HHsearch results for GI: 254780757 and protein with PDBid: 2zin_A

>2zin_A Pyrrolysyl-tRNA synthetase; aminoacyl-tRNA synthetase, pyrrolysine, ATP analogue, non-natural amino acid, unnatural amino acid, ATP-binding; HET: ANP LBY; 1.79A {Methanosarcina mazei} PDB: 2e3c_A* 2zcd_A* 2zce_A* 2zio_A* 2q7e_A* 2q7g_A* 2q7h_A* 2zim_A*
Probab=93.49  E-value=0.5  Score=27.04  Aligned_cols=159  Identities=16%  Similarity=0.193  Sum_probs=96.2

Q ss_pred             HHHHHHHHHHHHHHCCCEEEECCCCC-------CCCCCCCH-------------------HHHHH---H---CCCCCCEE
Q ss_conf             99999999999986695896116754-------33322485-------------------78987---4---48344016
Q gi|254780757|r   13 FQNIILTLTQYWAQQGCTILQPYDME-------VGAGTFHP-------------------STTLR---A---LGPLSWKA   60 (307)
Q Consensus        13 fq~ii~~L~~fW~~~GC~i~qpyd~e-------~GAgT~hp-------------------~T~lr---~---lg~~pw~~   60 (307)
                      .-.++..+.+|-.++|++-....-++       .|-+.-+|                   .+..+   .   -.+.|-++
T Consensus        80 ~~~i~~~ir~~f~~~Gf~EV~TP~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~lr~~~~~~~~~~~~~~~~~~~~p~r~  159 (291)
T 2zin_A           80 LGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPDPIKI  159 (291)
T ss_dssp             HHHHHHHHHHHHHHTTCEEECCCSEEETHHHHHTTCCTTSSGGGGCCEETTTEEECSCSHHHHHHHHHHHTTTSCSSEEE
T ss_pred             HHHHHHHHHHHHHHCCCEEEECCCEEEECCCCCCCCCCCCCCCCCEECCCCHHCCCCCCCCCHHHHHHHHHHHCCCCCEE
T ss_conf             99999999999998879999765223312201368887741212132578011266423451457778776521334024


Q ss_pred             EEECCCCCCCCCCCCCCCCCCCEEEEEEEEEC---CCCHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCCCHHHHCCCCE
Q ss_conf             76415578876554667750011444455757---983358999999999819996217179883288870011012321
Q gi|254780757|r   61 AYVQPSRRPLDGRYAENPNRLQHYYQFQVIIK---PNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTLGAWGLGW  137 (307)
Q Consensus        61 aYvqPsrRP~DgRYGeNPNRlq~y~QfQVilK---Psp~niq~lYl~SL~~iGid~~~hDIrFveDnWEsPtLGAwGlGW  137 (307)
                      .++.+|.|..+..    ..|+..++|.-+.+-   .+-.++..+.-+-|+.+|++..     .+++...-     .|-..
T Consensus       160 f~ig~vfR~e~~~----~~h~~eF~q~e~~~~~~~~~~~dl~~~~~~~l~~lg~~~~-----~~~~~~~~-----~~~~~  225 (291)
T 2zin_A          160 FEIGPCYRKESDG----KEHLEEFTMLNFCQMGSGCTRENLESIITDFLNHLGIDFK-----IVGDSCMV-----YGDTL  225 (291)
T ss_dssp             EEEEEEECCCSCS----SSCCSEEEEEEEEEESTTCCHHHHHHHHHHHHHHHTCCCE-----EECC----------CEEE
T ss_pred             EEECCEEEECCCC----CCCCCCEEEEEEEEECCCCCHHHHHHHHHHHHHHCCCCEE-----EECCCCCC-----CCCCC
T ss_conf             6641012203456----7888863899999989999799999999999998599278-----71366567-----67660


Q ss_pred             EEEECCEEEHHHHHH----HHHCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEE
Q ss_conf             768878741477789----98668257751456787899999998699821133
Q gi|254780757|r  138 ECWCDGMEISQFTYF----QQVCGIECSPISGEITYGLERLAMYVQNVNSVYDI  187 (307)
Q Consensus       138 EvwldGMEItQFTYF----QQvGGi~c~pv~~EiTYGLERiaMylQ~vdnvyDl  187 (307)
                      +++.+..||..+--+    -.--|++  +...-.-+|+||+||...+++|+-.+
T Consensus       226 ~~~~~~~ei~~~~~~~~~v~~~~gid--~p~~~~g~g~erla~~~~~~~dir~~  277 (291)
T 2zin_A          226 DVMHGDLELSSAVVGPIPLDREWGID--KPWIGAGFGLERLLKVKHDFKNIKRA  277 (291)
T ss_dssp             EEEETTEEEEEEEESCCGGGGGGTCC--SCEEEEEEEHHHHHHHHTTCSSGGGG
T ss_pred             CCCCCCEEEECCCEECHHHHHHCCCC--CCEEEECCCHHHHHHHHCCCCCHHHH
T ss_conf             21668757403860169999866999--98188675899999875299934555