HHsearch alignment of GI: 254780757 and MMDB domain: 2zze_A_1-266

>2zze_A (A:1-266) Alanyl-tRNA synthetase; ligase, hydrolase; HET: MLY; 2.16A {Pyrococcus horikoshii} PDB: 2zzf_A 2zzg_A*
Probab=97.97  E-value=3.7e-05  Score=58.07  Aligned_cols=172  Identities=22%  Similarity=0.326  Sum_probs=118.4

Q ss_pred             CCCCCCCHHHHHHHHHHHHHHCC---CEEEECCCCC---------CCCC--CCCHHHHHHHCCCCCCEEEEECCCCCCCC
Q ss_conf             35677779999999999998669---5896116754---------3332--24857898744834401676415578876
Q gi|254780757|r    6 NKKNDLSFQNIILTLTQYWAQQG---CTILQPYDME---------VGAG--TFHPSTTLRALGPLSWKAAYVQPSRRPLD   71 (307)
Q Consensus         6 ~~~~~~~fq~ii~~L~~fW~~~G---C~i~qpyd~e---------~GAg--T~hp~T~lr~lg~~pw~~aYvqPsrRP~D   71 (307)
                      -...+|+.++|..+-.+|..++|   ..++.+|.+-         +.||  .|-|.-.-...-|..-+++-+|||.|-.|
T Consensus        52 ~~~~~~~~~eir~~Fl~FF~~kg~~~H~~i~~~pvv~r~d~~llft~Agm~~Fqp~~l~G~~~pp~~~l~~sQ~CiR~nD  131 (266)
T 2zze_A           52 GIPRXYTLDEMREXFLRFFEXHEIYPHGRVXRYPVLPRWRDDVLLVGASIMDFQPWVISGEADPPANPLVISQPSIRFTD  131 (266)
T ss_dssp             SSSSCCCHHHHHHHHHHHHHTCSSSCCEECCCCCSSCTTCSSCSSCCSGGGGGTTHHHHTSSCCSSSSEEEEEEEECCTT
T ss_pred             CCCCCCCHHHHHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCEECCC
T ss_conf             87775899999999999838688899727715782779999814770366336440047765799997246610000373


Q ss_pred             CCCCCCCCC-CCEEEEEEEEECCCCH----------HHHHHHHHHH-HHCCCCCCCCCEEEEECCCCCCHHHHCCCCEEE
Q ss_conf             554667750-0114444557579833----------5899999999-981999621717988328887001101232176
Q gi|254780757|r   72 GRYAENPNR-LQHYYQFQVIIKPNPL----------NLQNLYIESL-KAVGIDPLIHDVRFVEDNWESPTLGAWGLGWEC  139 (307)
Q Consensus        72 gRYGeNPNR-lq~y~QfQVilKPsp~----------niq~lYl~SL-~~iGid~~~hDIrFveDnWEsPtLGAwGlGWEv  139 (307)
                      =.   |--| -.|+.=|+.+=-=|-.          ...++-.+=| +.+||++.  .|.|.|+=|+-  -|-.|=--||
T Consensus       132 ld---nVG~t~RH~T~FEMlGn~SFgd~~~~~YfK~eaI~~a~eflt~~lgi~~~--~l~~~en~W~g--gGp~GPc~Ei  204 (266)
T 2zze_A          132 ID---NVGITGRHFTIFEMMAHHAFNYPGXPIYWMDETVELAFEFFTKELXMXPE--DITFKENPWAG--GGNAGPAFEV  204 (266)
T ss_dssp             GG---GTTTSSSCCSEEEEEEEEEEECTTCCCCCHHHHHHHHHHHHHHTSCCCGG--GEEEEECCEEE--TTEEECEEEE
T ss_pred             HH---HCCCCCCCHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCEEEECHH--HHCCCCCCCCC--CCCCCCCEEE
T ss_conf             76---45788864176741522513899701768998999999974112443576--60654675568--9898788668


Q ss_pred             EECCEEEHHHHHHHH----HCCCC----------CCC---CHHHHHHHHHHHHHHHCCCCCE
Q ss_conf             887874147778998----66825----------775---1456787899999998699821
Q gi|254780757|r  140 WCDGMEISQFTYFQQ----VCGIE----------CSP---ISGEITYGLERLAMYVQNVNSV  184 (307)
Q Consensus       140 wldGMEItQFTYFQQ----vGGi~----------c~p---v~~EiTYGLERiaMylQ~vdnv  184 (307)
                      -.||+||--.-++|-    -|+++          ..|   -.+.--|||||||+.+||+.+|
T Consensus       205 ~~d~lEiwNlVFmq~~~~~dGs~~~~~~~~~~~~l~~L~~k~VDTG~GlERl~~i~qg~~tv  266 (266)
T 2zze_A          205 LYRGLEVATLVFMQYXXAPENAPQDQVVVIXGEKYIPMETXVVDTGYGLERLVWMSQGTPTA  266 (266)
T ss_dssp             EETTEEEEEEEEEEEEECCTTCCSCCEEETTTEEEEEEEEEEEEEEEEHHHHHHHHHCCSSH
T ss_pred             EEECCCCHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCC
T ss_conf             98036510010100354888876644233453024568777668887899999998289972