BLAST/PSIBLAST alignment of GI: 254780757 and GI: 15964604 at iteration 1
>gi|15964604|ref|NP_384957.1| glycyl-tRNA synthetase subunit alpha [Sinorhizobium meliloti 1021] Length = 311
>gi|25009315|sp|Q92RL5|SYGA_RHIME RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName: Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS Length = 311
>gi|15073782|emb|CAC45423.1| Probable glycyl-tRNA synthetase alpha chain [Sinorhizobium meliloti 1021] Length = 311
 Score =  498 bits (1283), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 228/298 (76%), Positives = 262/298 (87%), Gaps = 3/298 (1%)

Query: 12  SFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPLD 71
           SFQ +ILTL  YWA +GC +LQPYDMEVGAGTFHP+TTLRALGP  W+AAYVQPSRRP D
Sbjct: 6   SFQALILTLHNYWADKGCAVLQPYDMEVGAGTFHPATTLRALGPKPWRAAYVQPSRRPTD 65

Query: 72  GRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTLG 131
           GRY ENPNRLQHYYQ+QVI+KPNP NLQ LY+ SL+A+G+DPL+HD+RFVED+WESPTLG
Sbjct: 66  GRYGENPNRLQHYYQYQVILKPNPSNLQELYLGSLEAIGLDPLLHDIRFVEDDWESPTLG 125

Query: 132 AWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFNA 191
           AWGLGWECWCDGME+SQFTYFQQVCGIECSP+SGE+TYGLERLAMYVQ V++VYD+ FN 
Sbjct: 126 AWGLGWECWCDGMEVSQFTYFQQVCGIECSPVSGELTYGLERLAMYVQGVDNVYDLNFNG 185

Query: 192 IEG-QNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNE--HHR 248
            EG + + YGD+F Q+EQEYSR+NFEYAN  +LH HFID+EKECL LL  G P +  ++R
Sbjct: 186 REGAEKISYGDVFLQAEQEYSRHNFEYANTAMLHQHFIDAEKECLALLAAGAPGDSSNNR 245

Query: 249 HHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNGG 306
            H CVFPAYDQCIKASH+FNLLDARGVIS TERQ YILR+R+LAKACGEAFL+T  GG
Sbjct: 246 LHKCVFPAYDQCIKASHVFNLLDARGVISVTERQSYILRVRTLAKACGEAFLLTEAGG 303