BLAST/PSIBLAST alignment of GI: 254780757 and GI: 86356527 at iteration 1
>gi|86356527|ref|YP_468419.1| glycyl-tRNA synthetase subunit alpha [Rhizobium etli CFN 42] Length = 318
>gi|86280629|gb|ABC89692.1| glycyl-tRNA synthetase, alpha subunit protein [Rhizobium etli CFN 42] Length = 318
 Score =  496 bits (1277), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 225/298 (75%), Positives = 261/298 (87%), Gaps = 3/298 (1%)

Query: 12  SFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPLD 71
           SFQ +ILTL  YWA +GC +LQPYDMEVGAGTFHP+TTLRALGP  WKAAYVQPSRRP D
Sbjct: 13  SFQALILTLHSYWADKGCAVLQPYDMEVGAGTFHPATTLRALGPKPWKAAYVQPSRRPSD 72

Query: 72  GRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTLG 131
           GRY ENPNRLQHYYQ+QVI+KPNP NLQ LY+ SL A+G+DPL+HD+RFVED+WESPTLG
Sbjct: 73  GRYGENPNRLQHYYQYQVILKPNPPNLQELYLGSLAAIGLDPLLHDIRFVEDDWESPTLG 132

Query: 132 AWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFNA 191
           AWGLGWECWCDGME+SQFTYFQQVCGIEC+P++GE+TYGLERLAMYVQ V++VYD+ FN 
Sbjct: 133 AWGLGWECWCDGMEVSQFTYFQQVCGIECAPVAGELTYGLERLAMYVQGVDNVYDLNFNG 192

Query: 192 IEG-QNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNE--HHR 248
            EG + + YGD+F Q+EQEYSR+NFE+AN E+LH HF+D+EKEC  LL  G P++  + R
Sbjct: 193 REGDEKISYGDVFLQAEQEYSRHNFEFANTEMLHRHFVDAEKECRSLLDAGAPDDSANQR 252

Query: 249 HHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNGG 306
            H CVFPAYDQCIKASH+FNLLDARGVIS TERQ YILR+R+LAKACGEAFL+T  GG
Sbjct: 253 LHKCVFPAYDQCIKASHVFNLLDARGVISVTERQSYILRVRTLAKACGEAFLLTDAGG 310