HHSEARCH alignment of GI: 254780757 and SCOP domain: d1riqa2

Alignment
>d1riqa2 d.104.1.1 (A:1-236) Alanyl-tRNA synthetase (AlaRS) {Aquifex aeolicus [TaxId: 63363]}
Probab=98.02  E-value=2.3e-06  Score=63.93  Aligned_cols=164  Identities=21%  Similarity=0.246  Sum_probs=110.2

Q ss_pred             CCCHHHHHHHHHHHHHHCCCEEEECCCCC---------CCCC--CCCHHHHHHHCCCCCCEEEEECCCCCCCC----C--
Q ss_conf             77799999999999986695896116754---------3332--24857898744834401676415578876----5--
Q gi|254780757|r   10 DLSFQNIILTLTQYWAQQGCTILQPYDME---------VGAG--TFHPSTTLRALGPLSWKAAYVQPSRRPLD----G--   72 (307)
Q Consensus        10 ~~~fq~ii~~L~~fW~~~GC~i~qpyd~e---------~GAg--T~hp~T~lr~lg~~pw~~aYvqPsrRP~D----g--   72 (307)
                      .|+-++|-.+--+|.+++|+.++.++.+=         +.||  -|-|. |+...-|..-+++-+|+|-|-.|    .  
T Consensus         1 ~mt~~eiR~~Fl~FF~~~gH~~v~s~slvp~~DptlLFtnAGM~~Fkp~-flG~~~p~~~r~~~~QkCiR~~gk~nDld~   79 (236)
T d1riqa2           1 SLSAHEIRELFLSFFEKKGHTRVKSAPLVPENDPTLLFVNAGMVPFKNV-FLGLEKRPYKRATSCQKCLRVSGKHNDLEQ   79 (236)
T ss_dssp             CCCHHHHHHHHHHHHHHTTCEECCCCCSSCTTCTTCSSCCSTTGGGHHH-HTTSSCCSCSEEEEEEEEECEETTEECTTT
T ss_pred             CCCHHHHHHHHHHHHHHCCCEECCCCCCCCCCCCCEEEECCCCHHHHHH-HCCCCCCCCCCCCCCCCCCCCCCCCCHHHH
T ss_conf             9988999999999998679988578773569999746541010222666-467645677764443214011674302231


Q ss_pred             -------------------------------------CCCCCCCCCCEEEEEEEEECCCCHHHHHHHHHHHHHCCCCCCC
Q ss_conf             -------------------------------------5466775001144445575798335899999999981999621
Q gi|254780757|r   73 -------------------------------------RYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLI  115 (307)
Q Consensus        73 -------------------------------------RYGeNPNRlq~y~QfQVilKPsp~niq~lYl~SL~~iGid~~~  115 (307)
                                                           .+|-.|+||.--     +-+.    -.+.+--=++.+||++. 
T Consensus        80 VG~t~rH~TfFEMLGn~SFgdYfK~eai~~awe~lt~~l~l~~~rl~vt-----v~~~----D~e~~~~w~~~~gi~~~-  149 (236)
T d1riqa2          80 VGYTSRHHTFFEMLGNFSFGDYFKKEAIEYAWEFVTEVLKLPKEKLYVS-----VYKD----DEEAYRIWNEHIGIPSE-  149 (236)
T ss_dssp             TTTSSSCCSEEEEEEEEESSSCCHHHHHHHHHHHHHHTSCCCGGGEEEE-----EETT----CHHHHHHHHTTTCCCGG-
T ss_pred             CCCCCCCHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCEEEE-----EECC----CHHHHHHHHHHCCCCCC-
T ss_conf             3876531105554352013860288899999999888851576424787-----5157----48998888760482004-


Q ss_pred             CCEEEE---ECCCCCCHHHHCCCCEEEEECC----------EEEHHHHHHH---HHCCC--CCCCCHHHHHHHHHHHHHH
Q ss_conf             717988---3288870011012321768878----------7414777899---86682--5775145678789999999
Q gi|254780757|r  116 HDVRFV---EDNWESPTLGAWGLGWECWCDG----------MEISQFTYFQ---QVCGI--ECSPISGEITYGLERLAMY  177 (307)
Q Consensus       116 hDIrFv---eDnWEsPtLGAwGlGWEvwldG----------MEItQFTYFQ---QvGGi--~c~pv~~EiTYGLERiaMy  177 (307)
                       .|-+.   |.=|+..--|.-|=-=|+--|+          +||--.-+.|   .-.|.  ++.--.+.--+|||||||.
T Consensus       150 -rI~~~~~~dNfW~~g~~GpcGPcsEi~yd~g~~~~~~~r~lEIwNlVFmqy~~~~~G~~~~L~~k~IDTGmGLERi~~v  228 (236)
T d1riqa2         150 -RIWRLGEEDNFWQMGDVGPCGPSSEIYVDRGEEYEGDERYLEIWNLVFMQYNRDENGVLTPLPHPNIDTGMGLERIASV  228 (236)
T ss_dssp             -GEEEECHHHHEEESSSSEEEEEEEEEEEECCTTSCHHHHEEEEEEEEEEEEEECTTSCEEEEEEEEEEEEEEHHHHHHH
T ss_pred             -CCEECCCCCCCCCCCCCCCCCCCEEEEECCCCCCCCCCCEEEEEEEEHEEEEECCCCCCCCCCCCCCCCCCCHHHHHHH
T ss_conf             -4153377777240689777776534787133333789765663110010001068986543889716589669999999


Q ss_pred             HCCCCCEE
Q ss_conf             86998211
Q gi|254780757|r  178 VQNVNSVY  185 (307)
Q Consensus       178 lQ~vdnvy  185 (307)
                      +|++.|+|
T Consensus       229 lqg~~s~y  236 (236)
T d1riqa2         229 LQGKNSNF  236 (236)
T ss_dssp             HTTCSSGG
T ss_pred             HCCCCCCC
T ss_conf             85999899


SCOP domain information

class: Alpha and beta proteins (a+b)
fold: Class II aaRS and biotin synthetases
superfamily: Class II aaRS and biotin synthetases
family: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain
domain: Alanyl-tRNA synthetase (AlaRS)
species: Aquifex aeolicus [TaxId: 63363]