HHsearch results for GI: 254780757 and protein with PDBid: 2zze_A

>2zze_A Alanyl-tRNA synthetase; ligase, hydrolase; HET: MLY; 2.16A {Pyrococcus horikoshii} PDB: 2zzf_A 2zzg_A*
Probab=98.56  E-value=1.4e-06  Score=67.36  Aligned_cols=177  Identities=21%  Similarity=0.342  Sum_probs=125.0

Q ss_pred             CCCCCCHHHHHHHHHHHHHHC---CCEEEECCCCC---------C--CCCCCCHHHHHHHCCCCCCEEEEECCCCCCCCC
Q ss_conf             567777999999999999866---95896116754---------3--332248578987448344016764155788765
Q gi|254780757|r    7 KKNDLSFQNIILTLTQYWAQQ---GCTILQPYDME---------V--GAGTFHPSTTLRALGPLSWKAAYVQPSRRPLDG   72 (307)
Q Consensus         7 ~~~~~~fq~ii~~L~~fW~~~---GC~i~qpyd~e---------~--GAgT~hp~T~lr~lg~~pw~~aYvqPsrRP~Dg   72 (307)
                      .+.+++..+|=.+--+|+.++   |..++.||.+-         +  |-..|-|.-|....-|..=+++-.|||-|-.|=
T Consensus        53 ~~~~~~~~eiR~~fl~fF~~~~~~gH~~i~~~pvvp~~~~~llft~Agm~~Fkp~v~~G~~~pp~~~l~~sQ~CiR~nDl  132 (752)
T 2zze_A           53 IPRXYTLDEMREXFLRFFEXHEIYPHGRVXRYPVLPRWRDDVLLVGASIMDFQPWVISGEADPPANPLVISQPSIRFTDI  132 (752)
T ss_dssp             SSSCCCHHHHHHHHHHHHHTCSSSCCEECCCCCSSCTTCSSCSSCCSGGGGGTTHHHHTSSCCSSSSEEEEEEEECCTTG
T ss_pred             CCCCCCHHHHHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCEEEECCCH
T ss_conf             77758999999999998386888997387147837799998246603664355721578768999972455200003747


Q ss_pred             CCCCCCCC-CCEEEEEEEEECCCC----------HHHHHHHHHHH-HHCCCCCCCCCEEEEECCCCCCHHHHCCCCEEEE
Q ss_conf             54667750-011444455757983----------35899999999-9819996217179883288870011012321768
Q gi|254780757|r   73 RYAENPNR-LQHYYQFQVIIKPNP----------LNLQNLYIESL-KAVGIDPLIHDVRFVEDNWESPTLGAWGLGWECW  140 (307)
Q Consensus        73 RYGeNPNR-lq~y~QfQVilKPsp----------~niq~lYl~SL-~~iGid~~~hDIrFveDnWEsPtLGAwGlGWEvw  140 (307)
                         +|--| -.||.=|.-+=-=|-          +...++-.+=| +.+||+|.  +|-|.|+-|+--  |--|=--||-
T Consensus       133 ---dnVG~t~rH~T~FEMlGn~sFg~~~~~~Y~k~e~i~~~~e~lt~~lgi~~~--~i~~~en~W~~G--G~~GPc~Ei~  205 (752)
T 2zze_A          133 ---DNVGITGRHFTIFEMMAHHAFNYPGXPIYWMDETVELAFEFFTKELXMXPE--DITFKENPWAGG--GNAGPAFEVL  205 (752)
T ss_dssp             ---GGTTTSSSCCSEEEEEEEEEEECTTCCCCCHHHHHHHHHHHHHHTSCCCGG--GEEEEECCEEET--TEEECEEEEE
T ss_pred             ---HHCCCCCCCHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHHCEEEECHH--HCCCCCCCCCCC--CCCCCCEEEE
T ss_conf             ---655788764055760412512899701769999999999975212342576--615545766589--8998875688


Q ss_pred             ECCEEEHHHHHHH--HH--CCC----------CCCCC---HHHHHHHHHHHHHHHCCCCCEEEEEEC
Q ss_conf             8787414777899--86--682----------57751---456787899999998699821133206
Q gi|254780757|r  141 CDGMEISQFTYFQ--QV--CGI----------ECSPI---SGEITYGLERLAMYVQNVNSVYDIVFN  190 (307)
Q Consensus       141 ldGMEItQFTYFQ--Qv--GGi----------~c~pv---~~EiTYGLERiaMylQ~vdnvyDl~wn  190 (307)
                      -+|+||--.-+.|  +.  |+.          ...|.   .+---|||||||+.+||+.++||..+.
T Consensus       206 ~~glEi~nlVFmq~~~~~~g~~~~~~~~~~~~~~~~Lp~k~VDTGmGLERl~~vlQg~~t~Ydtd~~  272 (752)
T 2zze_A          206 YRGLEVATLVFMQYXXAPENAPQDQVVVIXGEKYIPMETXVVDTGYGLERLVWMSQGTPTAYDAVLG  272 (752)
T ss_dssp             ETTEEEEEEEEEEEEECCTTCCSCCEEETTTEEEEEEEEEEEEEEEEHHHHHHHHHCCSSHHHHHSH
T ss_pred             ECCCCCCCHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCHHCCCH
T ss_conf             7144421000100255888875654233453014668878658887899999998289970221341