HHsearch alignment of GI: 254780751 and MMDB domain: 1yz6_A_1-83

>1yz6_A (A:1-83) Probable translation initiation factor 2 alpha subunit; beta barrel, helical domain and alpha beta domain; 3.37A {Pyrococcus abyssi}
Probab=97.49  E-value=0.00031  Score=48.11  Aligned_cols=43  Identities=19%  Similarity=0.413  Sum_probs=36.9

Q ss_pred             CCCCCCEEEEEEEEECCCCCEEEEEECC--CCCCCCCHHHCCCCCCC
Q ss_conf             6042878798997836388231353278--97713022213712102
Q gi|254780751|r   36 KQIKGNIYLAKVTRVEPSLQAAFVDYGG--NRHGFLPFLEIHPDYYQ   80 (723)
Q Consensus        36 ~~~~GnIY~G~V~~V~p~lqAAFVdiG~--~k~gFL~~~ei~~~y~~   80 (723)
                      ....|.||.|+|++|.+  .+|||+||.  +..||+|.+|+..+|+.
T Consensus         7 ~~~~G~~v~g~V~~i~~--~G~fV~l~~~~gv~Gli~~~~~s~~~~~   51 (83)
T 1yz6_A            7 YPEEGEFVVATVKRIHN--YGAFLELDEYPGKEAFMHISEVASTWVR   51 (83)
T ss_dssp             SCCTTCEEEEEEEEEET--TEEEEEETTSTTCEEEEEGGGTSSSCCS
T ss_pred             CCCCCCEEEEEEEEEEC--CEEEEEECCCCCCEEEEEHHHCCCCCCC
T ss_conf             79999999999999972--4389997478992899898887774204