>TIGR00388 glyQ glycyl-tRNA synthetase, alpha subunit; InterPro: IPR002310 The aminoacyl-tRNA synthetases (6.1.1. from EC) catalyse the attachment of an amino acid to its cognate transfer RNA molecule in a highly specific two-step reaction. These proteins differ widely in size and oligomeric state, and have limited sequence homology . The 20 aminoacyl-tRNA synthetases are divided into two classes, I and II. Class I aminoacyl-tRNA synthetases contain a characteristic Rossman fold catalytic domain and are mostly monomeric . Class II aminoacyl-tRNA synthetases share an anti-parallel beta-sheet fold flanked by alpha-helices , and are mostly dimeric or multimeric, containing at least three conserved regions , , . However, tRNA binding involves an alpha-helical structure that is conserved between class I and class II synthetases. In reactions catalysed by the class I aminoacyl-tRNA synthetases, the aminoacyl group is coupled to the 2'-hydroxyl of the tRNA, while, in class II reactions, the 3'-hydroxyl site is preferred. The synthetases specific for arginine, cysteine, glutamic acid, glutamine, isoleucine, leucine, methionine, tyrosine, tryptophan and valine belong to class I synthetases; these synthetases are further divided into three subclasses, a, b and c, according to sequence homology. The synthetases specific for alanine, asparagine, aspartic acid, glycine, histidine, lysine, phenylalanine, proline, serine, and threonine belong to class-II synthetases . In eubacteria, glycyl-tRNA synthetase (6.1.1.14 from EC) is an alpha2/beta2 tetramer composed of 2 different subunits , , . In some eubacteria, in archaea and eukaryota, glycyl-tRNA synthetase is an alpha2 dimer (see IPR002315 from INTERPRO). It belongs to class IIc and is one of the most complex synthetases. What is most interesting is the lack of similarity between the two types: divergence at the sequence level is so great that it is impossible to infer descent from common genes. The alpha and beta subunits (see IPR002311 from INTERPRO) also lack significant sequence similarity. However, they are translated from a single mRNA , and a single chain glycyl-tRNA synthetase from Chlamydia trachomatis has been found to have significant similarity with both domains, suggesting divergence from a single polypeptide chain .; GO: 0000166 nucleotide binding, 0004820 glycine-tRNA ligase activity, 0005524 ATP binding, 0006412 translation, 0006426 glycyl-tRNA aminoacylation, 0005737 cytoplasm.

Probab=100.00 E-value=0 Score=727.61 Aligned_cols=285 Identities=61% Similarity=1.105 Sum_probs=279.9 Q ss_pred CCHHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCHHHHHHHCCCCCCEEEEECCCCCCCCCCCCCCCCCCCEEEEEEEE Q ss_conf 77999999999999866958961167543332248578987448344016764155788765546677500114444557 Q gi|254780757|r 11 LSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPLDGRYAENPNRLQHYYQFQVI 90 (307) Q Consensus 11 ~~fq~ii~~L~~fW~~~GC~i~qpyd~e~GAgT~hp~T~lr~lg~~pw~~aYvqPsrRP~DgRYGeNPNRlq~y~QfQVi 90 (307) T Consensus 1 ~~~~~~~~~~~~~w~~~gc~~~~p~d~~~g~g~~~p~~~~~~~gp~p~~~~~~~p~~~p~dg~~g~~p~~~~~~~~~~~~ 80 (295) T TIGR00388 1 LTFQGLLLKLQEYWANQGCLLVQPYDVEKGAGTLHPATFLRSLGPEPWSVAYVEPSRRPTDGRYGENPNRLGHYYQFQVV 80 (295) T ss_pred CCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCHHHHHHHCCCCCCEEEEECCCCCCCCCCCCCCHHHHHHEEEEEEE T ss_conf 93588999988864106714641123322455220467876507652101000344576666567770132110025678 Q ss_pred ECCCCHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCCCHHHHCCCCEEEEECCEEEHHHHHHHHHCCCCCCCCHHHHHHH Q ss_conf 57983358999999999819996217179883288870011012321768878741477789986682577514567878 Q gi|254780757|r 91 IKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYG 170 (307) Q Consensus 91 lKPsp~niq~lYl~SL~~iGid~~~hDIrFveDnWEsPtLGAwGlGWEvwldGMEItQFTYFQQvGGi~c~pv~~EiTYG 170 (307) T Consensus 81 ~~p~p~~~~~~~~~~~~~~g~~~~~~d~~~~~d~w~~p~~g~wg~gw~~w~~g~~~~~~~~~~~~gg~~c~p~~~~~~~g 160 (295) T TIGR00388 81 IKPSPDNIQELYLDSLRALGIDPTEHDIRFVEDNWENPTLGAWGLGWEVWLDGLEVTQFTYFQQVGGLECKPVSVEITYG 160 (295) T ss_pred ECCCCCHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCHHHHCCCCHHHHHHHHHHHCCCCCCCCCEEHHHH T ss_conf 61684125787765566633773201100000256775443122433222054112333334430663224321100221 Q ss_pred HHHHHHHHCCCCCEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHH--HHHCCCCCCCC Q ss_conf 9999999869982113320688878831106244746997776350179899999999999999999--85006653233 Q gi|254780757|r 171 LERLAMYVQNVNSVYDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDL--LKKGIPNEHHR 248 (307) Q Consensus 171 LERiaMylQ~vdnvyDl~wn~~~~~~vtYGdif~q~E~E~S~YNFE~Ad~~~L~~~F~~yE~Ea~rL--le~~LP~~~~~ 248 (307) T Consensus 161 ~~~~~~~~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~----- 235 (295) T TIGR00388 161 LERLALYLQGVENVLDLEWSDGPLGKLTYGDVFLEGEYEQSTYNFETADVDLLFELFSLYEKEALKLLALENGLP----- 235 (295) T ss_pred HHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCC----- T ss_conf 788888762011233311035655531022333310122211001112378999999877777777765303566----- Q ss_pred CCCCCCCHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHC Q ss_conf 553013828999999999878883875017889999999999999999999854516 Q gi|254780757|r 249 HHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNG 305 (307) Q Consensus 249 ~~~lvlPAYD~~LKaSH~FNLLDARGaISVTERq~YI~RIR~Lak~~A~ayl~~re~ 305 (307) T Consensus 236 -----~p~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 287 (295) T TIGR00388 236 -----LPAYDYVLKCSHSFNLLDARGAISVTERTRYILRIRNLAKGVAELYYEEREA 287 (295) T ss_pred -----CHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf -----4046777775433322210000212233457888888888889887754554

HHsearch alignment for GI: 254780757 and conserved domain: TIGR00388