RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780755|ref|YP_003065168.1| octaprenyl-diphosphate synthase protein [Candidatus Liberibacter asiaticus str. psy62] (322 letters) >gnl|CDD|173833 cd00685, Trans_IPPS_HT, Trans-Isoprenyl Diphosphate Synthases, head-to-tail. These trans-Isoprenyl Diphosphate Synthases (Trans_IPPS) catalyze head-to-tail (HT) (1'-4) condensation reactions. This CD includes all-trans (E)-isoprenyl diphosphate synthases which synthesize various chain length (C10, C15, C20, C25, C30, C35, C40, C45, and C50) linear isoprenyl diphosphates from precursors, isopentenyl diphosphate (IPP) and dimethylallyl diphosphate (DMAPP). They catalyze the successive 1'-4 condensation of the 5-carbon IPP to allylic substrates geranyl-, farnesyl-, or geranylgeranyl-diphosphate. Isoprenoid chain elongation reactions proceed via electrophilic alkylations in which a new carbon-carbon single bond is generated through interaction between a highly reactive electron-deficient allylic carbocation and an electron-rich carbon-carbon double bond. The catalytic site consists of a large central cavity formed by mostly antiparallel alpha helices with two aspartate-rich regions (DDXX(XX)D) located on opposite walls. These residues mediate binding of prenyl phosphates via bridging Mg2+ ions, inducing proposed conformational changes that close the active site to solvent, protecting and stabilizing reactive carbocation intermediates. Farnesyl diphosphate synthases produce the precursors of steroids, cholesterol, sesquiterpenes, farnsylated proteins, heme, and vitamin K12; and geranylgeranyl diphosphate and longer chain synthases produce the precursors of carotenoids, retinoids, diterpenes, geranylgeranylated chlorophylls, ubiquinone, and archaeal ether linked lipids. Isoprenyl diphosphate synthases are widely distributed among archaea, bacteria, and eukareya. Length = 259 Score = 268 bits (688), Expect = 1e-72 Identities = 115/300 (38%), Positives = 168/300 (56%), Gaps = 45/300 (15%) Query: 25 SDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVL-LACAIEFIHTATLLHDD 83 S+VE++ + ++YL+ +GGKRLRP+L L A L L LA AIE +HTA+L+HDD Sbjct: 1 SEVELLREALRYLLLAGGKRLRPLLVLLAARALGGPELEAALRLAAAIELLHTASLVHDD 60 Query: 84 VVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEALEALSLVACT---L 140 V+D+S LRRGK V+GN T++L GD+LL++AF ++ + AL L + L Sbjct: 61 VMDNSDLRRGKPTVHKVFGNATAILAGDYLLARAFELLARLGNPYYPRALELFSEAILEL 120 Query: 141 AEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSVRQALKSYGMN 200 EG+L L + DVTEE+YL +I+ KTA LF+AA + +L+AG +ALK +G N Sbjct: 121 VEGQLLDLLSEYDTDVTEEEYLRIIRLKTAALFAAAPLLGALLAGADEEEAEALKRFGRN 180 Query: 201 LGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREKNFWKSTINDG 260 LG+AFQ+ DD+LD G+ +GK +G D R GK TLPV+LA + Sbjct: 181 LGLAFQIQDDILDLFGDPETLGKPVGSDLREGKCTLPVLLALRE---------------- 224 Query: 261 KISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSLMEVVDFCLQR 320 A Y +KA ++L+ LP+S +++L + DF L+R Sbjct: 225 -------------------------LAREYEEKALEALKALPESPAREALRALADFILER 259 >gnl|CDD|30491 COG0142, IspA, Geranylgeranyl pyrophosphate synthase [Coenzyme metabolism]. Length = 322 Score = 266 bits (681), Expect = 6e-72 Identities = 126/328 (38%), Positives = 202/328 (61%), Gaps = 13/328 (3%) Query: 2 KMLEDLTLKDMEKVNFLILKRIC-SDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60 L L LK + ++ L+ + + SD E++ + ++YL+ +GGKRLRP+L L A L Sbjct: 1 SDLLALLLKRLARIEELLSELLSGSDPELLLEAMRYLLLAGGKRLRPLLVLLAAEALGID 60 Query: 61 ----GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQ 116 G++ + LA AIE IHTA+L+HDD++DD LRRGK +G T++L GD LL+ Sbjct: 61 LETGGNDALDLAAAIELIHTASLIHDDLMDDDDLRRGKPTVHAKFGEATAILAGDALLAA 120 Query: 117 AFCMVIETKSQ--EALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFS 174 AF ++ + S+ EA++AL+ L G+ L +N VT E+YL VI+ KTA LF+ Sbjct: 121 AFELLSKLGSEALEAIKALAEAINGLCGGQALDL-AFENKPVTLEEYLRVIELKTAALFA 179 Query: 175 AALEVSSLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKP 234 AA + +++AG + +AL+ YG NLG+AFQ+ DD+LD G+ E+GK +G D + GKP Sbjct: 180 AAAVLGAILAGADEELLEALEDYGRNLGLAFQIQDDILDITGDEEELGKPVGSDLKEGKP 239 Query: 235 TLPVILAFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKA 294 TLPV+LA ++ + +K G++ ++A ++R++ A+ + A +Y +KA Sbjct: 240 TLPVLLALEKANEDQKLLRILLEGGGEV-----EEALELLRKSGAIEYAKNLAKTYVEKA 294 Query: 295 KDSLRCLPDSSWKKSLMEVVDFCLQRLN 322 K++L LPDS K++L+E+ DF ++R Sbjct: 295 KEALEKLPDSEAKEALLELADFIIKRKY 322 >gnl|CDD|144078 pfam00348, polyprenyl_synt, Polyprenyl synthetase. Length = 260 Score = 209 bits (534), Expect = 8e-55 Identities = 84/221 (38%), Positives = 133/221 (60%), Gaps = 6/221 (2%) Query: 34 VKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACAIEFIHTATLLHDDVVDDSALRRG 93 + Y + +GGKR+RP+L + A L + + LACAIE IHTA+L+HDD++D+S LRRG Sbjct: 5 MLYYLLAGGKRIRPLLVVLAARALGVEPETLLYLACAIEMIHTASLVHDDLMDNSDLRRG 64 Query: 94 KVAARLVWGNQTSVLVGDFLLSQAFCMVIETK----SQEALEALSLVACTLAEGELRQLS 149 K +G ++L GD LLS+AF ++ + + L A+GE+ QL Sbjct: 65 KPTCHKKFGEAGAILAGDALLSRAFQLLALLGHVRPEPKYILISELANAVGAQGEVGQLM 124 Query: 150 --LSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSVRQALKSYGMNLGIAFQL 207 ++ D+T E+YL ++ KTA LF A++++ +++AG + L +G +LG+AFQ+ Sbjct: 125 DLETEGKDITLEEYLRIVSYKTAALFYASVQLGAIVAGADEEDEKDLYDFGRDLGLAFQI 184 Query: 208 VDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKR 248 DD+LD G+ E+GK +G D + GK TLPV+LA + + Sbjct: 185 QDDILDLTGDTEELGKPVGTDLQEGKSTLPVLLALEGAREE 225 >gnl|CDD|173836 cd00867, Trans_IPPS, Trans-Isoprenyl Diphosphate Synthases. Trans-Isoprenyl Diphosphate Synthases (Trans_IPPS) of class 1 isoprenoid biosynthesis enzymes which either synthesis geranyl/farnesyl diphosphates (GPP/FPP) or longer chained products from isoprene precursors, isopentenyl diphosphate (IPP) and dimethylallyl diphosphate (DMAPP), or use geranyl (C10)-, farnesyl (C15)-, or geranylgeranyl (C20)-diphosphate as substrate. These enzymes produce a myriad of precursors for such end products as steroids, cholesterol, sesquiterpenes, heme, carotenoids, retinoids, diterpenes, ubiquinone, and archaeal ether linked lipids; and are widely distributed among archaea, bacteria, and eukareya. The enzymes in this family share the same 'isoprenoid synthase fold' and include the head-to-tail (HT) IPPS which catalyze the successive 1'-4 condensation of the 5-carbon IPP to the growing isoprene chain to form linear, all-trans, C10-, C15-, C20- C25-, C30-, C35-, C40-, C45-, or C50-isoprenoid diphosphates. The head-to-head (HH) IPPS catalyze the successive 1'-1 condensation of 2 farnesyl or 2 geranylgeranyl isoprenoid diphosphates. Isoprenoid chain elongation reactions proceed via electrophilic alkylations in which a new carbon-carbon single bond is generated through interaction between a highly reactive electron-deficient allylic carbocation and an electron-rich carbon-carbon double bond. The catalytic site consists of a large central cavity formed by mostly antiparallel alpha helices with two aspartate-rich regions located on opposite walls. These residues mediate binding of prenyl phosphates via bridging Mg2+ ions, inducing proposed conformational changes that close the active site to solvent, stabilizing reactive carbocation intermediates. Mechanistically and structurally distinct, cis-IPPS are not included in this CD. Length = 236 Score = 196 bits (501), Expect = 6e-51 Identities = 82/207 (39%), Positives = 120/207 (57%), Gaps = 2/207 (0%) Query: 45 LRPMLTLATALMLEYRGDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLV-WGN 103 RP+L L A L + + LA A+E +H A+L+HDD+VDDS LRRGK A L +GN Sbjct: 1 SRPLLVLLLARALGGDLEAALRLAAAVELLHAASLVHDDIVDDSDLRRGKPTAHLRRFGN 60 Query: 104 QTSVLVGDFLLSQAFCMVIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLH 163 ++L GD+LL++AF ++ ALE + L EG+ L ++ T ++YL Sbjct: 61 ALAILAGDYLLARAFQLLARLGYPRALELFAEALRELLEGQALDLEFERDTYETLDEYLE 120 Query: 164 VIKSKTAVLFSAALEVSSLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGK 223 + KTA L + + ++G + +ALK YG LG+AFQL DD+LD G+ E+GK Sbjct: 121 YCRYKTAGLVGLLCLLGAGLSGADDEQAEALKDYGRALGLAFQLTDDLLDVFGDAEELGK 180 Query: 224 NIGEDFRNGKPTLPVILAFQRGTKREK 250 +G D R G+ TLPVILA +R + + Sbjct: 181 -VGSDLREGRITLPVILARERAAEYAE 206 >gnl|CDD|164542 CHL00151, preA, prenyl transferase; Reviewed. Length = 323 Score = 187 bits (477), Expect = 3e-48 Identities = 96/297 (32%), Positives = 156/297 (52%), Gaps = 8/297 (2%) Query: 29 MIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGD---NHVLLACAIEFIHTATLLHDDVV 85 ++ K+L +GGKR+RP + L A + + LA E IHTA+L+HDDV+ Sbjct: 32 ILYAAAKHLFSAGGKRIRPAIVLLVAKATGGNMEIKTSQQRLAEITEIIHTASLVHDDVI 91 Query: 86 DDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEALEALSLVACTLAEGEL 145 D+ ++RRG ++G + +VL GDFL +Q+ + + E ++ +S V AEGE+ Sbjct: 92 DECSIRRGIPTVHKIFGTKIAVLAGDFLFAQSSWYLANLNNLEVVKLISKVITDFAEGEI 151 Query: 146 RQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSVRQALKSYGMNLGIAF 205 RQ + + ++ +Y+ KTA L +A+ + ++L++ YG +LG+AF Sbjct: 152 RQGLVQFDTTLSILNYIEKSFYKTASLIAASCKAAALLSDADEKDHNDFYLYGKHLGLAF 211 Query: 206 QLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREKNFWKSTINDGKISVE 265 Q++DDVLD +GK IG D +NG T PV+ A + +K K + IS Sbjct: 212 QIIDDVLDITSSTESLGKPIGSDLKNGNLTAPVLFALTQNSKLAKLIEREFCETKDIS-- 269 Query: 266 NLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSLMEVVDFCLQRLN 322 +A I++E + + A + Q A L+ LP SS K SL+E+ +F + RLN Sbjct: 270 ---QALQIIKETNGIEKAKDLALEHMQAAIQCLKFLPPSSAKDSLIEIANFIINRLN 323 >gnl|CDD|35995 KOG0776, KOG0776, KOG0776, Geranylgeranyl pyrophosphate synthase/Polyprenyl synthetase [Coenzyme transport and metabolism]. Length = 384 Score = 167 bits (425), Expect = 3e-42 Identities = 98/296 (33%), Positives = 151/296 (51%), Gaps = 19/296 (6%) Query: 34 VKYLIFSGGKRLRPMLTLATALMLEYRGD--NHVLLACAIEFIHTATLLHDDVV--DDSA 89 ++YL+ +GGKR+RP+L LA A L GD + LA +E IHTA+L+HDDV DD+ Sbjct: 99 MRYLLLAGGKRVRPLLCLA-ACELVGSGDESSQRSLAEIVEMIHTASLIHDDVPCMDDAD 157 Query: 90 LRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEALEALSLVACTLAEGELRQLS 149 LRRGK V+GN+ +VL GD LL+ A + ++ +E ++ L GE Q Sbjct: 158 LRRGKPTNHKVFGNKMAVLAGDALLALASEHLASLENPVVVELMASAIADLVRGEFTQGL 217 Query: 150 LSKNL----DVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSVRQALKSYGMNLGIAF 205 ++ DV E KTA L + + ++++ G V +A YG LG+AF Sbjct: 218 VAGEGLDLDDVGLEYLEFKTLLKTASLLAKSCVAAAILGGGSEEVIEAAFEYGRCLGLAF 277 Query: 206 QLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTK-REKNFWKSTINDGKISV 264 Q+VDD+LD+ E+GK G+D + GK T PV+ A ++ + REK + Sbjct: 278 QVVDDILDFTKSSEELGKTAGKDLKAGKLTAPVLFALEKSPELREK------LEREFSEP 331 Query: 265 ENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSLMEVVDFCLQR 320 + A + + +Y A + KA ++L+ LP S + +L +V L R Sbjct: 332 LDGFDADKAV---PGVALAKYLARRHNNKALEALQSLPRSEARSALENLVLAVLTR 384 >gnl|CDD|173830 cd00385, Isoprenoid_Biosyn_C1, Isoprenoid Biosynthesis enzymes, Class 1. Superfamily of trans-isoprenyl diphosphate synthases (IPPS) and class I terpene cyclases which either synthesis geranyl/farnesyl diphosphates (GPP/FPP) or longer chained products from isoprene precursors, isopentenyl diphosphate (IPP) and dimethylallyl diphosphate (DMAPP), or use geranyl (C10)-, farnesyl (C15)-, or geranylgeranyl (C20)-diphosphate as substrate. These enzymes produce a myriad of precursors for such end products as steroids, cholesterol, sesquiterpenes, heme, carotenoids, retinoids, and diterpenes; and are widely distributed among archaea, bacteria, and eukaryota.The enzymes in this superfamily share the same 'isoprenoid synthase fold' and include several subgroups. The head-to-tail (HT) IPPS catalyze the successive 1'-4 condensation of the 5-carbon IPP to the growing isoprene chain to form linear, all-trans, C10-, C15-, C20- C25-, C30-, C35-, C40-, C45-, or C50-isoprenoid diphosphates. Cyclic monoterpenes, diterpenes, and sesquiterpenes, are formed from their respective linear isoprenoid diphosphates by class I terpene cyclases. The head-to-head (HH) IPPS catalyze the successive 1'-1 condensation of 2 farnesyl or 2 geranylgeranyl isoprenoid diphosphates. Cyclization of these 30- and 40-carbon linear forms are catalyzed by class II cyclases. Both the isoprenoid chain elongation reactions and the class I terpene cyclization reactions proceed via electrophilic alkylations in which a new carbon-carbon single bond is generated through interaction between a highly reactive electron-deficient allylic carbocation and an electron-rich carbon-carbon double bond. The catalytic site consists of a large central cavity formed by mostly antiparallel alpha helices with two aspartate-rich regions located on opposite walls. These residues mediate binding of prenyl phosphates via bridging Mg2+ ions, inducing proposed conformational changes that close the active site to solvent, stabilizing reactive carbocation intermediates. Generally, the enzymes in this family exhibit an all-trans reaction pathway, an exception, is the cis-trans terpene cyclase, trichodiene synthase. Mechanistically and structurally distinct, class II terpene cyclases and cis-IPPS are not included in this CD. Length = 243 Score = 144 bits (366), Expect = 2e-35 Identities = 73/209 (34%), Positives = 102/209 (48%), Gaps = 20/209 (9%) Query: 45 LRPMLTLATALMLEYRGDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLV---W 101 RP+ L L A+E +H A+L+HDD+VDDS RRG A L Sbjct: 1 FRPLAVLLEPEASR--------LRAAVEKLHAASLVHDDIVDDSGTRRGLPTAHLAVAID 52 Query: 102 GNQTSVLVGDFLLSQAFCMVIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDY 161 G ++L GD LL+ AF + S EALE L+ L EG+L L + T E+Y Sbjct: 53 GLPEAILAGDLLLADAFEELAREGSPEALEILAEALLDLLEGQLLDLKWRREYVPTLEEY 112 Query: 162 LHVIKSKTAVLFSAALEVSSLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEM 221 L + KTA L A + + ++G + + +AL+ G LG+AFQL +D+LDY G+ Sbjct: 113 LEYCRYKTAGLVGALCLLGAGLSGGEAELLEALRKLGRALGLAFQLTNDLLDYEGDAERG 172 Query: 222 GKNIGEDFRNGKPTLPVILAFQRGTKREK 250 GK TLPV+ A + G E Sbjct: 173 ---------EGKCTLPVLYALEYGVPAED 192 >gnl|CDD|35996 KOG0777, KOG0777, KOG0777, Geranylgeranyl pyrophosphate synthase/Polyprenyl synthetase [Coenzyme transport and metabolism]. Length = 322 Score = 77.0 bits (189), Expect = 7e-15 Identities = 55/215 (25%), Positives = 101/215 (46%), Gaps = 5/215 (2%) Query: 28 EMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACAIEFIHTATLLHDDVVDD 87 ++ Y++ GK+ R L +A L D +++ +E +H ++LL DD+ D+ Sbjct: 21 SILLKPYNYILQKPGKQFRLNLIVAFNHWLNLPKDKLAIISQIVEMLHNSSLLIDDIEDN 80 Query: 88 SALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEALEALSLVACTLAEGELRQ 147 S LRRG+ A ++G +++ +++ A V + A++ + L G+ Sbjct: 81 SPLRRGQPVAHSIYGVPSTINTANYMYFLALEKVSQLDHPNAIKIFTEQLLELHRGQGLD 140 Query: 148 LSLSKNLDV-TEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSVRQALKSYGMNLGIAFQ 206 + L TEE Y +++ +KT LF AL + L + ++ L LG+ FQ Sbjct: 141 IYWRDFLTCPTEEMYKNMVMNKTGGLFRLALRLMQLFS----HHKEDLVPLINLLGLIFQ 196 Query: 207 LVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILA 241 + DD L+ + + K+ ED GK + P+I A Sbjct: 197 IRDDYLNLKDKEYSENKSFAEDLTEGKFSFPIIHA 231 >gnl|CDD|35930 KOG0711, KOG0711, KOG0711, Polyprenyl synthetase [Coenzyme transport and metabolism]. Length = 347 Score = 50.8 bits (121), Expect = 5e-07 Identities = 65/271 (23%), Positives = 110/271 (40%), Gaps = 26/271 (9%) Query: 29 MIPDVVKYLIFS------GGKRLRPMLTLAT-ALMLEYRGDNH------VLLACAIEFIH 75 D ++L GGK R + + + ++E R + ++L +E + Sbjct: 32 ESGDATEWLKEVLDYNVIGGKLNRGLSVVDSFKALVEPRKLDEEELQLALILGWCVELLQ 91 Query: 76 TATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETK-----SQEAL 130 L+ DD++D+S RRG+ G + FLL A +++ L Sbjct: 92 AFFLVADDIMDNSKTRRGQPCWYQKPGVGLDAINDAFLLEAAIYKLLKKHFRNIYCYVDL 151 Query: 131 EALSLVACTLAEGELRQLSLSKNLDV---TEEDYLHVIKSKTAVL-FSAALEVSSLIAGV 186 L E + N D+ + E Y+ +++ KTA F + ++ L+AG+ Sbjct: 152 VELFHEVTFQTELGDLLTTPEGNKDLSKFSLEKYVFIVEYKTAYYSFYLPVALALLLAGI 211 Query: 187 QNSVRQA-LKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRG 245 N A K + LG FQ+ DD LD G+ GK IG D ++ K + V+ A QR Sbjct: 212 ANLKEHACEKKVLLLLGEYFQVQDDYLDCFGDPEVTGK-IGTDIQDNKCSWLVVKALQRA 270 Query: 246 TKREKNFWKSTINDGKISVENLKKAFIIMRE 276 + + N GK E + K + +E Sbjct: 271 SAEQYKILFE--NYGKPEAEAVAKVKALYKE 299 >gnl|CDD|32666 COG2838, Icd, Monomeric isocitrate dehydrogenase [Energy production and conversion]. Length = 744 Score = 28.8 bits (64), Expect = 2.2 Identities = 13/39 (33%), Positives = 21/39 (53%) Query: 279 ALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSLMEVVDFC 317 A++ R + K KD+ +PDS++ EV+DFC Sbjct: 357 AMIRNSGRMWGKDGKLKDTKAVIPDSTYAGIYQEVIDFC 395 >gnl|CDD|35282 KOG0059, KOG0059, KOG0059, Lipid exporter ABCA1 and related proteins, ABC superfamily [Lipid transport and metabolism, General function prediction only]. Length = 885 Score = 28.5 bits (63), Expect = 2.4 Identities = 22/110 (20%), Positives = 38/110 (34%), Gaps = 5/110 (4%) Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180 ++ + S E EAL + G+LR + + L + EVS Sbjct: 752 ILTSHSMEEAEALCTRTAIMVIGQLRCIGSPQELKSRYGSGYTLTVR-----IKELPEVS 806 Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFR 230 + +QN A+ +AF++ D + EV + E F Sbjct: 807 EVEKLLQNRFPGAVLKERHAGLLAFEIPKDEVVSLSEVFLALEKAKESFG 856 >gnl|CDD|35828 KOG0608, KOG0608, KOG0608, Warts/lats-like serine threonine kinases [Cell cycle control, cell division, chromosome partitioning]. Length = 1034 Score = 28.2 bits (62), Expect = 3.2 Identities = 10/24 (41%), Positives = 14/24 (58%) Query: 67 LACAIEFIHTATLLHDDVVDDSAL 90 L CAIE +H +H D+ D+ L Sbjct: 738 LTCAIESVHKMGFIHRDIKPDNIL 761 >gnl|CDD|112770 pfam03971, IDH, Monomeric isocitrate dehydrogenase. NADP(+)-dependent isocitrate dehydrogenase (ICD) is an important enzyme of the intermediary metabolism, as it controls the carbon flux within the citric acid cycle and supplies the cell with 2-oxoglutarate EC:1.1.1.42 and NADPH for biosynthetic purposes. Length = 735 Score = 27.9 bits (62), Expect = 3.7 Identities = 12/39 (30%), Positives = 21/39 (53%) Query: 279 ALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSLMEVVDFC 317 A++ + + K KD+ +PDS++ EV+DFC Sbjct: 351 AMIRNSGQMWGKDGKLKDTKAVIPDSTYAGVYQEVIDFC 389 >gnl|CDD|144030 pfam00290, Trp_syntA, Tryptophan synthase alpha chain. Length = 258 Score = 28.0 bits (63), Expect = 4.2 Identities = 13/55 (23%), Positives = 22/55 (40%), Gaps = 19/55 (34%) Query: 186 VQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240 +Q + +AL GM L +LV E+ RN ++P++L Sbjct: 56 IQRANLRALAG-GMTLDQTLELV------------------EEIRNKGTSVPIVL 91 >gnl|CDD|144184 pfam00494, SQS_PSY, Squalene/phytoene synthase. Length = 262 Score = 27.7 bits (62), Expect = 4.2 Identities = 33/169 (19%), Positives = 61/169 (36%), Gaps = 42/169 (24%) Query: 82 DDVVDDSALRRGKVAARLVW--------GNQTSVLVGDFLLSQAFCMVIETK--SQEALE 131 DD+VD+ + ARL W + + +A + +E Sbjct: 34 DDIVDEVSDP-LIGRARLDWWRDALDAAFAGRRLGPSTHPVLRALADTVRRYDLPREPFL 92 Query: 132 ALSLVACTLAEGELRQLSLSKNLDVTEED---YLHVIKSKTAVLFSAALEVSSLIAGVQN 188 L +G ++ L K+ T + Y + + A + + GV++ Sbjct: 93 EL-------IDG--MEMDLEKDRYETLAELEEYCY----RVA---GVVGLLLLRLLGVRD 136 Query: 189 SVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLP 237 +A +LG+A QL ++L +++GED R G+ LP Sbjct: 137 D-AEAADEAARHLGLALQLT-NIL----------RDVGEDARRGRVYLP 173 >gnl|CDD|132964 cd06633, STKc_TAO3, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3. Serine/threonine kinases (STKs), thousand-and-one amino acids 3 (TAO3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TAO subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. TAO proteins possess mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK) activity. MAPK signaling cascades are important in mediating cellular responses to extracellular signals. TAO3 is also known as JIK (JNK inhibitory kinase) or KFC (kinase from chicken). It specifically activates c-Jun N-terminal kinase (JNK), presumably by phosphorylating and activating MKK4/MKK7. In Saccharomyces cerevisiae, TAO3 is a component of the RAM (regulation of Ace2p activity and cellular morphogenesis) signaling pathway. TAO3 is upregulated in retinal ganglion cells after axotomy, and may play a role in apoptosis. Length = 313 Score = 27.3 bits (60), Expect = 5.6 Identities = 19/64 (29%), Positives = 29/64 (45%), Gaps = 2/64 (3%) Query: 259 DGKISVENLKKAFIIMRENR-ALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSLMEVVDFC 317 DGK+ V +L I + E + L + + Y DS L + W S VD+C Sbjct: 198 DGKVDVWSLGITCIELAERKPPLFNMNAMSALYHIAQNDS-PTLQSNEWTDSFRGFVDYC 256 Query: 318 LQRL 321 LQ++ Sbjct: 257 LQKI 260 >gnl|CDD|36874 KOG1661, KOG1661, KOG1661, Protein-L-isoaspartate(D-aspartate) O-methyltransferase [Posttranslational modification, protein turnover, chaperones]. Length = 237 Score = 27.2 bits (60), Expect = 6.7 Identities = 17/58 (29%), Positives = 24/58 (41%), Gaps = 5/58 (8%) Query: 252 FWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLP--DSSWK 307 W S+ +D ++NL++ II V+ RA A S R P DS K Sbjct: 2 GWVSSGSDNDDLIDNLRENKIIRTRR---VEQAMRATDRSDYAPRSERTNPYMDSPQK 56 >gnl|CDD|31750 COG1562, ERG9, Phytoene/squalene synthetase [Lipid metabolism]. Length = 288 Score = 27.2 bits (60), Expect = 6.7 Identities = 42/185 (22%), Positives = 61/185 (32%), Gaps = 39/185 (21%) Query: 60 RGDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVW-----GNQTSVLVGDFLL 114 R L A E DDVVD + L W G+ + D + Sbjct: 36 REAVWALYAFCREA--------DDVVDGVSDPDLPAEILLAWRRELDGDFSGQPASDHPV 87 Query: 115 SQAFCMVIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTE-EDYLHVIKSKTAVLF 173 A V L + A L + L ++ LD E E+Y + + +L Sbjct: 88 LAALVEVARRF---GLPREAFPA--LIDAMRMDLDRTRYLDFEELEEYCYGVAGAVGLLL 142 Query: 174 SAALEVSSLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGK 233 + L A ++Y LG+A QLV+ + D GED R G+ Sbjct: 143 ARILGPDK---------DAATRAYARGLGLALQLVNILRDV-----------GEDRRRGR 182 Query: 234 PTLPV 238 LP Sbjct: 183 VYLPA 187 >gnl|CDD|99750 cd06259, YdcF-like, YdcF-like. YdcF-like is a large family of mainly bacterial proteins, with a few members found in fungi, plants, and archaea. Escherichia coli YdcF has been shown to bind S-adenosyl-L-methionine (AdoMet), but a biochemical function has not been idenitified. The family also includes Escherichia coli sanA and Salmonella typhimurium sfiX, which are involved in vancomycin resistance; sfiX may also be involved in murein synthesis.. Length = 150 Score = 26.9 bits (60), Expect = 7.0 Identities = 20/92 (21%), Positives = 28/92 (30%), Gaps = 20/92 (21%) Query: 34 VKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACAI-----------EFIHTATLLHD 82 LI SGG+ + A A M Y + V A AI +A LL + Sbjct: 35 APKLIVSGGQGPGEGYSEAEA-MARYLIELGV-PAEAILLEDRSTNTYENARFSAELLRE 92 Query: 83 D-------VVDDSALRRGKVAARLVWGNQTSV 107 V + R + R + V Sbjct: 93 RGIRSVLLVTSAYHMPRALLIFRKAGLDVEVV 124 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.321 0.136 0.384 Gapped Lambda K H 0.267 0.0607 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 3,690,029 Number of extensions: 188605 Number of successful extensions: 485 Number of sequences better than 10.0: 1 Number of HSP's gapped: 463 Number of HSP's successfully gapped: 31 Length of query: 322 Length of database: 6,263,737 Length adjustment: 94 Effective length of query: 228 Effective length of database: 4,232,491 Effective search space: 965007948 Effective search space used: 965007948 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 57 (26.0 bits)