RPSBLAST alignment for GI: 254780754 and conserved domain: PRK01911

>gnl|CDD|179352 PRK01911, ppnK, inorganic polyphosphate/ATP-NAD kinase; Provisional. Length = 292
 Score = 73.4 bits (181), Expect = 6e-14
 Identities = 48/191 (25%), Positives = 86/191 (45%), Gaps = 38/191 (19%)

Query: 15  AKKAQEAYDKFVKIYGNSTSEEADVIVVLGGDGFMLQSFHQSKEYDKPIYGMNCGSVGFL 74
             K   +YD F           AD+++ +GGDG  L++       + PI G+N G +GFL
Sbjct: 45  DLKFHPSYDTFSD--NEELDGSADMVISIGGDGTFLRTATYVGNSNIPILGINTGRLGFL 102

Query: 75  M----------------NEYCIENLVERLSVAVECTFHPLKMTVFDYDNSICAENILAIN 118
                             +Y IE   ER  + +E             +  +  E   A+N
Sbjct: 103 ATVSKEEIEETIDELLNGDYTIE---ERSLLQLES------------NPKLFGELNFALN 147

Query: 119 EVSIIRKPGQNQLVQAAKLEVKVDDQVRLPELVCDGLVVSTPIGSTAYNFSALGPILPLE 178
           E++I+++   + +     +   ++ +  L     DGL+V+TP GST Y+ S  GPI+  +
Sbjct: 148 EIAILKRDTSSMI----TVHTYLNGEY-LNSYWADGLIVATPTGSTGYSLSCGGPIIVPD 202

Query: 179 SRHLLLTPVSP 189
           ++  ++TP++P
Sbjct: 203 AKSFVITPIAP 213