             64514787860-------67869998189998779999999999998--59828998079898


No 370
>PRK10787 DNA-binding ATP-dependent protease La; Provisional
Probab=89.64  E-value=0.46  Score=26.41  Aligned_cols=60  Identities=17%  Similarity=0.354  Sum_probs=30.4

Q ss_pred             HHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHCCCEEEEEEEEEEECCEEEEEEEEEE--CCCCCCHHHHHHHHC
Q ss_conf             567999999999999726984999748757976643068858999999960992778777744--789887789999982
Q gi|254780750|r  745 LDGLSIAWATIEYLHETNRCRGLLATHFHELTDLSKSLKRFHNATLQVSDSNEGIIFLHKVIP--GIADHSYGIQVGKLA  822 (920)
Q Consensus       745 ~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~~l~~~~~~v~n~~~~~~~~~~~i~flykl~~--G~~~~Sygi~vA~la  822 (920)
                      .-|++++.|++-.+..+ .-+                 +   +..|.     ++|+..=++.|  |+-.+   +-.|++|
T Consensus       679 SAGit~~tal~S~~~~~-~v~-----------------~---~~amT-----GEitL~G~VlpiGG~keK---~laA~r~  729 (784)
T PRK10787        679 SAGIAMCTALVSCLTGN-PVR-----------------A---DVAMT-----GEITLRGQVLPIGGLKEK---LLAAHRG  729 (784)
T ss_pred             HHHHHHHHHHHHHHHCC-CCC-----------------C---CCCEE-----EEEEECEEEEEECCHHHH---HHHHHHC
T ss_conf             28999999999998699-989-----------------9---96555-----656602027820789999---9999984


Q ss_pred             CCCHHHHHHHH
Q ss_conf             99989999999
Q gi|254780750|r  823 GLPNTVISRAY  833 (920)
Q Consensus       823 G~p~~vi~~A~  833 (920)
                      |+-.-+|-.+.
T Consensus       730 gi~~vi~P~~N  740 (784)
T PRK10787        730 GIKTVLIPFEN  740 (784)
T ss_pred             CCCEEEECHHH
T ss_conf             99899945212


No 371
>TIGR00929 VirB4_CagE type IV secretion/conjugal transfer ATPase, VirB4 family; InterPro: IPR004346   This family includes the Helicobacter pylori protein CagE (see examples), which together with other proteins from the cag pathogenicity island (PAI), encodes a type IV transporter secretion system. The precise role of CagE is not known, but studies in animal models have shown that it is essential for pathogenesis in Helicobacter pylori induced gastritis and peptic ulceration . Indeed, the expression of the cag PAI has been shown to be essential for stimulating human gastric epithelial cell apoptosis in vitro .    Similar type IV transport systems are also found in other bacteria. This family includes proteins from the trb and Vir conjugal transfer systems in Agrobacterium tumefaciens and homologues of VirB proteins from other species.; GO: 0005524 ATP binding.
Probab=89.64  E-value=0.26  Score=28.18  Aligned_cols=184  Identities=17%  Similarity=0.227  Sum_probs=92.3

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHCCCCCCCE-----EEEEEECCC--CCC-------CCCCHHH--HH
Q ss_conf             9996778440789999999999999719853035320682210-----567652376--611-------3853289--99
Q gi|254780750|r  653 WLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHIGIVDK-----LFSRVGSAD--NLA-------SGRSTFM--VE  716 (920)
Q Consensus       653 ~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a~i~~~D~-----IftRiGa~D--~l~-------~g~STF~--vE  716 (920)
                      -+|.||.-+||||+|-     -+|||++=|.|+..+++=.|||     ||+|-..+.  -|.       .|+.+=+  -.
T Consensus       519 T~IfG~~G~GKTtLl~-----fL~a~~~ky~~~~a~~~~~fDkd~g~~~~~~a~gG~Y~~i~G~~T~~~~g~~~~~NPl~  593 (931)
T TIGR00929       519 TLIFGPTGSGKTTLLN-----FLLAQLQKYKPNFALTIFAFDKDRGMEIFIRALGGKYLEIKGDATVAADGEPFGFNPLQ  593 (931)
T ss_pred             EEEECCCCCCHHHHHH-----HHHHHHHCCCCCCCEEEEEEECCCCCHHHHEEECCEEEEECCCEECCCCCCCCCCCCHH
T ss_conf             7788888984699999-----99999742488987069998878982104111174565303301016788866568020


Q ss_pred             HHHHHHHHHHCCCCCE------EEEECCCCC---CCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHCCCEEE
Q ss_conf             9999999995899856------999325889---8805679999999999997269849997487579766430688589
Q gi|254780750|r  717 MIETASILNQATNQSF------VILDEIGRG---TATLDGLSIAWATIEYLHETNRCRGLLATHFHELTDLSKSLKRFHN  787 (920)
Q Consensus       717 m~e~~~IL~~at~~SL------VllDElGrG---Tst~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~~l~~~~~~v~n  787 (920)
                      |..++.+...++.+++      .|...=|++   ++..+--+|+.||.--. +.. ..-  --+...|.++...++.-.+
T Consensus       594 ~~~g~~l~~t~~n~~F~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~i~~~~-~~~-~~~--~~~~r~l~~l~~~l~~~~~  669 (931)
T TIGR00929       594 GIDGEALEDTERNRAFLKEWLAMLVTLDGETDEEISAEDRNALSSAIDSLY-EED-QKE--HPAIRSLSDLLNFLPKDSI  669 (931)
T ss_pred             HHCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHH-HCC-CCC--CCCCCCHHHHHHHHCCCCC
T ss_conf             123367777724407999999999851276654367899999999988887-314-411--2552208999997257753


Q ss_pred             EEEEEE----------EECCEEE---EEEEEEE-CCC------C-CCHHHHHHHHCCCC---HHHHHHHHHHHHHHHHHH
Q ss_conf             999999----------6099277---8777744-789------8-87789999982999---899999999999998763
Q gi|254780750|r  788 ATLQVS----------DSNEGII---FLHKVIP-GIA------D-HSYGIQVGKLAGLP---NTVISRAYDILKTFEKLY  843 (920)
Q Consensus       788 ~~~~~~----------~~~~~i~---flykl~~-G~~------~-~Sygi~vA~laG~p---~~vi~~A~~~~~~le~~~  843 (920)
                      -.|+..          -.++..-   -++.|-+ +..      . +-+|+++-.+.--|   +...--+--++.+.++..
T Consensus       670 ~~~~~~~~l~~~L~~w~~~~~~G~~Gef~wLFD~~~~D~Ldl~~~~~~gfd~~~ll~~~e~~~~~~p~~~YLf~Ri~~~~  749 (931)
T TIGR00929       670 EVVEARNSLADRLERWLKGGDYGGDGEFQWLFDGNETDSLDLSKADIIGFDLTELLDNPELEKVATPVLLYLFHRIEEAL  749 (931)
T ss_pred             CCCCCHHHHHHHHHHHHCCCCCCCCCEEEEECCCCCCCCCCCCCCCEEEEEHHHHHCCCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             00045023899988751789875552032110689754123789714787554642476866789999999999999972


Q ss_pred             HH
Q ss_conf             00
Q gi|254780750|r  844 HH  845 (920)
Q Consensus       844 ~~  845 (920)
                      ..
T Consensus       750 dg  751 (931)
T TIGR00929       750 DG  751 (931)
T ss_pred             CC
T ss_conf             41


No 372
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated
Probab=89.63  E-value=1.5  Score=22.61  Aligned_cols=165  Identities=23%  Similarity=0.325  Sum_probs=87.7

Q ss_pred             CCCEEEEEECCCCCCHHHHHHHHHHHHHHHH----CCCCCCHHHCCCCCCCEE--EEEEECCCCCCCCCCHH-HHHHHHH
Q ss_conf             6643999967784407899999999999997----198530353206822105--67652376611385328-9999999
Q gi|254780750|r  648 NSGKLWLLTGPNMGGKSTFLRQNALIVIMAQ----MGSYVPASYAHIGIVDKL--FSRVGSADNLASGRSTF-MVEMIET  720 (920)
Q Consensus       648 ~~~~~~iiTGpNmgGKSt~lRqval~vilAQ----iG~fVPA~~a~i~~~D~I--ftRiGa~D~l~~g~STF-~vEm~e~  720 (920)
                      ..+++..+-||=..||||.+==+|-...+.+    +| +|-++.-+++-++++  |++|=       |..-+ .-.-.|.
T Consensus       208 ~~~~vvalVGPTGVGKTTTiAKLAA~~~l~~~~~kV~-lIT~DtyRigA~eQLk~Ya~il-------gvp~~v~~~~~~l  279 (412)
T PRK05703        208 EQGGVVALVGPTGVGKTTTLAKLAARYALEEGKDKVA-LITLDTYRIGAVEQLKTYAKIM-------GIPVKVAYDPKEL  279 (412)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEE-EEEECCCCHHHHHHHHHHHHHC-------CCEEEEECCHHHH
T ss_conf             5673699988888756769999999999972998179-9983767777999999999971-------9737984799999


Q ss_pred             HHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCC----CEEEE-ECCCHHHHHHHHHCCCEEEEEEEEEEE
Q ss_conf             9999958998569993258898805679999999999997269----84999-748757976643068858999999960
Q gi|254780750|r  721 ASILNQATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNR----CRGLL-ATHFHELTDLSKSLKRFHNATLQVSDS  795 (920)
Q Consensus       721 ~~IL~~at~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~----~~~lf-aTHy~eL~~l~~~~~~v~n~~~~~~~~  795 (920)
                      ..+|+......|||+|=-||.  ++|..-+.  -+..|.+...    .++|= +|++.+|.+....+..+..        
T Consensus       280 ~~al~~~~~~dlILIDTaG~s--~~d~~~~~--eL~~~~~~~~~~~~~LVlsat~~~~dl~~i~~~f~~~~~--------  347 (412)
T PRK05703        280 AKALEQLANCDLILIDTAGRS--QRDPRLIS--ELKALIENSKPIDVYLVLSATTKYRDLKDIVKHFSRLPL--------  347 (412)
T ss_pred             HHHHHHHCCCCEEEEECCCCC--CCCHHHHH--HHHHHHHHCCCCCEEEEECCCCCHHHHHHHHHHHCCCCC--------
T ss_conf             999987158997999689889--78999999--999998624887189997598998999999998467999--------


Q ss_pred             CCEEEEEEEEEECCCCCCHHHHHHHHCCCCHHHHHHHHHH
Q ss_conf             9927787777447898877899999829998999999999
Q gi|254780750|r  796 NEGIIFLHKVIPGIADHSYGIQVGKLAGLPNTVISRAYDI  835 (920)
Q Consensus       796 ~~~i~flykl~~G~~~~Sygi~vA~laG~p~~vi~~A~~~  835 (920)
                       +.++|+ ||=+=.+-- --++++...|+|=.-+-.-+.|
T Consensus       348 -~~lI~T-KlDEt~~~G-~il~~~~~~~lplsy~t~GQ~V  384 (412)
T PRK05703        348 -DGLILT-KLDETSSLG-SILSLLIESGLPISYLTDGQRV  384 (412)
T ss_pred             -CEEEEE-EECCCCCCC-HHHHHHHHHCCCEEEEECCCCC
T ss_conf             -879997-112899862-9999999988796999469997


No 373
>PRK00411 cdc6 cell division control protein 6; Reviewed
Probab=89.54  E-value=0.69  Score=25.07  Aligned_cols=121  Identities=16%  Similarity=0.114  Sum_probs=57.3

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHHHHHC----CCCCCHHHC--CCCCCCEEEEEEECCCCC-CCCCCHHHHHHHHHHHHHH
Q ss_conf             999677844078999999999999971----985303532--068221056765237661-1385328999999999999
Q gi|254780750|r  653 WLLTGPNMGGKSTFLRQNALIVIMAQM----GSYVPASYA--HIGIVDKLFSRVGSADNL-ASGRSTFMVEMIETASILN  725 (920)
Q Consensus       653 ~iiTGpNmgGKSt~lRqval~vilAQi----G~fVPA~~a--~i~~~D~IftRiGa~D~l-~~g~STF~vEm~e~~~IL~  725 (920)
                      ++|.||-..|||+..|.|.=-. -.+.    =.||-|...  ...++-+|+..++. .++ ..|.|+-.+ +...-..|.
T Consensus        58 ~~I~G~pGTGKT~~vk~v~~~l-~~~~~~~~~vyINc~~~~t~~~i~~~i~~~L~~-~~~p~~G~s~~~~-~~~l~~~l~  134 (394)
T PRK00411         58 VLILGPPGTGKTTTVKKVFEEL-EEAALKVVYVYINCQIDRTRYAILSEIARSLFG-HPPPSSGLSFDEL-FDKIAEYLD  134 (394)
T ss_pred             EEEECCCCCCHHHHHHHHHHHH-HHHCCCCEEEEEECCCCCCHHHHHHHHHHHHCC-CCCCCCCCCHHHH-HHHHHHHHH
T ss_conf             7998899998999999999999-974689659999696689899999999999569-9898778789999-999999861


Q ss_pred             HCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHH--HHHCCCEEEEECCCHHHHH
Q ss_conf             589985699932588988056799999999999--9726984999748757976
Q gi|254780750|r  726 QATNQSFVILDEIGRGTATLDGLSIAWATIEYL--HETNRCRGLLATHFHELTD  777 (920)
Q Consensus       726 ~at~~SLVllDElGrGTst~DG~aiA~aile~l--~~~~~~~~lfaTHy~eL~~  777 (920)
                      .-...-+|+|||+-.=.+ .+|--+-|...+--  +...++-.+..++--.+.+
T Consensus       135 ~~~~~~ivvLDEiD~L~~-~~~~~vLY~L~r~~~~~~~~~~~vI~IsN~~~~~~  187 (394)
T PRK00411        135 ERDRVLIVALDDINYLVE-KEGNDVLYSLLRAHEEYPGARIGVIGISSDLTFLY  187 (394)
T ss_pred             CCCCEEEEEEECCCCCCC-CCCCHHHHHHHHCCCCCCCCCEEEEEEECCCCHHH
T ss_conf             669758999965540203-66508999998540226887389999976871776


No 374
>COG1101 PhnK ABC-type uncharacterized transport system, ATPase component [General function prediction only]
Probab=89.52  E-value=0.32  Score=27.59  Aligned_cols=128  Identities=27%  Similarity=0.332  Sum_probs=64.8

Q ss_pred             EEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHH--HC---CCCC---C-HHHCCCCCCCEEE--------
Q ss_conf             4434563587777664399996778440789999999999999--71---9853---0-3532068221056--------
Q gi|254780750|r  635 IANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMA--QM---GSYV---P-ASYAHIGIVDKLF--------  697 (920)
Q Consensus       635 VpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilA--Qi---G~fV---P-A~~a~i~~~D~If--------  697 (920)
                      +=|.++|..    ..+.|..|-|.|-+||||++..++=-+..-  ||   |--|   | ++.|  ..+-|+|        
T Consensus        21 ~l~~~sL~I----~~g~FvtViGsNGAGKSTlln~iaG~l~~t~G~I~Idg~dVtk~~~~~RA--~~larVfQdp~~gt~   94 (263)
T COG1101          21 ALNGLSLEI----AEGDFVTVIGSNGAGKSTLLNAIAGDLKPTSGQILIDGVDVTKKSVAKRA--NLLARVFQDPLAGTA   94 (263)
T ss_pred             HHHCCCEEE----CCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCEEEECCEECCCCCHHHHH--HHHHHHHCCHHHCCC
T ss_conf             872375122----47846999767986388888886075036776599876443437788875--678987136520776


Q ss_pred             EEEECCCCC-----------------CCCCCHHHHHHHHH-----------------------HHHHHHCCCCCEEEEEC
Q ss_conf             765237661-----------------13853289999999-----------------------99999589985699932
Q gi|254780750|r  698 SRVGSADNL-----------------ASGRSTFMVEMIET-----------------------ASILNQATNQSFVILDE  737 (920)
Q Consensus       698 tRiGa~D~l-----------------~~g~STF~vEm~e~-----------------------~~IL~~at~~SLVllDE  737 (920)
                      +++--..|+                 .+-.+.|+-++.++                       +-++-.+.+--+.++||
T Consensus        95 ~~lTieENl~la~~Rg~~rgl~~~ln~~~~~~f~~~l~~l~lgLenrL~~~iglLSGGQRQalsL~MAtl~~pkiLLLDE  174 (263)
T COG1101          95 PELTIEENLALAESRGKKRGLSSALNERRRSSFRERLARLGLGLENRLSDRIGLLSGGQRQALSLLMATLHPPKILLLDE  174 (263)
T ss_pred             CCCCHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHCCCCHHHHHCCHHHHCCCHHHHHHHHHHHHCCCCCEEEECC
T ss_conf             42519988999986076556335452778999999986615323555247133236518999999998547984887601


Q ss_pred             CCCCCCHHH-HHH--HHHHHHHHHHHHCCCEEEEECCC
Q ss_conf             588988056-799--99999999997269849997487
Q gi|254780750|r  738 IGRGTATLD-GLS--IAWATIEYLHETNRCRGLLATHF  772 (920)
Q Consensus       738 lGrGTst~D-G~a--iA~aile~l~~~~~~~~lfaTHy  772 (920)
                      =   |...| +.|  +-..+ +.+++.-+-.++-.||-
T Consensus       175 H---TAALDPkta~~vm~lT-~kiV~~~klTtlMVTHn  208 (263)
T COG1101         175 H---TAALDPKTAEFVMELT-AKIVEEHKLTTLMVTHN  208 (263)
T ss_pred             H---HHCCCCCHHHHHHHHH-HHHHHHCCCCEEEEECC
T ss_conf             1---2117930679999999-99998569706887415


No 375
>TIGR01188 drrA daunorubicin resistance ABC transporter, ATP-binding protein; InterPro: IPR005894   ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs.   ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain .    The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , .   The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , .   Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1).     This family contains the daunorubicin resistance ABC transporter, ATP binding subunit in bacteria and archaea. This model is restricted in its scope to preferentially recognize the ATP binding subunit associated with effux of the drug, daunorubicin. In other words it functions as an ATP dependent antiporter. .
Probab=89.43  E-value=0.38  Score=27.04  Aligned_cols=124  Identities=31%  Similarity=0.439  Sum_probs=67.1

Q ss_pred             CCCEEEEEECCCCCCHHHHHHHHHHHHHHHH-------CCCCC---CH--H-HCCCCCC------CEEEEEEECCCCCC-
Q ss_conf             6643999967784407899999999999997-------19853---03--5-3206822------10567652376611-
Q gi|254780750|r  648 NSGKLWLLTGPNMGGKSTFLRQNALIVIMAQ-------MGSYV---PA--S-YAHIGIV------DKLFSRVGSADNLA-  707 (920)
Q Consensus       648 ~~~~~~iiTGpNmgGKSt~lRqval~vilAQ-------iG~fV---PA--~-~a~i~~~------D~IftRiGa~D~l~-  707 (920)
                      ..+.++=+=|||-+||||.+|..+  +++==       .|.=|   |+  + .=+||+|      |..+|   |..||. 
T Consensus        19 ~~G~vfGfLGPNGAGKTTti~mLt--Tll~P~sG~A~V~GYDvvreP~kl~VRr~IG~v~Q~~s~D~~LT---g~ENl~m   93 (343)
T TIGR01188        19 REGEVFGFLGPNGAGKTTTIRMLT--TLLKPTSGTARVAGYDVVREPRKLKVRRRIGIVPQYASVDEDLT---GRENLVM   93 (343)
T ss_pred             CCCEEEEEECCCCCCHHHHHHHHC--CCCCCCCCEEEEEEEECCCCHHHCCCCEEEEEECCCCCCCCCCC---HHHHHHH
T ss_conf             062489976879985133563410--25579987689983210236304032113204468555564577---4754445


Q ss_pred             ----CCCCHHH-----HHHHHHHHHHHHCCC----------------CC------EEEEECCCCCCCHHHHHHHHHHHHH
Q ss_conf             ----3853289-----999999999995899----------------85------6999325889880567999999999
Q gi|254780750|r  708 ----SGRSTFM-----VEMIETASILNQATN----------------QS------FVILDEIGRGTATLDGLSIAWATIE  756 (920)
Q Consensus       708 ----~g~STF~-----vEm~e~~~IL~~at~----------------~S------LVllDElGrGTst~DG~aiA~aile  756 (920)
                          .|.|-=.     .|+.|.=.+-..|.+                .|      +.-|||-=-|=+|.---+| |-+++
T Consensus        94 ~g~LyGlp~~~~~~Ra~ELLe~~~L~~aa~r~V~tySGGMrRRL~iA~sli~~P~vLFLDEPT~GLDP~tR~~i-Wd~i~  172 (343)
T TIGR01188        94 MGRLYGLPKKEAEERAEELLELFELTEAADRKVKTYSGGMRRRLEIAASLIHQPEVLFLDEPTTGLDPRTRRAI-WDYIE  172 (343)
T ss_pred             HHHHCCCCHHHHHHHHHHHHHHCCHHHHHCCCCCCCCCCCEEHHHHHHHHHCCCCEEECCCCCCCCCHHHHHHH-HHHHH
T ss_conf             33334896899998888876230014662543322677112144543111038825651488768888669999-99999


Q ss_pred             HHHHHCCCEEEEECCCHHHHH
Q ss_conf             999726984999748757976
Q gi|254780750|r  757 YLHETNRCRGLLATHFHELTD  777 (920)
Q Consensus       757 ~l~~~~~~~~lfaTHy~eL~~  777 (920)
                      .|-+..+--+|.+|||=|=++
T Consensus       173 ~lk~~~g~TilLTThYmeEAd  193 (343)
T TIGR01188       173 ALKKEEGVTILLTTHYMEEAD  193 (343)
T ss_pred             HHHHCCCCEEEEECCCHHHHH
T ss_conf             987407969997437869998


No 376
>TIGR00611 recf DNA replication and repair protein RecF; InterPro: IPR001238   All proteins in this family, including recF, for which functions are known are DNA binding proteins that assist the filamentation of RecA onto DNA for the initiation of recombination or recombinational repair. RecF is involved in DNA metabolism and is required for recombinational DNA repair and for induction of the SOS response , . ; GO: 0003697 single-stranded DNA binding, 0005524 ATP binding, 0006281 DNA repair.
Probab=89.31  E-value=0.29  Score=27.85  Aligned_cols=25  Identities=20%  Similarity=0.037  Sum_probs=12.4

Q ss_pred             HHHHHHHHHHHHHH--HHHHHHHHHCC
Q ss_conf             98888999867788--77888775258
Q gi|254780750|r  576 LDNASQVIAIIDIS--IALAILAKEQN  600 (920)
Q Consensus       576 l~~~~~~ia~lD~l--~SlA~~a~~~~  600 (920)
                      +.-+=+..||||-.  -.||..+...+
T Consensus       339 ilLlDDv~SELD~~Rr~~L~~~~~~~~  365 (399)
T TIGR00611       339 ILLLDDVASELDDQRRRALAETLQSLG  365 (399)
T ss_pred             EEEECCHHHCCHHHHHHHHHHHHHHCC
T ss_conf             264425232260789999999997169


No 377
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes. SRP recognizes N-terminal sighnal sequences of newly synthesized polypeptides at the ribosome. The SRP-polypeptide complex is then targeted to the membrane by an interaction between SRP and its cognated receptor (SR). In mammals, SRP consists of six protein subunits and a 7SL RNA. One of these subunits is a 54 kd protein (SRP54), which is a GTP-binding protein that interacts with the signal sequence when it emerges from the ribosome. SRP54 is a multidomain protein that consists of an N-terminal domain, followed by a central G (GTPase) domain and a C-terminal M domain.
Probab=89.08  E-value=1.6  Score=22.33  Aligned_cols=154  Identities=18%  Similarity=0.198  Sum_probs=67.9

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHHHCCC---CCCHHHCCCCCCCEE--EEEEECCCCCC--CCCCHHHHHHHHH-HHH
Q ss_conf             999967784407899999999999997198---530353206822105--67652376611--3853289999999-999
Q gi|254780750|r  652 LWLLTGPNMGGKSTFLRQNALIVIMAQMGS---YVPASYAHIGIVDKL--FSRVGSADNLA--SGRSTFMVEMIET-ASI  723 (920)
Q Consensus       652 ~~iiTGpNmgGKSt~lRqval~vilAQiG~---fVPA~~a~i~~~D~I--ftRiGa~D~l~--~g~STF~vEm~e~-~~I  723 (920)
                      +.++-|||-+||||.+=-.|.-.  .+-|-   +|.|+..+++=+|++  |+++-.- .+.  ...+    ++.+. ...
T Consensus         2 Vi~lvGptGvGKTTTiaKLA~~~--~~~~~kV~lit~Dt~R~gA~eQL~~~a~~l~v-~~~~~~~~~----~~~~~~~~~   74 (173)
T cd03115           2 VILLVGLQGVGKTTTAAKLALYL--KKKGKKVLLVAADTYRPAAIEQLRVLGEQVGV-PVFEEGEGK----DPVSIAKRA   74 (173)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHH--HHCCCEEEEEECCCCCHHHHHHHHHHHHHCCC-EEEECCCCC----CHHHHHHHH
T ss_conf             99998999998899999999999--97699289997488757799999999997498-599227755----879999999


Q ss_pred             HHH--CCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCC----EEEEECCCHHHHHHHHHCCCEEEEEEEEEEECC
Q ss_conf             995--89985699932588988056799999999999972698----499974875797664306885899999996099
Q gi|254780750|r  724 LNQ--ATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRC----RGLLATHFHELTDLSKSLKRFHNATLQVSDSNE  797 (920)
Q Consensus       724 L~~--at~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~----~~lfaTHy~eL~~l~~~~~~v~n~~~~~~~~~~  797 (920)
                      +..  .....+||+|=-||.  .+|..-+  .=++.+.+..++    +++-+|.=++..+....+....+        -+
T Consensus        75 ~~~~~~~~~D~IlIDTaGr~--~~d~~~~--~el~~l~~~~~p~~~~LVl~a~~~~~~~~~~~~f~~~~~--------~~  142 (173)
T cd03115          75 IEHAREENFDVVIVDTAGRL--QIDENLM--EELKKIKRVVKPDEVLLVVDAMTGQDAVNQAKAFNEALG--------IT  142 (173)
T ss_pred             HHHHHHCCCCEEEEECCCCC--CCCHHHH--HHHHHHHHHHCCCCCEEECCCCCHHHHHHHHHHHHHCCC--------CC
T ss_conf             99987568998999788878--7999999--999999864489721574246550658999999874279--------97


Q ss_pred             EEEEEEEEEECCCCCCHHHHHHHHCCCCH
Q ss_conf             27787777447898877899999829998
Q gi|254780750|r  798 GIIFLHKVIPGIADHSYGIQVGKLAGLPN  826 (920)
Q Consensus       798 ~i~flykl~~G~~~~Sygi~vA~laG~p~  826 (920)
                      .++|. ||=+ .+.---.++++...|+|=
T Consensus       143 ~~I~T-KlDe-t~~~G~~ls~~~~~~~Pi  169 (173)
T cd03115         143 GVILT-KLDG-DARGGAALSIRAVTGKPI  169 (173)
T ss_pred             EEEEE-EECC-CCCCCHHHHHHHHHCCCE
T ss_conf             89997-1438-997579999999989090


No 378
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones]
Probab=89.04  E-value=0.73  Score=24.86  Aligned_cols=103  Identities=23%  Similarity=0.368  Sum_probs=41.9

Q ss_pred             EEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHCCCCCCCEEEEEE---ECCC--CCCCCCCHHHHHHHH-HHHHH
Q ss_conf             39999677844078999999999999971985303532068221056765---2376--611385328999999-99999
Q gi|254780750|r  651 KLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHIGIVDKLFSRV---GSAD--NLASGRSTFMVEMIE-TASIL  724 (920)
Q Consensus       651 ~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a~i~~~D~IftRi---Ga~D--~l~~g~STF~vEm~e-~~~IL  724 (920)
                      .++.+.||-.-|||++-|++|=.                   ..|=|.||   |-.|  .|-..+=|+---|-- .-.-+
T Consensus       351 pILcLVGPPGVGKTSLgkSIA~a-------------------l~RkfvR~sLGGvrDEAEIRGHRRTYIGaMPGrIiQ~m  411 (782)
T COG0466         351 PILCLVGPPGVGKTSLGKSIAKA-------------------LGRKFVRISLGGVRDEAEIRGHRRTYIGAMPGKIIQGM  411 (782)
T ss_pred             CEEEEECCCCCCCHHHHHHHHHH-------------------HCCCEEEEECCCCCCHHHHCCCCCCCCCCCCHHHHHHH
T ss_conf             57999789988701189999999-------------------58977999547654277753553123356872899999


Q ss_pred             HH-CCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHH
Q ss_conf             95-8998569993258898805679999999999997269849997487579
Q gi|254780750|r  725 NQ-ATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFHEL  775 (920)
Q Consensus       725 ~~-at~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~eL  775 (920)
                      +. -+.|-++||||+-+=+|.+-|-- |.|.||-|=-. +- .=|.-||-++
T Consensus       412 kka~~~NPv~LLDEIDKm~ss~rGDP-aSALLEVLDPE-QN-~~F~DhYLev  460 (782)
T COG0466         412 KKAGVKNPVFLLDEIDKMGSSFRGDP-ASALLEVLDPE-QN-NTFSDHYLEV  460 (782)
T ss_pred             HHHCCCCCEEEEECHHHCCCCCCCCH-HHHHHHHCCHH-HC-CCHHHCCCCC
T ss_conf             98677687478640333167777886-88888626976-56-7612220167


No 379
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair]
Probab=88.91  E-value=1.6  Score=22.25  Aligned_cols=30  Identities=13%  Similarity=0.211  Sum_probs=17.4

Q ss_pred             HHHHCCC-CEEEEECCCCCHHHHHHHHHHCC
Q ss_conf             9852298-57997077689678998874238
Q gi|254780750|r  188 DIMRIDP-REIIFSEKELSHAEYKSLFETLG  217 (920)
Q Consensus       188 ~L~~l~P-~EIii~~~~~~~~~~~~l~~~~~  217 (920)
                      .+.+..| --||+.+-.++...+...+...+
T Consensus       188 ~~~~rr~DLKiIimSATld~~rfs~~f~~ap  218 (845)
T COG1643         188 LLARRRDDLKLIIMSATLDAERFSAYFGNAP  218 (845)
T ss_pred             HHHHCCCCCEEEEEECCCCHHHHHHHCCCCC
T ss_conf             9864688705999725358899997628998


No 380
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein; InterPro: IPR013505   ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs.   ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain .    The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , .   The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , .   Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1).     FtsE is an ABC transporter ATP-binding protein. This protein and its permease partner FtsX, localize to the cell division site. In a number of species, the ftsEX gene pair is located next to ftsY, which encodes the signal recognition particle-docki ng protein.; GO: 0005524 ATP binding, 0051301 cell division.
Probab=88.90  E-value=0.58  Score=25.65  Aligned_cols=123  Identities=28%  Similarity=0.319  Sum_probs=61.4

Q ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHHHHHHC--------------CCCCCHHHCCCCCCC---EEEEEEECCCCC-----
Q ss_conf             6439999677844078999999999999971--------------985303532068221---056765237661-----
Q gi|254780750|r  649 SGKLWLLTGPNMGGKSTFLRQNALIVIMAQM--------------GSYVPASYAHIGIVD---KLFSRVGSADNL-----  706 (920)
Q Consensus       649 ~~~~~iiTGpNmgGKSt~lRqval~vilAQi--------------G~fVPA~~a~i~~~D---~IftRiGa~D~l-----  706 (920)
                      .+.|.-|+||--+||||+||-+.=+.- +-.              |--||-=.=.||.|=   ++++.--+-||.     
T Consensus        28 kGem~fL~GHSGaGKST~lkLi~~~~~-P~~G~i~~~G~d~~~L~~r~~P~LRr~iG~VFQD~~LL~drtv~dNVa~pL~  106 (216)
T TIGR00960        28 KGEMVFLVGHSGAGKSTLLKLILGIEK-PTRGKIRFSGQDLTRLRGREVPFLRRHIGMVFQDHRLLSDRTVYDNVALPLR  106 (216)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHCC-CCCCEEEECCCCCCCCCCCCCCCEEEECCEEECCHHHHHHCCHHHHHHHHHH
T ss_conf             850799856888607899999985228-9986078715421001577467300010426701155311655455243355


Q ss_pred             CCCCCHHHHHHHHHHHHHH--------------------------HC--CCCCEEEEECCCCCCCHHHHHHHHHHHH---
Q ss_conf             1385328999999999999--------------------------58--9985699932588988056799999999---
Q gi|254780750|r  707 ASGRSTFMVEMIETASILN--------------------------QA--TNQSFVILDEIGRGTATLDGLSIAWATI---  755 (920)
Q Consensus       707 ~~g~STF~vEm~e~~~IL~--------------------------~a--t~~SLVllDElGrGTst~DG~aiA~ail---  755 (920)
                      .-|.++=-.+-. ++..|+                          .|  .+=.|.|=||-   |...|- +.+.-|+   
T Consensus       107 iiG~~~~~~~~r-v~~aL~~VGL~~K~~~lP~~LSGGEQQRv~IARA~V~~P~lLLADEP---TGNLD~-~~S~~il~Lf  181 (216)
T TIGR00960       107 IIGVPGRDINER-VSAALEKVGLKGKAHALPVQLSGGEQQRVAIARAVVNKPALLLADEP---TGNLDP-ELSRDILRLF  181 (216)
T ss_pred             HCCCCCCCHHHH-HHHHHHHCCCCCHHHCCCCCCCCCCHHHHHHHHHHCCCCCCEEEECC---CCCCCH-HHHHHHHHHH
T ss_conf             228997426789-99998730611212407620048503455664443067970131088---988788-8899999999


Q ss_pred             HHHHHHCCCEEEEECCCHHHHHH
Q ss_conf             99997269849997487579766
Q gi|254780750|r  756 EYLHETNRCRGLLATHFHELTDL  778 (920)
Q Consensus       756 e~l~~~~~~~~lfaTHy~eL~~l  778 (920)
                      |.++ +.|..+|.|||.+.|.+-
T Consensus       182 ~~~n-~~G~TVl~ATHD~~L~~~  203 (216)
T TIGR00960       182 EEFN-RAGTTVLVATHDINLVES  203 (216)
T ss_pred             HHHH-CCCCEEEECCCHHHHHHH
T ss_conf             8750-378547771024889973


No 381
>cd01393 recA_like RecA is a  bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response.  RecA couples ATP hydrolysis to DNA strand exchange. While prokaryotes have a single RecA protein, eukaryotes have multiple RecA homologs such as Rad51, DMC1 and Rad55/57.  Archaea have the RecA-like homologs radA and radB.
Probab=88.78  E-value=1.7  Score=22.19  Aligned_cols=116  Identities=16%  Similarity=0.306  Sum_probs=57.3

Q ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHHHHHH-C----C--CCCCHHHC-------CCC---------CCCEEEEEEECCCC
Q ss_conf             643999967784407899999999999997-1----9--85303532-------068---------22105676523766
Q gi|254780750|r  649 SGKLWLLTGPNMGGKSTFLRQNALIVIMAQ-M----G--SYVPASYA-------HIG---------IVDKLFSRVGSADN  705 (920)
Q Consensus       649 ~~~~~iiTGpNmgGKSt~lRqval~vilAQ-i----G--~fVPA~~a-------~i~---------~~D~IftRiGa~D~  705 (920)
                      .+++.-|.||..+|||++.=|+|+.+.+.- .    |  .|+-++..       .++         +.|+|+.-  ..++
T Consensus        18 ~G~ItEi~G~~gsGKT~l~lqla~~~q~~~~~~~~~g~vvyIDtE~~f~~~rl~~i~~~~~~~~~~~l~~i~~~--~~~~   95 (226)
T cd01393          18 TGRITEIFGEFGSGKTQLCLQLAVEAQLPGELGGLEGKVVYIDTEGAFRPERLVQLAVRFGLDPEEVLDNIYVA--RPYN   95 (226)
T ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHHHCCCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHCCCHHHHHHHEEEE--CCCC
T ss_conf             88399999999998999999999998542211699961999955775319999999876032667764333684--3799


Q ss_pred             CCCCCCHHHHHHHH-HHHHHHHCCCCCEEEEECCC---------CCCCHHHHHHHH---HHHHHHHHHHCCCEEEEECCC
Q ss_conf             11385328999999-99999958998569993258---------898805679999---999999997269849997487
Q gi|254780750|r  706 LASGRSTFMVEMIE-TASILNQATNQSFVILDEIG---------RGTATLDGLSIA---WATIEYLHETNRCRGLLATHF  772 (920)
Q Consensus       706 l~~g~STF~vEm~e-~~~IL~~at~~SLVllDElG---------rGTst~DG~aiA---~aile~l~~~~~~~~lfaTHy  772 (920)
                      ..+     ..++.+ ...++. ..+-.||++|=+.         +++. .+...+.   ...|..+..+.++-++++-|.
T Consensus        96 ~e~-----~~~~~~~l~~~~~-~~~v~liViDSi~al~r~~~~~~~~~-~~r~~~l~~~~~~L~~la~~~~~avv~tNQv  168 (226)
T cd01393          96 GEQ-----QLEIVEELERIMS-SGRVDLVVVDSVAALFRKEFIGRGML-AERARLLSQALRKLLRLADKFNVAVVFTNQV  168 (226)
T ss_pred             HHH-----HHHHHHHHHHHHH-CCCCEEEEEECCCEECCHHHCCCCCH-HHHHHHHHHHHHHHHHHHHHCCCEEEEECEE
T ss_conf             999-----9999999998752-47842899932200111444276207-8999999999999999999849799996811


Q ss_pred             H
Q ss_conf             5
Q gi|254780750|r  773 H  773 (920)
Q Consensus       773 ~  773 (920)
                      .
T Consensus       169 ~  169 (226)
T cd01393         169 R  169 (226)
T ss_pred             E
T ss_conf             7


No 382
>COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown]
Probab=88.63  E-value=1.7  Score=22.12  Aligned_cols=107  Identities=28%  Similarity=0.445  Sum_probs=58.1

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHCCCCCCCEEEEEEECCC------------CCCCC--CCHHHHHHH
Q ss_conf             9996778440789999999999999719853035320682210567652376------------61138--532899999
Q gi|254780750|r  653 WLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHIGIVDKLFSRVGSAD------------NLASG--RSTFMVEMI  718 (920)
Q Consensus       653 ~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a~i~~~D~IftRiGa~D------------~l~~g--~STF~vEm~  718 (920)
                      .+|-||--.||+|+||-+|=.+--- +--|.|-   +.+++|-= .-|++.|            ++..+  ++-=|.+|.
T Consensus       140 tLiigpP~~GKTTlLRdiaR~~s~g-~~~~l~k---kv~IiDer-sEIag~~~gvpq~~~g~R~dVld~cpk~~gmmmaI  214 (308)
T COG3854         140 TLIIGPPQVGKTTLLRDIARLLSDG-INQFLPK---KVGIIDER-SEIAGCLNGVPQHGRGRRMDVLDPCPKAEGMMMAI  214 (308)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHHCC-CCCCCCC---EEEEEECC-CHHHCCCCCCCHHHHHHHHHHCCCCHHHHHHHHHH
T ss_conf             6996599887077999999986315-1126773---28997150-04303435886032322101046561788899999


Q ss_pred             HHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHH
Q ss_conf             99999995899856999325889880567999999999999726984999748757976643
Q gi|254780750|r  719 ETASILNQATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFHELTDLSK  780 (920)
Q Consensus       719 e~~~IL~~at~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~~l~~  780 (920)
                            ++..+. .+++||+|+-   .|    |-|+++.++.  |-..+-+-|=.++-++.+
T Consensus       215 ------rsm~PE-ViIvDEIGt~---~d----~~A~~ta~~~--GVkli~TaHG~~iedl~k  260 (308)
T COG3854         215 ------RSMSPE-VIIVDEIGTE---ED----ALAILTALHA--GVKLITTAHGNGIEDLIK  260 (308)
T ss_pred             ------HHCCCC-EEEEECCCCH---HH----HHHHHHHHHC--CCEEEEEECCCCHHHHHC
T ss_conf             ------954995-7998343647---77----9999999854--858999504411777650


No 383
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism]
Probab=88.26  E-value=0.52  Score=26.01  Aligned_cols=35  Identities=37%  Similarity=0.470  Sum_probs=23.9

Q ss_pred             EEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHH
Q ss_conf             443456358777766439999677844078999999999
Q gi|254780750|r  635 IANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALI  673 (920)
Q Consensus       635 VpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~  673 (920)
                      +=.||+|..+    ...+--+-||-.+|||||||..--+
T Consensus        22 aL~~i~l~i~----~~~VTAlIGPSGcGKST~LR~lNRm   56 (253)
T COG1117          22 ALKDINLDIP----KNKVTALIGPSGCGKSTLLRCLNRM   56 (253)
T ss_pred             HHCCCCEECC----CCCEEEEECCCCCCHHHHHHHHHHH
T ss_conf             2315722145----7806998889886788899998754


No 384
>KOG0061 consensus
Probab=88.26  E-value=1.8  Score=21.95  Aligned_cols=15  Identities=27%  Similarity=0.470  Sum_probs=9.0

Q ss_pred             CEEEEEEEEECCCCE
Q ss_conf             455458999775303
Q gi|254780750|r  125 LVRRNVVRLVTPGTL  139 (920)
Q Consensus       125 ~v~R~Vt~IiTpGT~  139 (920)
                      -+=+.|+....||.+
T Consensus        44 ~iL~~vsg~~~~Gel   58 (613)
T KOG0061          44 TILKGVSGTAKPGEL   58 (613)
T ss_pred             EEECCCEEEEECCEE
T ss_conf             432187799867868


No 385
>KOG2355 consensus
Probab=88.17  E-value=0.51  Score=26.05  Aligned_cols=38  Identities=37%  Similarity=0.558  Sum_probs=25.0

Q ss_pred             CEEEEECCCCCCCHHHHHHHHHH-HHHHHHHH---CCCEEEEECCCH
Q ss_conf             56999325889880567999999-99999972---698499974875
Q gi|254780750|r  731 SFVILDEIGRGTATLDGLSIAWA-TIEYLHET---NRCRGLLATHFH  773 (920)
Q Consensus       731 SLVllDElGrGTst~DG~aiA~a-ile~l~~~---~~~~~lfaTHy~  773 (920)
                      -..|+||+   |--.|  -+|.| .+|+|-+.   -+|..+.|||-.
T Consensus       167 kVLLLDEV---TVDLD--VlARadLLeFlkeEce~RgatIVYATHIF  208 (291)
T KOG2355         167 KVLLLDEV---TVDLD--VLARADLLEFLKEECEQRGATIVYATHIF  208 (291)
T ss_pred             EEEEEEEE---EEEHH--HHHHHHHHHHHHHHHHHCCCEEEEEEEEC
T ss_conf             37776315---74067--87788899999998863486799973000


No 386
>KOG0744 consensus
Probab=88.13  E-value=1.8  Score=21.89  Aligned_cols=101  Identities=27%  Similarity=0.338  Sum_probs=56.3

Q ss_pred             CEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHCCCCCCC----EEEEEEECCCCCCCCCCHHHHHHHH------
Q ss_conf             439999677844078999999999999971985303532068221----0567652376611385328999999------
Q gi|254780750|r  650 GKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHIGIVD----KLFSRVGSADNLASGRSTFMVEMIE------  719 (920)
Q Consensus       650 ~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a~i~~~D----~IftRiGa~D~l~~g~STF~vEm~e------  719 (920)
                      .|+++++||-.-||+++.|..      ||-        ..|..-|    .+..-|.+       .|-|..=-.|      
T Consensus       177 NRliLlhGPPGTGKTSLCKaL------aQk--------LSIR~~~~y~~~~liEins-------hsLFSKWFsESgKlV~  235 (423)
T KOG0744         177 NRLILLHGPPGTGKTSLCKAL------AQK--------LSIRTNDRYYKGQLIEINS-------HSLFSKWFSESGKLVA  235 (423)
T ss_pred             EEEEEEECCCCCCHHHHHHHH------HHH--------HEEEECCCCCCCEEEEEEH-------HHHHHHHHHHHHHHHH
T ss_conf             148998579998822799999------875--------1465237644406999704-------6788988712113899


Q ss_pred             -----HHHHHHHCCCCCEEEEECCC----------CCCCHHHHHHHHHHHHHHHHHHCCC--EEEEECC
Q ss_conf             -----99999958998569993258----------8988056799999999999972698--4999748
Q gi|254780750|r  720 -----TASILNQATNQSFVILDEIG----------RGTATLDGLSIAWATIEYLHETNRC--RGLLATH  771 (920)
Q Consensus       720 -----~~~IL~~at~~SLVllDElG----------rGTst~DG~aiA~aile~l~~~~~~--~~lfaTH  771 (920)
                           +...+..-..=-+|||||+-          .|+.|.||+-..-|++..|-+-.+|  ..+.+|-
T Consensus       236 kmF~kI~ELv~d~~~lVfvLIDEVESLa~aR~s~~S~~EpsDaIRvVNalLTQlDrlK~~~NvliL~TS  304 (423)
T KOG0744         236 KMFQKIQELVEDRGNLVFVLIDEVESLAAARTSASSRNEPSDAIRVVNALLTQLDRLKRYPNVLILATS  304 (423)
T ss_pred             HHHHHHHHHHHCCCCEEEEEEHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHCCCCCEEEEECC
T ss_conf             999999999717896899980787888999875413799821899999999989986047977999626


No 387
>TIGR00606 rad50 rad50; InterPro: IPR004584   Rad50 is involved in recombination, recombinational repair, and/or non-homologous end joining. It is a component of an exonuclease complex with MRE11 homologs. The Saccharomyces cerevisiae Rad50/MRE11 complex possesses single-stranded endonuclease activity and ATP-dependent double-strand-specific exonuclease activity. Rad50 provides an ATP-dependent control of MRE11 by unwinding and repositioning DNA ends into the MRE11 active site. This family is distantly related to the SbcC family of bacterial proteins.    When the N- and C-terminal globular regions of Rad50 from Pyrococcus furiosus P58301 from SWISSPROT are co-expressed in Escherichia coli, they spontaneously associate to form a stable complex that possesses ATP-binding and weak ATP-hydrolysing activities. The structure formed is known as the Rad50 catalytic domain (Rad50cd1). In the presence of ATP, two Rad50cd1 molecules interact via their ATP-binding and highly conserved 'signature' motifs to form a dimer. As ATP is buried deep within this dimer interface, the two Rad50cd1 molecules may have to completely disengage after ATP hydrolysis to allow the release of ADP before binding of a new ATP molecule. ATP binding is also accompanied by a 30 rotation of two distinct domains within each Rad50cd1 part of the dimer. This rotation and dimerisation creates a positively charged surface which, potentially, could provide a DNA-binding site capable of accommodating two DNA molecules.   The Mre11-docking site within Rad50 has been mapped to two 40-residue heptad-repeat sequences that lie adjacent to the N- and C-terminal ATPase segments. A distinct region within this domain forms a conserved hydrophobic patch that is believed to be the actual Mre11-binding site and lies immediately adjacent to the putative DNA-binding site of Rad50. As Rad50 dimerises in the presence of ATP and forms a stoichiometric complex with Mre11 (one Mre11 subunit binding to one Rad50 subunit), it is possible that the MR complex forms a closely coordinated DNA-binding unit that has the potential to act on two DNA molecules simultaneously. Within this unit, ATP-dependent control of nuclease action might be achieved via Rad50 unwinding or repositioning DNA ends into the active-site of Mre11 . ; GO: 0005524 ATP binding, 0006281 DNA repair, 0030870 Mre11 complex.
Probab=88.01  E-value=0.32  Score=27.57  Aligned_cols=50  Identities=10%  Similarity=0.232  Sum_probs=25.4

Q ss_pred             EEEEEEECCCCEECCHHCC-------------------CC-CCCEEEEEE-----ECCCEEEEEEEECCCCEEEE
Q ss_conf             4589997753030201038-------------------78-773699999-----52984999999978655999
Q gi|254780750|r  128 RNVVRLVTPGTLTEDQLLS-------------------PT-DSNYLMAVA-----RIRTEWAIAWIDISTGIFKI  177 (920)
Q Consensus       128 R~Vt~IiTpGT~~d~~~l~-------------------~~-~~nyL~aI~-----~~~~~~Gia~iDisTG~~~~  177 (920)
                      ..+..-+||-|++-+-.-.                   .. .|.|+-+-.     ..+..+-+-|.||.--.+.+
T Consensus        21 ~~~I~F~SP~T~l~GPNG~GKTT~IE~L~y~~TG~~P~~~K~NtFvH~~~VA~~T~V~A~~~L~F~DV~G~~~~~   95 (1328)
T TIGR00606        21 KQIIDFLSPLTLLVGPNGAGKTTIIEALKYVTTGDFPPGKKGNTFVHDPKVARETDVRAQVRLEFRDVKGEEVAV   95 (1328)
T ss_pred             CCEEEEECCCCEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHCCCCEEEEEEEEEEECCCEEEE
T ss_conf             423321166010127788752589875433204889888888600037222110532058899888617607887


No 388
>PRK12377 putative replication protein; Provisional
Probab=87.91  E-value=1.9  Score=21.80  Aligned_cols=103  Identities=17%  Similarity=0.187  Sum_probs=56.1

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHCCCCCCCEEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHCCCCC
Q ss_conf             99996778440789999999999999719853035320682210567652376611385328999999999999589985
Q gi|254780750|r  652 LWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHIGIVDKLFSRVGSADNLASGRSTFMVEMIETASILNQATNQS  731 (920)
Q Consensus       652 ~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a~i~~~D~IftRiGa~D~l~~g~STF~vEm~e~~~IL~~at~~S  731 (920)
                      -+|+.||---|||-+-=.+|.-++.  -|--|            +|+++.  |=+.+=..+|--...+ ...++....-.
T Consensus       103 NlIf~G~pGtGKTHLA~AIg~~a~~--~G~sV------------lF~t~~--dLv~~L~~a~~~g~~~-~k~l~~l~~~d  165 (248)
T PRK12377        103 NFVFSGKPGTGKNHLAAAIGNRLLA--KGRSV------------IVVTVP--DVMSRLHESYDNGQSG-EKFLQELCKVD  165 (248)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHHH--CCCEE------------EEEEHH--HHHHHHHHHHHCCCCH-HHHHHHHHCCC
T ss_conf             0899899998788999999999998--79969------------998899--9999999999848509-99999973389


Q ss_pred             EEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCC
Q ss_conf             69993258898805679999999999997269849997487
Q gi|254780750|r  732 FVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHF  772 (920)
Q Consensus       732 LVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy  772 (920)
                      |+||||+|--..+..+..+-.-++..=.+..++ ++++|-.
T Consensus       166 LLIIDElG~~~~s~~~~~llfqlI~~Ry~~~ks-~IiTTNL  205 (248)
T PRK12377        166 LLVLDEIGIQRETKNEQVVLNQIIDRRTASMRS-VGMLTNL  205 (248)
T ss_pred             EEEEHHCCCCCCCHHHHHHHHHHHHHHHHCCCC-EEEECCC
T ss_conf             898600057889867999999999999855798-6897589


No 389
>KOG2004 consensus
Probab=87.88  E-value=1.6  Score=22.39  Aligned_cols=104  Identities=25%  Similarity=0.440  Sum_probs=63.0

Q ss_pred             CCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHCCCCCCCEEEEEE---ECCC--CCCCCCCHHHHHHH-HHH
Q ss_conf             66439999677844078999999999999971985303532068221056765---2376--61138532899999-999
Q gi|254780750|r  648 NSGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHIGIVDKLFSRV---GSAD--NLASGRSTFMVEMI-ETA  721 (920)
Q Consensus       648 ~~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a~i~~~D~IftRi---Ga~D--~l~~g~STF~vEm~-e~~  721 (920)
                      -.+.++-.+||-.-||++.-|+||=.                   .+|=|-|+   |-.|  +|-..+-|+---|- .+-
T Consensus       436 ~qGkIlCf~GPPGVGKTSI~kSIA~A-------------------LnRkFfRfSvGG~tDvAeIkGHRRTYVGAMPGkiI  496 (906)
T KOG2004         436 VQGKILCFVGPPGVGKTSIAKSIARA-------------------LNRKFFRFSVGGMTDVAEIKGHRRTYVGAMPGKII  496 (906)
T ss_pred             CCCCEEEEECCCCCCCCCHHHHHHHH-------------------HCCCEEEEECCCCCCHHHHCCCCEEEECCCCHHHH
T ss_conf             78837998689987732189999998-------------------48746998536634277642542110014884899


Q ss_pred             HHHHHC-CCCCEEEEECC---CCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHH
Q ss_conf             999958-99856999325---88988056799999999999972698499974875797
Q gi|254780750|r  722 SILNQA-TNQSFVILDEI---GRGTATLDGLSIAWATIEYLHETNRCRGLLATHFHELT  776 (920)
Q Consensus       722 ~IL~~a-t~~SLVllDEl---GrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~  776 (920)
                      +-|+.+ |.|-||||||+   |||--   |-- |.|.||-|--. +- .=|--||-.+.
T Consensus       497 q~LK~v~t~NPliLiDEvDKlG~g~q---GDP-asALLElLDPE-QN-anFlDHYLdVp  549 (906)
T KOG2004         497 QCLKKVKTENPLILIDEVDKLGSGHQ---GDP-ASALLELLDPE-QN-ANFLDHYLDVP  549 (906)
T ss_pred             HHHHHHCCCCCEEEEEHHHHHCCCCC---CCH-HHHHHHHCCHH-HC-CCHHHHCCCCC
T ss_conf             99986177886588532234178877---986-89998743965-35-53454202664


No 390
>TIGR02142 modC_ABC molybdate ABC transporter, ATP-binding protein; InterPro: IPR011868   ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs.   ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain .    The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , .   The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , .   Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1).    This entry represents the ATP-binding cassette (ABC) protein of the three subunit molybdate ABC transporter. The three proteins of this complex are homologous to proteins of the sulphate ABC transporter. Molybdenum may be used in nitrogenases of nitrogen-fixing bacteria and in molybdopterin cofactors. In some cases, molybdate may be transported by a sulphate transporter rather than by a specific molybdate transporter.; GO: 0005524 ATP binding, 0015098 molybdate ion transmembrane transporter activity, 0015689 molybdate ion transport, 0009276 1-2nm peptidoglycan-based cell wall.
Probab=87.66  E-value=1.7  Score=22.07  Aligned_cols=139  Identities=25%  Similarity=0.339  Sum_probs=84.7

Q ss_pred             EEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHH--H------------CCCCCCHHHCCCCCC---CEEEE
Q ss_conf             434563587777664399996778440789999999999999--7------------198530353206822---10567
Q gi|254780750|r  636 ANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMA--Q------------MGSYVPASYAHIGIV---DKLFS  698 (920)
Q Consensus       636 pNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilA--Q------------iG~fVPA~~a~i~~~---D~Ift  698 (920)
                      .-|+.+..++    .-+.=|-|+=-+||||++|-||=++=..  |            -|-+.|+++=++|.|   =++|+
T Consensus        13 ~Ld~~~~~pg----~GvtAlFG~SGsGKTtli~~iaGL~rp~~G~i~l~G~~L~ds~k~i~Lp~ekRr~GYVFQeA~LFP   88 (361)
T TIGR02142        13 ELDVDLTLPG----QGVTALFGRSGSGKTTLIRLIAGLTRPDEGEIVLNGEVLFDSRKGIFLPPEKRRIGYVFQEARLFP   88 (361)
T ss_pred             EEEEEEECCC----CEEEEEECCCCCHHHHHHHHHHHCCCCCCCEEEECCEEEECCCCCCCCCCCCCEEEEEEECCEECC
T ss_conf             7777653287----406871258997078999998731675668799887462056776678720113536885355078


Q ss_pred             EEECCCCCCCCCCHHHHHH-----------HHHHHHHHH-----------------C--CCCCEEEEECCCCCCCHHHHH
Q ss_conf             6523766113853289999-----------999999995-----------------8--998569993258898805679
Q gi|254780750|r  699 RVGSADNLASGRSTFMVEM-----------IETASILNQ-----------------A--TNQSFVILDEIGRGTATLDGL  748 (920)
Q Consensus       699 RiGa~D~l~~g~STF~vEm-----------~e~~~IL~~-----------------a--t~~SLVllDElGrGTst~DG~  748 (920)
                      -.+-..||.-|.+--+.+-           .-+...|..                 |  |.=-|.||||-=   |.-|-.
T Consensus        89 Hl~Vr~NL~YG~~~~~~~~r~i~~~~v~~lLgi~hLL~R~p~~LSGGEkQRVAIGRALLs~P~LLLMDEPL---aaLD~~  165 (361)
T TIGR02142        89 HLSVRGNLRYGMKRARPKERRISFERVIELLGIEHLLERLPGRLSGGEKQRVAIGRALLSSPRLLLMDEPL---AALDEP  165 (361)
T ss_pred             CHHHHHHHHCCCCCCCHHHCCCCHHHHHHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCHHHCCCCH---HHCCHH
T ss_conf             52334551257210574121378899998746751121678875784047788998874187411104662---340644


Q ss_pred             HHHHHH---HHHHHHHCCCEEEEECCC-HHHHHHHHHC
Q ss_conf             999999---999997269849997487-5797664306
Q gi|254780750|r  749 SIAWAT---IEYLHETNRCRGLLATHF-HELTDLSKSL  782 (920)
Q Consensus       749 aiA~ai---le~l~~~~~~~~lfaTHy-~eL~~l~~~~  782 (920)
                      .= .-|   ||.|++..+--+||..|- .|+..|++..
T Consensus       166 rk-~EilPYLerL~~e~~iP~lyVSHsl~Ev~rLADrv  202 (361)
T TIGR02142       166 RK-KEILPYLERLHAELKIPILYVSHSLDEVARLADRV  202 (361)
T ss_pred             HH-HHHCCHHHHHHHHHCCCEEEEECCHHHHHHHHCEE
T ss_conf             46-64161676789872798899904979998760747


No 391
>PRK10078 ribose 1,5-bisphosphokinase; Provisional
Probab=87.40  E-value=0.59  Score=25.57  Aligned_cols=21  Identities=43%  Similarity=0.646  Sum_probs=18.5

Q ss_pred             CEEEEEECCCCCCHHHHHHHH
Q ss_conf             439999677844078999999
Q gi|254780750|r  650 GKLWLLTGPNMGGKSTFLRQN  670 (920)
Q Consensus       650 ~~~~iiTGpNmgGKSt~lRqv  670 (920)
                      +++.+|+||-.+||||+++.+
T Consensus         2 G~LivvsgPSGaGK~Tli~~l   22 (184)
T PRK10078          2 GKLIWLMGPSGSGKDSLLAAL   22 (184)
T ss_pred             CEEEEEECCCCCCHHHHHHHH
T ss_conf             709999899869999999999


No 392
>PRK06647 DNA polymerase III subunits gamma and tau; Validated
Probab=87.38  E-value=2  Score=21.58  Aligned_cols=15  Identities=20%  Similarity=0.284  Sum_probs=8.2

Q ss_pred             HHHHHHHHHHHHHHH
Q ss_conf             468887777643687
Q gi|254780750|r  255 VEKTAAAAAISYIKK  269 (920)
Q Consensus       255 ~~~~a~~all~Yl~~  269 (920)
                      +...|+.|||.-|++
T Consensus       131 Lt~~A~NALLKtLEE  145 (560)
T PRK06647        131 LSNSAFNALLKTIEE  145 (560)
T ss_pred             CCHHHHHHHHHHHHC
T ss_conf             599999999998634


No 393
>PRK06893 DNA replication initiation factor; Validated
Probab=87.24  E-value=2.1  Score=21.53  Aligned_cols=112  Identities=21%  Similarity=0.332  Sum_probs=59.6

Q ss_pred             CEEEEEECCCCCCHHHHHHHHHHHHHHHH-CCCCCCHHHCCCCCCCEEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHCC
Q ss_conf             43999967784407899999999999997-19853035320682210567652376611385328999999999999589
Q gi|254780750|r  650 GKLWLLTGPNMGGKSTFLRQNALIVIMAQ-MGSYVPASYAHIGIVDKLFSRVGSADNLASGRSTFMVEMIETASILNQAT  728 (920)
Q Consensus       650 ~~~~iiTGpNmgGKSt~lRqval~vilAQ-iG~fVPA~~a~i~~~D~IftRiGa~D~l~~g~STF~vEm~e~~~IL~~at  728 (920)
                      .+++.|.||-.+|||=+|..+|--..-+. -..|||++.+.-                      |.      ..++.+..
T Consensus        39 ~~~l~i~G~~gsGKTHLLqa~~~~~~~~~~~~~yi~~~~~~~----------------------~~------~~~l~~l~   90 (229)
T PRK06893         39 QPFFYIWGGKSSGKSHLLKAVSNHYLLNQRTAIYIPLSKSQY----------------------FS------PAVLENLE   90 (229)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHHHHCCCEEEEEHHHHHH----------------------CC------HHHHHHHH
T ss_conf             987999899999889999999999997189859997377564----------------------06------99998765


Q ss_pred             CCCEEEEECCCC--CCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCH--H----HHHHHHHCCCEEEEEEE
Q ss_conf             985699932588--988056799999999999972698499974875--7----97664306885899999
Q gi|254780750|r  729 NQSFVILDEIGR--GTATLDGLSIAWATIEYLHETNRCRGLLATHFH--E----LTDLSKSLKRFHNATLQ  791 (920)
Q Consensus       729 ~~SLVllDElGr--GTst~DG~aiA~aile~l~~~~~~~~lfaTHy~--e----L~~l~~~~~~v~n~~~~  791 (920)
                      .-.+|++|-+=-  |....+  -.-+-+...+.+..++..+++.+.+  +    +.+|...+.....+++.
T Consensus        91 ~~d~l~iDDi~~i~g~~~~e--~~lF~l~N~l~~~~~~~ll~ss~~~p~~l~~~l~DL~SRl~~~~~~~i~  159 (229)
T PRK06893         91 QQDLVCLDDLQAVIGNEEWE--LAIFDLFNRIKESGKTLLLISANQSPHALQIKLPDLASRLTWGEIYQLN  159 (229)
T ss_pred             HCCEEEEECHHHHCCCHHHH--HHHHHHHHHHHHCCCCEEEEECCCCHHHHCCHHHHHHHHHHCCEEEEEC
T ss_conf             47979996723424883899--9999999999975991799857988332210026799999688369966


No 394
>TIGR02868 CydC ABC transporter, CydDC cysteine exporter (CydDC-E) family, permease/ATP-binding protein CydC; InterPro: IPR014223   ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs.   ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain .    The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , .   The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , .   Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1).    This entry represents CydC, a member of a heterodimeric ATP-binding cassette-type transporter (ABC transporter). It is involved in the export of glutathione from the cytoplasm to the periplasm and is required for the assembly of both cytochrome c and cytochrome bd , , .; GO: 0042626 ATPase activity coupled to transmembrane movement of substances, 0006810 transport, 0016021 integral to membrane.
Probab=87.12  E-value=0.74  Score=24.83  Aligned_cols=144  Identities=25%  Similarity=0.330  Sum_probs=83.0

Q ss_pred             CCCCEEECC--CCCHHHHHHHHHCCCCCEEEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHH-HCCCC--
Q ss_conf             787140000--4680588763102877044434563587777664399996778440789999999999999-71985--
Q gi|254780750|r  608 NSTNFIVKD--GRHPIVEKTLKQQSSKPFIANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMA-QMGSY--  682 (920)
Q Consensus       608 ~~~~l~i~~--gRHPviE~~l~~~~~~~fVpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilA-QiG~f--  682 (920)
                      +++.+.+++  .+||         .+..+|=++|+|.-+    .++=.-|+||=-+||||++....=  ++. +-|-+  
T Consensus       356 ~~p~L~~~~ls~~~p---------g~~~~vl~~V~L~l~----~G~r~Ai~G~SG~GKsTLL~~L~G--~l~P~~G~vtl  420 (566)
T TIGR02868       356 DKPTLELRDLSVGYP---------GAPPNVLDGVSLDLP----PGERVAILGPSGSGKSTLLATLAG--LLDPLQGEVTL  420 (566)
T ss_pred             CCCEEEEEEEEEECC---------CCCHHHHCCCCCCCC----CCCCEEEECCCCCCHHHHHHHHHH--HCCCCCCCEEE
T ss_conf             875078987765269---------873465427864113----886089866887657899999984--02899991787


Q ss_pred             --CCHHH-------CCCCCCC---EEEE-------EEE---C----CC-----------------CCCCCCCHHHHHHHH
Q ss_conf             --30353-------2068221---0567-------652---3----76-----------------611385328999999
Q gi|254780750|r  683 --VPASY-------AHIGIVD---KLFS-------RVG---S----AD-----------------NLASGRSTFMVEMIE  719 (920)
Q Consensus       683 --VPA~~-------a~i~~~D---~Ift-------RiG---a----~D-----------------~l~~g~STF~vEm~e  719 (920)
                        ||..+       ..++.+.   ++|.       |||   +    +|                 .|-.|.+|=|.|+-.
T Consensus       421 ~G~~~~~~~~~evrr~v~~~aQ~aHlF~ttvr~NLrlarpdaaaGDtdeE~~~aL~~vgL~~~~~~LP~Gl~T~~ge~G~  500 (566)
T TIGR02868       421 DGVPVSSLSEDEVRRRVSVFAQDAHLFDTTVRENLRLARPDAAAGDTDEELLAALERVGLADWLRALPDGLDTVLGEGGA  500 (566)
T ss_pred             CCCCHHHCCCCHHEHHEEECCCCCCCCCCCHHHHHHHCCCCCCCCCCHHHHHHHHHHHCCCCHHHHCCCCCCCCCCCCCC
T ss_conf             77324325731100000312788621105478788731888899888899999999715802386385767853035643


Q ss_pred             -----------HHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHH-HHC-CCE-----EEEECCC
Q ss_conf             -----------9999995899856999325889880567999999999999-726-984-----9997487
Q gi|254780750|r  720 -----------TASILNQATNQSFVILDEIGRGTATLDGLSIAWATIEYLH-ETN-RCR-----GLLATHF  772 (920)
Q Consensus       720 -----------~~~IL~~at~~SLVllDElGrGTst~DG~aiA~aile~l~-~~~-~~~-----~lfaTHy  772 (920)
                                 .|.+|  .++--++||||-.=+=+...+    ..+++-|. +-. +=.     ++..||-
T Consensus       501 ~lSGGeRqRLALARaL--l~~ap~llLDEPTehLDa~t~----~~ll~dL~t~a~~g~t~~~R~vvliTH~  565 (566)
T TIGR02868       501 RLSGGERQRLALARAL--LADAPILLLDEPTEHLDAETA----DELLEDLLTAALSGRTESARAVVLITHH  565 (566)
T ss_pred             CCCHHHHHHHHHHHHH--HCCCCEEEECCCCCCCCHHHH----HHHHHHHHCCCCCCCCCCCCEEEEEEEC
T ss_conf             0104899999999997--379988986088666787679----9999998505544655898748987506


No 395
>pfam00437 GSPII_E Type II/IV secretion system protein. This family contains both type II and type IV pathway secretion proteins from bacteria. VirB11 ATPase is a subunit of the Agrobacterium tumefaciens transfer DNA (T-DNA) transfer system, a type IV secretion pathway required for delivery of T-DNA and effector proteins to plant cells during infection.
Probab=87.02  E-value=0.65  Score=25.24  Aligned_cols=22  Identities=27%  Similarity=0.250  Sum_probs=18.4

Q ss_pred             CEEEEEECCCCCCHHHHHHHHH
Q ss_conf             4399996778440789999999
Q gi|254780750|r  650 GKLWLLTGPNMGGKSTFLRQNA  671 (920)
Q Consensus       650 ~~~~iiTGpNmgGKSt~lRqva  671 (920)
                      ...++|+||=.+||||+|+...
T Consensus       139 ~~~ilIsG~TGSGKTT~l~all  160 (283)
T pfam00437       139 RGNILVSGGTGSGKTTLLYALL  160 (283)
T ss_pred             CCEEEEECCCCCCHHHHHHHHH
T ss_conf             9759998899998899999999


No 396
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair]
Probab=86.89  E-value=2.1  Score=21.39  Aligned_cols=97  Identities=16%  Similarity=0.275  Sum_probs=57.7

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHCCCCCCCEEEEEEECCCCCCCCCCHHHHHHHHH-------HHHH
Q ss_conf             999967784407899999999999997198530353206822105676523766113853289999999-------9999
Q gi|254780750|r  652 LWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHIGIVDKLFSRVGSADNLASGRSTFMVEMIET-------ASIL  724 (920)
Q Consensus       652 ~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a~i~~~D~IftRiGa~D~l~~g~STF~vEm~e~-------~~IL  724 (920)
                      -++++||=..|||-+.=.+|.-.+  +-|--            -+|+.+          +-|+-++.+.       ..++
T Consensus       107 nl~l~G~~G~GKthLa~Ai~~~l~--~~g~s------------v~f~~~----------~el~~~Lk~~~~~~~~~~~l~  162 (254)
T COG1484         107 NLVLLGPPGVGKTHLAIAIGNELL--KAGIS------------VLFITA----------PDLLSKLKAAFDEGRLEEKLL  162 (254)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHHH--HCCCE------------EEEEEH----------HHHHHHHHHHHHCCCHHHHHH
T ss_conf             289989999879999999999999--83984------------999885----------999999999874552689999


Q ss_pred             HHCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHH
Q ss_conf             95899856999325889880567999999999999726984999748757
Q gi|254780750|r  725 NQATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFHE  774 (920)
Q Consensus       725 ~~at~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~e  774 (920)
                      +....=.|.||||||-=+.+.-+..+..-++...... +.. +|+|.+..
T Consensus       163 ~~l~~~dlLIiDDlG~~~~~~~~~~~~~q~I~~r~~~-~~~-~~tsN~~~  210 (254)
T COG1484         163 RELKKVDLLIIDDIGYEPFSQEEADLLFQLISRRYES-RSL-IITSNLSF  210 (254)
T ss_pred             HHHHHCCEEEEECCCCCCCCCHHHHHHHHHHHHHHHH-CCC-CEEECCCH
T ss_conf             8875289899823677668815587999999999973-054-20205882


No 397
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair]
Probab=86.88  E-value=1.9  Score=21.74  Aligned_cols=14  Identities=14%  Similarity=0.180  Sum_probs=5.0

Q ss_pred             HHHHHHHHHHHHHH
Q ss_conf             11345666433464
Q gi|254780750|r  535 FTTLELIDLENRIT  548 (920)
Q Consensus       535 f~t~eL~~l~~~i~  548 (920)
                      |..|....++.++.
T Consensus       408 yy~p~~~g~E~~i~  421 (436)
T COG2256         408 YYQPTNRGFEKKIG  421 (436)
T ss_pred             CCCCCCCCHHHHHH
T ss_conf             20699850799999


No 398
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of recombinases includes the eukaryotic proteins RAD51, RAD55/57 and the meiosis-specific protein DMC1, and the archaeal proteins radA and radB. They are closely related to the bacterial RecA group. Rad51 proteins catalyze a similiar recombination reaction as RecA, using ATP-dependent DNA binding activity and a DNA-dependent ATPase. However, this reaction is less efficient and requires accessory proteins such as RAD55/57 .
Probab=86.82  E-value=2.2  Score=21.37  Aligned_cols=116  Identities=19%  Similarity=0.291  Sum_probs=59.2

Q ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHHHHHH-CC------CCCCHHHCCCC-----------------CCCEEEEEEECCC
Q ss_conf             643999967784407899999999999997-19------85303532068-----------------2210567652376
Q gi|254780750|r  649 SGKLWLLTGPNMGGKSTFLRQNALIVIMAQ-MG------SYVPASYAHIG-----------------IVDKLFSRVGSAD  704 (920)
Q Consensus       649 ~~~~~iiTGpNmgGKSt~lRqval~vilAQ-iG------~fVPA~~a~i~-----------------~~D~IftRiGa~D  704 (920)
                      .+.+..|.||-.+|||++.=|+|+.+.+.. .|      .||-++.. ++                 +.|+|+.-- +. 
T Consensus        18 ~G~itEi~G~~GsGKTql~lqla~~~~~~~~~~g~~~~vvyIdtE~~-f~~~Rl~qia~~~~~~~~~~l~~i~~~~-~~-   94 (235)
T cd01123          18 TGSITEIFGEFGSGKTQLCHQLAVTVQLPIELGGLEGKAVYIDTEGT-FRPERLVQIAERFGLDPEEVLDNIYVAR-AY-   94 (235)
T ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCC-CCHHHHHHHHHHHCCCHHHHHCCEEEEC-CC-
T ss_conf             78799999999984999999999998424753678962999953677-5889999999971347245422547963-79-


Q ss_pred             CCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEECC---------CCCCCHHHHHHHHH---HHHHHHHHHCCCEEEEECCC
Q ss_conf             6113853289999999999995899856999325---------88988056799999---99999997269849997487
Q gi|254780750|r  705 NLASGRSTFMVEMIETASILNQATNQSFVILDEI---------GRGTATLDGLSIAW---ATIEYLHETNRCRGLLATHF  772 (920)
Q Consensus       705 ~l~~g~STF~vEm~e~~~IL~~at~~SLVllDEl---------GrGTst~DG~aiA~---aile~l~~~~~~~~lfaTHy  772 (920)
                      |.    ..++--+.+....+....+-.||++|=+         |++ +..+....-.   ..|..|..+-++-++++-|-
T Consensus        95 ~~----~~l~~~l~~l~~~l~~~~~v~LvVIDSia~l~r~e~~~~~-~~~~r~~~l~~~~~~L~~lA~~~~~aVvvtNqv  169 (235)
T cd01123          95 NS----DHQLQLLEELEAILIESSRIKLVIVDSVTALFRAEFDGRG-ELAERQQHLAKLLRTLKRLADEFNVAVVITNQV  169 (235)
T ss_pred             CH----HHHHHHHHHHHHHHHCCCCCEEEEEEECHHHHHHHHCCCC-CHHHHHHHHHHHHHHHHHHHHHCCCEEEEECEE
T ss_conf             99----9999999999998730377239999610455566644886-447899999999999999999809799996806


No 399
>KOG0250 consensus
Probab=86.79  E-value=0.67  Score=25.14  Aligned_cols=11  Identities=9%  Similarity=0.184  Sum_probs=5.4

Q ss_pred             HHHHHHHHCCC
Q ss_conf             99999972698
Q gi|254780750|r  754 TIEYLHETNRC  764 (920)
Q Consensus       754 ile~l~~~~~~  764 (920)
                      |+.+|++..+|
T Consensus       586 V~N~LID~s~i  596 (1074)
T KOG0250         586 VLNVLIDKSGI  596 (1074)
T ss_pred             HHHHHHHHCCC
T ss_conf             88886432052


No 400
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion]
Probab=86.61  E-value=2.2  Score=21.29  Aligned_cols=118  Identities=24%  Similarity=0.345  Sum_probs=66.9

Q ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHCCCCCCCEEEEEEECCCCCCCCCCHH-------------HH
Q ss_conf             64399996778440789999999999999719853035320682210567652376611385328-------------99
Q gi|254780750|r  649 SGKLWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHIGIVDKLFSRVGSADNLASGRSTF-------------MV  715 (920)
Q Consensus       649 ~~~~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a~i~~~D~IftRiGa~D~l~~g~STF-------------~v  715 (920)
                      .++++.+-||-.-||+|.|=-.|-.-.|-       ..+-+++++.-===||||..-|    +|+             ..
T Consensus       202 ~~~vi~LVGPTGVGKTTTlAKLAar~~~~-------~~~~kVaiITtDtYRIGA~EQL----k~Ya~im~vp~~vv~~~~  270 (407)
T COG1419         202 QKRVIALVGPTGVGKTTTLAKLAARYVML-------KKKKKVAIITTDTYRIGAVEQL----KTYADIMGVPLEVVYSPK  270 (407)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHHHH-------CCCCCEEEEEECCCHHHHHHHH----HHHHHHHCCCEEEECCHH
T ss_conf             68579998998875887999999999753-------2576068997144115289999----999998699559963999


Q ss_pred             HHHHHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHC----CCEEEEEC-CCHHHHHHHHHCCC
Q ss_conf             99999999995899856999325889880567999999999999726----98499974-87579766430688
Q gi|254780750|r  716 EMIETASILNQATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETN----RCRGLLAT-HFHELTDLSKSLKR  784 (920)
Q Consensus       716 Em~e~~~IL~~at~~SLVllDElGrGTst~DG~aiA~aile~l~~~~----~~~~lfaT-Hy~eL~~l~~~~~~  784 (920)
                      |+.+.-.-|+++   -+||+|=.||  |.+|+.-++.  ++.+++..    -+++|=|| -|..|.+..+.+..
T Consensus       271 el~~ai~~l~~~---d~ILVDTaGr--s~~D~~~i~e--l~~~~~~~~~i~~~Lvlsat~K~~dlkei~~~f~~  337 (407)
T COG1419         271 ELAEAIEALRDC---DVILVDTAGR--SQYDKEKIEE--LKELIDVSHSIEVYLVLSATTKYEDLKEIIKQFSL  337 (407)
T ss_pred             HHHHHHHHHHCC---CEEEEECCCC--CCCCHHHHHH--HHHHHHCCCCCEEEEEEECCCCHHHHHHHHHHHCC
T ss_conf             999999985318---8899968998--8337899999--99997035662179998457646889999997245


No 401
>KOG1533 consensus
Probab=86.40  E-value=0.58  Score=25.64  Aligned_cols=37  Identities=16%  Similarity=0.173  Sum_probs=24.2

Q ss_pred             CCCCEEEECCHHHCCEEEEECCCCCCCCHHHHHHCCCCCCHHHHHHHHHHHHH
Q ss_conf             74540142513320154541278776412787630123433789999863100
Q gi|254780750|r  285 DIQSTLFIDSAARSNLEILRTLSGSREQSLLKTIDYSITGAGGRLFAERIASP  337 (920)
Q Consensus       285 ~~~~~m~LD~~Tl~nLEI~~~~~g~~~gSL~~~Ln~t~T~~G~RlLr~wL~~P  337 (920)
                      ..+.|+..|--  -+.|+|.     ..+||.+++         |.|++|=.++
T Consensus        95 ~~~~Y~lFDcP--GQVELft-----~h~~l~~I~---------~~Lek~~~rl  131 (290)
T KOG1533          95 LTDHYVLFDCP--GQVELFT-----HHDSLNKIF---------RKLEKLDYRL  131 (290)
T ss_pred             CCCCEEEEECC--CCEEEEE-----CCCHHHHHH---------HHHHHCCCEE
T ss_conf             34748999579--8279874-----256099999---------9999769537


No 402
>TIGR00763 lon ATP-dependent protease La; InterPro: IPR004815   Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes . They include a wide range of peptidase activity, including exopeptidase, endopeptidase, oligopeptidase and omega-peptidase activity. Over 20 families (denoted S1 - S66) of serine protease have been identified, these being grouped into clans on the basis of structural similarity and other functional evidence . Structures are known for members of the clans and the structures indicate that some appear to be totally unrelated, suggesting different evolutionary origins for the serine peptidases .   Not withstanding their different evolutionary origins, there are similarities in the reaction mechanisms of several peptidases. Chymotrypsin, subtilisin and carboxypeptidase C have a catalytic triad of serine, aspartate and histidine in common: serine acts as a nucleophile, aspartate as an electrophile, and histidine as a base . The geometric orientations of the catalytic residues are similar between families, despite different protein folds . The linear arrangements of the catalytic residues commonly reflect clan relationships. For example the catalytic triad in the chymotrypsin clan (PA) is ordered HDS, but is ordered DHS in the subtilisin clan (SB) and SDH in the carboxypeptidase clan (SC) , .   Peptidases are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry. Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins.   Families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule.    This signature defines the bacterial and eukaryotic lon proteases, which are ATP-dependent serine peptidases belonging to the MEROPS peptidase family S16 (lon protease family, clan SF). This family of sequences does not include the archaeal lon homologs, IPR004663 from INTERPRO. In the eukaryotes the majority of the proteins are located in the mitochondrial matrix , . In yeast, Pim1, is located in the mitochondrial matrix, is required for mitochondrial function, is constitutively expressed but is increased after thermal stress, suggesting that Pim1 may play a role in the heat shock response .; GO: 0004176 ATP-dependent peptidase activity, 0005524 ATP binding, 0006510 ATP-dependent proteolysis.
Probab=86.28  E-value=1.4  Score=22.76  Aligned_cols=104  Identities=30%  Similarity=0.469  Sum_probs=67.4

Q ss_pred             CCE-EEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHCCCCCCCEEEEEE---ECCC--CCCCCCCHHHH----HHH
Q ss_conf             643-9999677844078999999999999971985303532068221056765---2376--61138532899----999
Q gi|254780750|r  649 SGK-LWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPASYAHIGIVDKLFSRV---GSAD--NLASGRSTFMV----EMI  718 (920)
Q Consensus       649 ~~~-~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~~a~i~~~D~IftRi---Ga~D--~l~~g~STF~v----Em~  718 (920)
                      .+. ++-+-||=.=|||++=|+||=                   -..|=|.||   |-.|  .|=..+=|.--    =|.
T Consensus       448 ~GpqIlClvGPPGVGKTSlg~SIA~-------------------ALnRkFvR~SlGG~~DeAEIrGHRRTYvGAMPGrii  508 (941)
T TIGR00763       448 KGPQILCLVGPPGVGKTSLGKSIAK-------------------ALNRKFVRFSLGGVRDEAEIRGHRRTYVGAMPGRII  508 (941)
T ss_pred             CCCEEEEEECCCCCCHHHHHHHHHH-------------------HHCCEEEEEEECCCEEHHHCCCCCCCCCCCCHHHHH
T ss_conf             8876787207269542227899999-------------------968804999526722031127864320346725789


Q ss_pred             HHHHHHHHC-CCCCEEEEECC---C--CCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHH-HHHH
Q ss_conf             999999958-99856999325---8--8988056799999999999972698499974875797-6643
Q gi|254780750|r  719 ETASILNQA-TNQSFVILDEI---G--RGTATLDGLSIAWATIEYLHETNRCRGLLATHFHELT-DLSK  780 (920)
Q Consensus       719 e~~~IL~~a-t~~SLVllDEl---G--rGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~-~l~~  780 (920)
                         .-|+.| |.|=|+|||||   |  +|---.=    |.|.||=| +=.+- .=|.=||-++. +|++
T Consensus       509 ---Q~lk~~~t~NPl~LlDEIDK~~~~~~~~GDP----aSALLEvL-DPEQN-~~F~DHYldvp~DLS~  568 (941)
T TIGR00763       509 ---QGLKKAKTKNPLILLDEIDKIGLKSSFRGDP----ASALLEVL-DPEQN-NAFSDHYLDVPFDLSK  568 (941)
T ss_pred             ---HHHHHCCCCCCEEEEEEEEEECCCCCCCCCH----HHHHHHHC-CHHHC-CCCCCCCCCCCCCHHH
T ss_conf             ---9987604158806862022001678865563----78886412-86436-0425530023400420


No 403
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism]
Probab=86.21  E-value=2.3  Score=21.14  Aligned_cols=133  Identities=25%  Similarity=0.252  Sum_probs=67.1

Q ss_pred             EEEEEEECCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHC------CCCCCHHH---CCCCCCCEEEEEEECC--
Q ss_conf             443456358777766439999677844078999999999999971------98530353---2068221056765237--
Q gi|254780750|r  635 IANDCDLSCPNDKNSGKLWLLTGPNMGGKSTFLRQNALIVIMAQM------GSYVPASY---AHIGIVDKLFSRVGSA--  703 (920)
Q Consensus       635 VpNdi~l~~~~~~~~~~~~iiTGpNmgGKSt~lRqval~vilAQi------G~fVPA~~---a~i~~~D~IftRiGa~--  703 (920)
                      +=|++++..    ..+-.+=|-||--+||||+.|.++-+.== ..      |..++-..   +...+|--||-.-..+  
T Consensus        22 ~l~~VS~~i----~~Ge~lgivGeSGsGKSTL~r~l~Gl~~p-~~G~I~~~G~~~~~~~~~~~~~~~VQmVFQDp~~SLn   96 (252)
T COG1124          22 ALNNVSLEI----ERGETLGIVGESGSGKSTLARLLAGLEKP-SSGSILLDGKPLAPKKRAKAFYRPVQMVFQDPYSSLN   96 (252)
T ss_pred             HHCCEEEEE----CCCCEEEEECCCCCCHHHHHHHHHCCCCC-CCCEEEECCCCCCCCCCCHHHCCCEEEEECCCCCCCC
T ss_conf             414325996----48978999848989888999999565678-8862898884057665303330450699518722468


Q ss_pred             ------CCCC-----CCCCHH---HHHHH-----------------------HHHHHHH-HCCCCCEEEEECCCCCCCHH
Q ss_conf             ------6611-----385328---99999-----------------------9999999-58998569993258898805
Q gi|254780750|r  704 ------DNLA-----SGRSTF---MVEMI-----------------------ETASILN-QATNQSFVILDEIGRGTATL  745 (920)
Q Consensus       704 ------D~l~-----~g~STF---~vEm~-----------------------e~~~IL~-~at~~SLVllDElGrGTst~  745 (920)
                            +-|.     .|.+.=   ..|+.                       .. .|.| -+.+-.++|+||-   ||..
T Consensus        97 P~~tv~~~l~Epl~~~~~~~~~~~i~~~L~~VgL~~~~l~R~P~eLSGGQ~QRi-aIARAL~~~PklLIlDEp---tSaL  172 (252)
T COG1124          97 PRRTVGRILSEPLRPHGLSKSQQRIAELLDQVGLPPSFLDRRPHELSGGQRQRI-AIARALIPEPKLLILDEP---TSAL  172 (252)
T ss_pred             CCHHHHHHHHHHHCCCCCCHHHHHHHHHHHHCCCCHHHHHCCCHHCCHHHHHHH-HHHHHHCCCCCEEEECCC---HHHH
T ss_conf             410198997424303775378999999999849998998539421281689999-999986368887995382---3441


Q ss_pred             HHHHHHHHHHHHHHH---HCCCEEEEECCCHHHHH
Q ss_conf             679999999999997---26984999748757976
Q gi|254780750|r  746 DGLSIAWATIEYLHE---TNRCRGLLATHFHELTD  777 (920)
Q Consensus       746 DG~aiA~aile~l~~---~~~~~~lfaTHy~eL~~  777 (920)
                      |- ++-..|+..|.+   .-+--.||.||.-.+.+
T Consensus       173 D~-siQa~IlnlL~~l~~~~~lt~l~IsHdl~~v~  206 (252)
T COG1124         173 DV-SVQAQILNLLLELKKERGLTYLFISHDLALVE  206 (252)
T ss_pred             CH-HHHHHHHHHHHHHHHHCCCEEEEEECCHHHHH
T ss_conf             58-89999999999999861945999967299999


No 404
>cd01131 PilT Pilus retraction ATPase PilT. PilT is a nucleotide binding protein responsible for the retraction of type IV pili, likely by pili disassembly. This retraction provides the force required for travel of bacteria in low water environments by a mechanism known as twitching motility.
Probab=86.18  E-value=0.71  Score=24.99  Aligned_cols=19  Identities=53%  Similarity=0.607  Sum_probs=17.0

Q ss_pred             EEEEECCCCCCHHHHHHHH
Q ss_conf             9999677844078999999
Q gi|254780750|r  652 LWLLTGPNMGGKSTFLRQN  670 (920)
Q Consensus       652 ~~iiTGpNmgGKSt~lRqv  670 (920)
                      +.|||||-.+||||.|...
T Consensus         3 liLitG~TGSGKTTtl~al   21 (198)
T cd01131           3 LVLVTGPTGSGKSTTLAAM   21 (198)
T ss_pred             EEEEECCCCCCHHHHHHHH
T ss_conf             8999899999799999999


No 405
>TIGR03263 guanyl_kin guanylate kinase. Members of this family are the enzyme guanylate kinase, also called GMP kinase. This enzyme transfers a phosphate from ATP to GMP, yielding ADP and GDP.
Probab=86.15  E-value=0.84  Score=24.44  Aligned_cols=22  Identities=36%  Similarity=0.572  Sum_probs=18.9

Q ss_pred             CEEEEEECCCCCCHHHHHHHHH
Q ss_conf             4399996778440789999999
Q gi|254780750|r  650 GKLWLLTGPNMGGKSTFLRQNA  671 (920)
Q Consensus       650 ~~~~iiTGpNmgGKSt~lRqva  671 (920)
                      +++++|+||-.+||+|+++.+.
T Consensus         1 G~livl~GpsG~GK~tl~~~l~   22 (180)
T TIGR03263         1 GLLIVISGPSGVGKSTLVKALL   22 (180)
T ss_pred             CEEEEEECCCCCCHHHHHHHHH
T ss_conf             9399998999889999999999


No 406
>pfam05621 TniB Bacterial TniB protein. This family consists of several bacterial TniB NTP-binding proteins. TniB is a probable ATP-binding protein which is involved in Tn5053 mercury resistance transposition.
Probab=86.06  E-value=1.2  Score=23.34  Aligned_cols=48  Identities=15%  Similarity=0.173  Sum_probs=29.5

Q ss_pred             HHHHHHCCCCCEEEEECC---CCCCCHHHHHHHHHHHHHHHHHHCC-CEEEEECC
Q ss_conf             999995899856999325---8898805679999999999997269-84999748
Q gi|254780750|r  721 ASILNQATNQSFVILDEI---GRGTATLDGLSIAWATIEYLHETNR-CRGLLATH  771 (920)
Q Consensus       721 ~~IL~~at~~SLVllDEl---GrGTst~DG~aiA~aile~l~~~~~-~~~lfaTH  771 (920)
                      -..|+....+ ++|+||+   -+||...--  -..+.+.+|.+..+ +.+.+-|.
T Consensus       138 ~~ll~~~~vr-mLIIDEiHnlL~Gs~~~qr--~~ln~LK~L~Nel~IpiV~vGt~  189 (302)
T pfam05621       138 LALLRKVGVR-MLVIDELHNVLAGNSVNRR--EFLNLLRFLGNELRIPLVGVGTR  189 (302)
T ss_pred             HHHHHHCCCC-EEEEECHHHHCCCCHHHHH--HHHHHHHHHHHCCCCCEEEECCH
T ss_conf             9999974987-8998543656048688999--99999999863658786995319


No 407
>pfam06745 KaiC KaiC. This family represents a conserved region within bacterial and archaeal proteins, most of which are hypothetical. More than one copy is sometimes found in each protein. This family includes KaiC, which is one of the Kai proteins among which direct protein-protein association may be a critical process in the generation of circadian rhythms in cyanobacteria.
Probab=86.03  E-value=2.4  Score=21.08  Aligned_cols=122  Identities=16%  Similarity=0.152  Sum_probs=61.8

Q ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHHHHH--HCCCCCCHHHC---------CCCC-CCE------E-EEE-----EEC-C
Q ss_conf             64399996778440789999999999999--71985303532---------0682-210------5-676-----523-7
Q gi|254780750|r  649 SGKLWLLTGPNMGGKSTFLRQNALIVIMA--QMGSYVPASYA---------HIGI-VDK------L-FSR-----VGS-A  703 (920)
Q Consensus       649 ~~~~~iiTGpNmgGKSt~lRqval~vilA--QiG~fVPA~~a---------~i~~-~D~------I-ftR-----iGa-~  703 (920)
                      .+++.+|+||--+|||++.-|.+..-.+-  .-|+||-.+.-         .+++ ++.      + +..     .+. .
T Consensus        18 ~gs~~LI~G~pGsGKT~la~qfl~~ga~~~ge~~lYis~ee~~~~l~~~~~~~g~~~~~~~~~g~l~i~d~~~~~~~~~~   97 (231)
T pfam06745        18 EGRVVLITGGPGTGKTIFGLQFLYNGALEYGEPGVYVTLEEPPEDLRENAKSFGWDLEKLEEEGKLAIIDASTSGIGIAE   97 (231)
T ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEEECCCHHHHHHHHHHCCCCHHHHHHCCCEEEEECCCCCCCCCC
T ss_conf             99699998589725999999999999986589689998137999999999982998589864696789862544222100


Q ss_pred             CCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEECCCC---CCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHH
Q ss_conf             6611385328999999999999589985699932588---98805679999999999997269849997487579
Q gi|254780750|r  704 DNLASGRSTFMVEMIETASILNQATNQSFVILDEIGR---GTATLDGLSIAWATIEYLHETNRCRGLLATHFHEL  775 (920)
Q Consensus       704 D~l~~g~STF~vEm~e~~~IL~~at~~SLVllDElGr---GTst~DG~aiA~aile~l~~~~~~~~lfaTHy~eL  775 (920)
                      +....+...|...+   ...++.- +-..|++|=+.-   -.+...-...-+....++. ..+|.+||+.|.+..
T Consensus        98 ~~~~~~~~~~~~~i---~~~i~~~-~~~~vVIDsit~l~~~~~~~~~r~~l~~l~~~lk-~~g~t~l~t~e~~~~  167 (231)
T pfam06745        98 VKGRFDLEELIERL---REAIREI-GAKRVVIDSITTLFYLLKPAMAREILRRLKRVLK-KLGVTAIFTSEKPSG  167 (231)
T ss_pred             CCCCCCHHHHHHHH---HHHHHHH-CCCEEEEECCHHHHHCCCHHHHHHHHHHHHHHHH-HCCCEEEEEEEECCC
T ss_conf             11227999999999---9999971-9988999764164005889999999999999999-769919999821257


No 408
>COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only]
Probab=85.78  E-value=2.4  Score=20.99  Aligned_cols=53  Identities=13%  Similarity=0.107  Sum_probs=35.2

Q ss_pred             CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHC
Q ss_conf             9985699932588988056799999999999972698499974875797664306
Q gi|254780750|r  728 TNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFHELTDLSKSL  782 (920)
Q Consensus       728 t~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~~l~~~~  782 (920)
                      ..--||++||--.--+..--.|++.|+.+ + +.-|+.+++.||-+.+-...+..
T Consensus       489 G~P~lvVLDEPNsNLD~~GE~AL~~Ai~~-~-k~rG~~vvviaHRPs~L~~~Dki  541 (580)
T COG4618         489 GDPFLVVLDEPNSNLDSEGEAALAAAILA-A-KARGGTVVVIAHRPSALASVDKI  541 (580)
T ss_pred             CCCCEEEECCCCCCCCHHHHHHHHHHHHH-H-HHCCCEEEEEECCHHHHHHCCEE
T ss_conf             89708995589877652679999999999-9-97698799992677788515534


No 409
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases. The homohexamer, VirB11 is one of eleven Vir proteins, which are required for T-pilus biogenesis and virulence in the transfer of T-DNA from the Ti (tumor-inducing) plasmid of bacterial to plant cells. The pilus is a fibrous cell surface organelle, which mediates adhesion between bacteria during conjugative transfer or between bacteria and host eukaryotic cells during infection. VirB11- related ATPases include the archaeal flagella biosynthesis protein and the pilus assembly proteins CpaF/TadA and TrbB.  This alignment contains the C-terminal domain, which is the ATPase.
Probab=85.73  E-value=0.75  Score=24.81  Aligned_cols=105  Identities=21%  Similarity=0.335  Sum_probs=48.0

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCHH-HCCCCC----CCEEEEEEECCCCCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             99996778440789999999999999719853035-320682----2105676523766113853289999999999995
Q gi|254780750|r  652 LWLLTGPNMGGKSTFLRQNALIVIMAQMGSYVPAS-YAHIGI----VDKLFSRVGSADNLASGRSTFMVEMIETASILNQ  726 (920)
Q Consensus       652 ~~iiTGpNmgGKSt~lRqval~vilAQiG~fVPA~-~a~i~~----~D~IftRiGa~D~l~~g~STF~vEm~e~~~IL~~  726 (920)
                      -++|+||-.+||||+|+.+.-.+ -.. --.|-.+ ..++.+    +-++++|...    ..+...+  -   .+.+++.
T Consensus        27 nIlIsG~tGSGKTTll~al~~~i-~~~-~rivtiEd~~El~l~~~~~v~l~~~~~~----~~~~~~~--~---~~~li~~   95 (186)
T cd01130          27 NILISGGTGSGKTTLLNALLAFI-PPD-ERIITIEDTAELQLPHPNWVRLVTRPGN----VEGSGEV--T---MADLLRS   95 (186)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHC-CCC-CCEEEECCCHHHCCCCCCEEEEEEECCC----CCCCCEE--C---HHHHHHH
T ss_conf             89998999998999999999613-345-6459841535404777756888860464----5786503--4---9999887


Q ss_pred             C--CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHH
Q ss_conf             8--9985699932588988056799999999999972698499974875797
Q gi|254780750|r  727 A--TNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFHELT  776 (920)
Q Consensus       727 a--t~~SLVllDElGrGTst~DG~aiA~aile~l~~~~~~~~lfaTHy~eL~  776 (920)
                      |  -.-..|++-|+ ||-   +    |++.++.+.