BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780757|ref|YP_003065170.1| glycyl-tRNA synthetase subunit
alpha [Candidatus Liberibacter asiaticus str. psy62]
         (307 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|312112892|ref|YP_004010488.1| glycyl-tRNA synthetase, subunit alpha [Rhodomicrobium vannielii
           ATCC 17100]
 gi|311218021|gb|ADP69389.1| glycyl-tRNA synthetase, alpha subunit [Rhodomicrobium vannielii
           ATCC 17100]
          Length = 312

 Score =  582 bits (1501), Expect = e-164,   Method: Composition-based stats.
 Identities = 213/305 (69%), Positives = 244/305 (80%), Gaps = 1/305 (0%)

Query: 3   PIHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAY 62
           P        SFQ++ILTL  YWA+QGC ILQPYDMEVGAGTFHP+TTLRALGP  W AA+
Sbjct: 6   PTTTLDPAHSFQDLILTLQHYWAEQGCVILQPYDMEVGAGTFHPATTLRALGPKPWSAAF 65

Query: 63  VQPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVE 122
           VQPSRRP DGRY ENPNRLQHYYQFQ I+KP+P N+Q LY+ESL  +GIDP +HD+RFVE
Sbjct: 66  VQPSRRPKDGRYGENPNRLQHYYQFQAILKPSPDNIQELYLESLVRLGIDPRVHDIRFVE 125

Query: 123 DNWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVN 182
           D+WESPTLGAWGLGWE WCDGME+SQFTYFQQV G +C P++GE+TYGLERLAMY+QNV+
Sbjct: 126 DDWESPTLGAWGLGWEVWCDGMEVSQFTYFQQVGGFDCDPVAGELTYGLERLAMYIQNVD 185

Query: 183 SVYDIVFNAIEGQN-VLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKG 241
           SVY + +N  +    VLYGD+F Q+EQEYSR+NFE+A+  IL   F D+EKEC  LL  G
Sbjct: 186 SVYKLNYNGRDDDKRVLYGDVFKQAEQEYSRHNFEFADTAILLQRFRDAEKECKALLAAG 245

Query: 242 IPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLM 301
            P E    HL V PAYDQCIKASHIFNLLDARGVIS TERQ YILR+R LAKAC  A+L 
Sbjct: 246 EPKEEGARHLQVLPAYDQCIKASHIFNLLDARGVISVTERQSYILRVRDLAKACCAAWLK 305

Query: 302 TPNGG 306
           T  GG
Sbjct: 306 TEAGG 310


>gi|328544960|ref|YP_004305069.1| glycyl-tRNA synthetase alpha subunit [polymorphum gilvum
           SL003B-26A1]
 gi|326414702|gb|ADZ71765.1| Glycyl-tRNA synthetase alpha subunit [Polymorphum gilvum
           SL003B-26A1]
          Length = 318

 Score =  577 bits (1489), Expect = e-163,   Method: Composition-based stats.
 Identities = 210/299 (70%), Positives = 248/299 (82%), Gaps = 4/299 (1%)

Query: 12  SFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPLD 71
           SFQ +ILTL ++WA QGC +LQPYDMEVGAGTFHP+TTLR+LGP  WKAAYVQPSRRP D
Sbjct: 15  SFQGLILTLQRFWADQGCVVLQPYDMEVGAGTFHPATTLRSLGPRPWKAAYVQPSRRPTD 74

Query: 72  GRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTLG 131
           GRY ENPNRLQHYYQFQVI+KP+P +LQ+LY+ SL A+G+DP +HD+RFVED+WESPTLG
Sbjct: 75  GRYGENPNRLQHYYQFQVILKPSPADLQDLYLRSLYAIGLDPAVHDIRFVEDDWESPTLG 134

Query: 132 AWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFNA 191
           AWGLGWECWCDGME+SQFTYFQQV G EC+P+SGE+TYGLERLAMY+Q V++VYD+ +N 
Sbjct: 135 AWGLGWECWCDGMEVSQFTYFQQVAGFECAPVSGELTYGLERLAMYIQGVDNVYDLNYNG 194

Query: 192 IEG-QNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKK---GIPNEHH 247
            EG + V YGD+F Q+EQEYSR+NFE+A+ ++L  HF D+E EC  LL+       ++  
Sbjct: 195 REGVEKVTYGDVFLQAEQEYSRHNFEHADTDMLFRHFKDAEDECRRLLEAGANARADKGA 254

Query: 248 RHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNGG 306
             H  V PAYDQCIKASH FNLLDARGVIS TERQ YILR+R LAKACG AFL T  GG
Sbjct: 255 AVHQLVLPAYDQCIKASHAFNLLDARGVISVTERQSYILRVRDLAKACGAAFLETEAGG 313


>gi|163761023|ref|ZP_02168101.1| glycyl-tRNA synthetase subunit alpha [Hoeflea phototrophica DFL-43]
 gi|162281804|gb|EDQ32097.1| glycyl-tRNA synthetase subunit alpha [Hoeflea phototrophica DFL-43]
          Length = 317

 Score =  577 bits (1489), Expect = e-163,   Method: Composition-based stats.
 Identities = 221/303 (72%), Positives = 255/303 (84%), Gaps = 1/303 (0%)

Query: 6   NKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQP 65
           + K   SFQ +IL L +YWA  GC +LQPYDMEVGAGTFHP+TTLRALGP  W AAYVQP
Sbjct: 8   HMKPTRSFQGLILALHRYWADYGCVVLQPYDMEVGAGTFHPATTLRALGPKPWNAAYVQP 67

Query: 66  SRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNW 125
           SRRP DGRY ENPNRLQHYYQ+QVI+KPNP NLQ LY+ SL A+GIDPL+HD+RFVED+W
Sbjct: 68  SRRPKDGRYGENPNRLQHYYQYQVILKPNPSNLQELYLGSLAAIGIDPLLHDIRFVEDDW 127

Query: 126 ESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVY 185
           ESPTLGAWGLGWECWCDGME+SQFTYFQQVCGIEC+P++GE+TYGLERLAMYVQ V++VY
Sbjct: 128 ESPTLGAWGLGWECWCDGMEVSQFTYFQQVCGIECAPVAGELTYGLERLAMYVQGVDNVY 187

Query: 186 DIVFNAIEG-QNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           D+ FN  EG + V YGD+F Q+EQEYSRYNFE A+  +L  HF D+EKEC  +LK G P+
Sbjct: 188 DLNFNGREGAEKVTYGDVFLQAEQEYSRYNFEIADTAVLLKHFEDAEKECEAILKSGAPS 247

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
           E    H CV PAYDQCIKASH+FNLLDARGVIS TERQ YILR+R+L++ CGEAFL+T  
Sbjct: 248 EPGSLHKCVLPAYDQCIKASHVFNLLDARGVISVTERQGYILRVRNLSRQCGEAFLLTDA 307

Query: 305 GGH 307
           GGH
Sbjct: 308 GGH 310


>gi|300024369|ref|YP_003756980.1| glycyl-tRNA synthetase subunit alpha [Hyphomicrobium denitrificans
           ATCC 51888]
 gi|299526190|gb|ADJ24659.1| glycyl-tRNA synthetase, alpha subunit [Hyphomicrobium denitrificans
           ATCC 51888]
          Length = 314

 Score =  577 bits (1489), Expect = e-163,   Method: Composition-based stats.
 Identities = 205/296 (69%), Positives = 239/296 (80%), Gaps = 5/296 (1%)

Query: 13  FQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPLDG 72
           FQ++ILTL  +W+ QGC ILQPYDMEVGAGTFHP+TTLRALGP  W AAYVQPSRRP DG
Sbjct: 22  FQDLILTLQTFWSNQGCAILQPYDMEVGAGTFHPATTLRALGPKPWAAAYVQPSRRPKDG 81

Query: 73  RYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTLGA 132
           RY ENPNRLQHYYQFQVI+KP+P N+Q LY+ SL A+GID  ++D+RFVED+WESPTLGA
Sbjct: 82  RYGENPNRLQHYYQFQVIMKPSPANIQELYLASLDAIGIDTALNDIRFVEDDWESPTLGA 141

Query: 133 WGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFNAI 192
           WGLGWE WC+GME+SQFTYFQQV G +C+P++ EITYGLERLAMYVQ V+ V+D+ FN  
Sbjct: 142 WGLGWEVWCNGMEVSQFTYFQQVGGFDCNPVASEITYGLERLAMYVQGVDRVFDLNFNGR 201

Query: 193 EGQ-NVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHHL 251
           +    + YGD+F Q+E+EYSRYNFE+A+ EIL  HF D+E EC  LL+K         HL
Sbjct: 202 DDDRRLTYGDVFLQAEREYSRYNFEHADTEILFRHFKDAEAECKALLEK---GATDGEHL 258

Query: 252 CVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNGGH 307
              PAYDQCIKASHIFNLLDARGVIS TERQ YILR+R LAKAC  A+L T  GGH
Sbjct: 259 LALPAYDQCIKASHIFNLLDARGVISVTERQSYILRVRDLAKACCAAWLKT-EGGH 313


>gi|118590809|ref|ZP_01548210.1| glycyl-tRNA synthetase subunit alpha [Stappia aggregata IAM 12614]
 gi|118436785|gb|EAV43425.1| glycyl-tRNA synthetase subunit alpha [Stappia aggregata IAM 12614]
          Length = 313

 Score =  575 bits (1483), Expect = e-162,   Method: Composition-based stats.
 Identities = 214/299 (71%), Positives = 246/299 (82%), Gaps = 4/299 (1%)

Query: 12  SFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPLD 71
           SFQ +ILTL +YWA QGC +LQPYDMEVGAGTFHP+TTLR+LGP  W+AAYVQPSRRP D
Sbjct: 6   SFQGLILTLQRYWADQGCVVLQPYDMEVGAGTFHPATTLRSLGPRPWRAAYVQPSRRPTD 65

Query: 72  GRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTLG 131
           GRY ENPNRLQHYYQFQVI+KP+P NLQ LY+ SL A+G+DP +HD+RFVED+WESPTLG
Sbjct: 66  GRYGENPNRLQHYYQFQVILKPSPANLQELYLNSLYAIGLDPKLHDIRFVEDDWESPTLG 125

Query: 132 AWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFNA 191
           AWGLGWECWCDGME+SQFTYFQQV G ECSP+SGE+TYGLERLAMY+Q V++VYD+ +N 
Sbjct: 126 AWGLGWECWCDGMEVSQFTYFQQVAGFECSPVSGELTYGLERLAMYIQGVDNVYDLNYNG 185

Query: 192 IEGQ-NVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRH- 249
           +EG   V YGD+F Q+EQEYSR+NFE+A+ E+L  HF D+E EC  LL+ G         
Sbjct: 186 MEGDAKVTYGDVFLQAEQEYSRHNFEHADTEMLFRHFKDAEAECRSLLEAGAKAREAAGA 245

Query: 250 --HLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNGG 306
             H  V PAYDQCIKASH FNLLDARGVIS TERQ YILR+R LAKACG AFL T  GG
Sbjct: 246 NVHQVVLPAYDQCIKASHAFNLLDARGVISVTERQSYILRVRELAKACGAAFLETEAGG 304


>gi|240139851|ref|YP_002964328.1| glycine tRNA synthetase, alpha subunit [Methylobacterium extorquens
           AM1]
 gi|240009825|gb|ACS41051.1| glycine tRNA synthetase, alpha subunit [Methylobacterium extorquens
           AM1]
          Length = 312

 Score =  575 bits (1482), Expect = e-162,   Method: Composition-based stats.
 Identities = 215/308 (69%), Positives = 246/308 (79%), Gaps = 1/308 (0%)

Query: 1   MAPIHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKA 60
           M    +     SFQ +ILTL ++WA +GC ILQPYDMEVGAGTFHP+TTLRALGP  WKA
Sbjct: 1   MPSDADLSPTRSFQGLILTLQRFWAAKGCVILQPYDMEVGAGTFHPATTLRALGPKPWKA 60

Query: 61  AYVQPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRF 120
           AYVQPSRRP DGRY ENPNRLQHYYQFQVI+KPNP NLQ LY+ SL+A+G+D  +HD+RF
Sbjct: 61  AYVQPSRRPKDGRYGENPNRLQHYYQFQVILKPNPPNLQELYLASLEAIGVDLKLHDIRF 120

Query: 121 VEDNWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQN 180
           VED+WESPTLGAWGLGWECWCDGME+SQFTYFQQV G EC+P++GE+TYGLERLAMYVQ 
Sbjct: 121 VEDDWESPTLGAWGLGWECWCDGMEVSQFTYFQQVAGFECAPVAGELTYGLERLAMYVQG 180

Query: 181 VNSVYDIVFNAIEG-QNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLK 239
           V +VYD+ FN  EG   V YGD+F Q+EQEYSR+NFE A+  +L  HF D+EK C   L+
Sbjct: 181 VENVYDLNFNGGEGDDKVTYGDVFLQAEQEYSRHNFEAADTAMLFRHFADAEKACRLYLE 240

Query: 240 KGIPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAF 299
            G P      H  V PAYDQCIKASH+FNLLDARGVIS TERQ YILR+R LAKACG A+
Sbjct: 241 AGAPESEGARHRIVQPAYDQCIKASHVFNLLDARGVISVTERQSYILRVRELAKACGAAW 300

Query: 300 LMTPNGGH 307
           L T  GGH
Sbjct: 301 LKTEAGGH 308


>gi|163852515|ref|YP_001640558.1| glycyl-tRNA synthetase subunit alpha [Methylobacterium extorquens
           PA1]
 gi|163664120|gb|ABY31487.1| glycyl-tRNA synthetase, alpha subunit [Methylobacterium extorquens
           PA1]
          Length = 312

 Score =  575 bits (1482), Expect = e-162,   Method: Composition-based stats.
 Identities = 215/308 (69%), Positives = 247/308 (80%), Gaps = 1/308 (0%)

Query: 1   MAPIHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKA 60
           M    +     SFQ +ILTL ++WA +GC ILQPYDMEVGAGTFHP+TTLRALGP  WKA
Sbjct: 1   MPSDADLSPTRSFQGLILTLQRFWAAKGCVILQPYDMEVGAGTFHPATTLRALGPKPWKA 60

Query: 61  AYVQPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRF 120
           AYVQPSRRP DGRY ENPNRLQHYYQFQVI+KPNP NLQ LY+ SL+A+G+D  +HD+RF
Sbjct: 61  AYVQPSRRPKDGRYGENPNRLQHYYQFQVILKPNPPNLQELYLASLEAIGVDLKLHDIRF 120

Query: 121 VEDNWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQN 180
           VED+WESPTLGAWGLGWECWCDGME+SQFTYFQQV G+EC+P++GE+TYGLERLAMYVQ 
Sbjct: 121 VEDDWESPTLGAWGLGWECWCDGMEVSQFTYFQQVAGLECAPVAGELTYGLERLAMYVQG 180

Query: 181 VNSVYDIVFNAIEG-QNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLK 239
           V +VYD+ FN  EG   V YGD+F Q+EQEYSR+NFE A+  +L  HF D+EK C   L+
Sbjct: 181 VENVYDLNFNGGEGDDKVTYGDVFLQAEQEYSRHNFEAADTAMLFRHFADAEKACRLYLE 240

Query: 240 KGIPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAF 299
            G P      H  V PAYDQCIKASH+FNLLDARGVIS TERQ YILR+R LAKACG A+
Sbjct: 241 AGAPESEGARHRIVQPAYDQCIKASHVFNLLDARGVISVTERQSYILRVRELAKACGAAW 300

Query: 300 LMTPNGGH 307
           L T  GGH
Sbjct: 301 LKTEAGGH 308


>gi|218531351|ref|YP_002422167.1| glycyl-tRNA synthetase subunit alpha [Methylobacterium
           chloromethanicum CM4]
 gi|218523654|gb|ACK84239.1| glycyl-tRNA synthetase, alpha subunit [Methylobacterium
           chloromethanicum CM4]
          Length = 312

 Score =  573 bits (1478), Expect = e-161,   Method: Composition-based stats.
 Identities = 216/308 (70%), Positives = 246/308 (79%), Gaps = 1/308 (0%)

Query: 1   MAPIHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKA 60
           M    +     SFQ +ILTL ++WA +GC ILQPYDMEVGAGTFHP+TTLRALGP  WKA
Sbjct: 1   MPSDADLSPTRSFQGLILTLQRFWAAKGCVILQPYDMEVGAGTFHPATTLRALGPRPWKA 60

Query: 61  AYVQPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRF 120
           AYVQPSRRP DGRY ENPNRLQHYYQFQVI+KPNP NLQ LY+ SL+A+G+D  +HD+RF
Sbjct: 61  AYVQPSRRPKDGRYGENPNRLQHYYQFQVILKPNPPNLQELYLASLEAIGVDLKLHDIRF 120

Query: 121 VEDNWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQN 180
           VED+WESPTLGAWGLGWECWCDGME+SQFTYFQQV G EC+P++GE+TYGLERLAMYVQ 
Sbjct: 121 VEDDWESPTLGAWGLGWECWCDGMEVSQFTYFQQVAGFECAPVAGELTYGLERLAMYVQG 180

Query: 181 VNSVYDIVFNAIEG-QNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLK 239
           V +VYD+ FN  EG   V YGD+F QSEQEYSR+NFE A+  +L  HF D+EK C   L+
Sbjct: 181 VENVYDLNFNGGEGEDKVTYGDVFLQSEQEYSRHNFEAADTAMLFRHFADAEKACRLYLE 240

Query: 240 KGIPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAF 299
            G P      H  V PAYDQCIKASH+FNLLDARGVIS TERQ YILR+R LAKACG A+
Sbjct: 241 AGAPESEGARHRIVQPAYDQCIKASHVFNLLDARGVISVTERQSYILRVRELAKACGAAW 300

Query: 300 LMTPNGGH 307
           L T  GGH
Sbjct: 301 LKTEAGGH 308


>gi|254501430|ref|ZP_05113581.1| glycyl-tRNA synthetase, alpha subunit [Labrenzia alexandrii DFL-11]
 gi|222437501|gb|EEE44180.1| glycyl-tRNA synthetase, alpha subunit [Labrenzia alexandrii DFL-11]
          Length = 313

 Score =  573 bits (1478), Expect = e-161,   Method: Composition-based stats.
 Identities = 214/299 (71%), Positives = 245/299 (81%), Gaps = 4/299 (1%)

Query: 12  SFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPLD 71
           SFQ +ILTL ++WA QGC +LQPYDMEVGAGTFHP+TTLR+LGP  WKAAYVQPSRRP D
Sbjct: 6   SFQGLILTLQRFWADQGCVVLQPYDMEVGAGTFHPATTLRSLGPRPWKAAYVQPSRRPTD 65

Query: 72  GRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTLG 131
           GRY ENPNRLQHYYQFQV++KP+P NLQ LY+ SL A+G+DP +HD+RFVED+WESPTLG
Sbjct: 66  GRYGENPNRLQHYYQFQVLLKPSPSNLQELYLNSLYAIGLDPKVHDIRFVEDDWESPTLG 125

Query: 132 AWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFNA 191
           AWGLGWECWCDGME+SQFTYFQQV G ECSP+SGE+TYGLERLAMY+Q V++VYD+ +N 
Sbjct: 126 AWGLGWECWCDGMEVSQFTYFQQVAGFECSPVSGELTYGLERLAMYIQGVDNVYDLNYNG 185

Query: 192 IEG-QNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLK---KGIPNEHH 247
           +EG   V YGD+F Q+EQEYSRYNFE+AN E L  HF D+E EC  +L    K   +   
Sbjct: 186 MEGADKVTYGDVFLQAEQEYSRYNFEHANTETLFQHFKDAEAECRAILDAGAKARDDNGL 245

Query: 248 RHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNGG 306
             H  V PAYDQCIKASH FNLLDARGVIS TERQ YILR+R LAKACG AFL T  GG
Sbjct: 246 SVHQVVLPAYDQCIKASHAFNLLDARGVISVTERQSYILRVRELAKACGAAFLETEAGG 304


>gi|188582533|ref|YP_001925978.1| glycyl-tRNA synthetase subunit alpha [Methylobacterium populi
           BJ001]
 gi|179346031|gb|ACB81443.1| glycyl-tRNA synthetase, alpha subunit [Methylobacterium populi
           BJ001]
          Length = 312

 Score =  573 bits (1477), Expect = e-161,   Method: Composition-based stats.
 Identities = 215/308 (69%), Positives = 245/308 (79%), Gaps = 1/308 (0%)

Query: 1   MAPIHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKA 60
           M    +     SFQ +ILTL ++WA +GC ILQPYDMEVGAGTFHP+TTLRALGP  WKA
Sbjct: 1   MPSDADLSPTRSFQGLILTLQRFWAAKGCVILQPYDMEVGAGTFHPATTLRALGPKPWKA 60

Query: 61  AYVQPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRF 120
           AYVQPSRRP DGRY ENPNRLQHYYQFQVI+KPNP NLQ LY+ SL A+G+D  +HD+RF
Sbjct: 61  AYVQPSRRPKDGRYGENPNRLQHYYQFQVILKPNPPNLQELYLASLDAIGVDLKLHDIRF 120

Query: 121 VEDNWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQN 180
           VED+WESPTLGAWGLGWECWCDGME+SQFTYFQQV G EC+P++GE+TYGLERLAMYVQ 
Sbjct: 121 VEDDWESPTLGAWGLGWECWCDGMEVSQFTYFQQVAGFECAPVAGELTYGLERLAMYVQG 180

Query: 181 VNSVYDIVFNAIEG-QNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLK 239
           V +VYD+ FN  EG   V YGD+F Q+EQEYSR+NFE A+  +L  HF D+EK C   L+
Sbjct: 181 VENVYDLNFNGGEGEDKVTYGDVFLQAEQEYSRHNFEAADTAMLFRHFADAEKACRLYLE 240

Query: 240 KGIPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAF 299
            G P      H  V PAYDQCIKASH+FNLLDARGVIS TERQ YILR+R LAKACG A+
Sbjct: 241 AGAPESEAARHRIVQPAYDQCIKASHVFNLLDARGVISVTERQSYILRVRELAKACGAAW 300

Query: 300 LMTPNGGH 307
           L T  GGH
Sbjct: 301 LKTEAGGH 308


>gi|254471747|ref|ZP_05085148.1| glycyl-tRNA synthetase, alpha subunit [Pseudovibrio sp. JE062]
 gi|211958949|gb|EEA94148.1| glycyl-tRNA synthetase, alpha subunit [Pseudovibrio sp. JE062]
          Length = 318

 Score =  573 bits (1477), Expect = e-161,   Method: Composition-based stats.
 Identities = 206/309 (66%), Positives = 244/309 (78%), Gaps = 4/309 (1%)

Query: 2   APIHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAA 61
           A   + +   SFQ +++TL ++WA QGC ILQPYDMEVGAGT HP+TTLR+LGP  WKAA
Sbjct: 5   AVPAHMQPTKSFQGLLMTLQRFWADQGCVILQPYDMEVGAGTSHPATTLRSLGPRPWKAA 64

Query: 62  YVQPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFV 121
           YVQPSRRP DGRY ENPNRLQHYYQFQV++KP+P NLQ LY+ SL+A+GID  IHDVRFV
Sbjct: 65  YVQPSRRPTDGRYGENPNRLQHYYQFQVLLKPSPENLQELYLASLRAIGIDTDIHDVRFV 124

Query: 122 EDNWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNV 181
           ED+WE+PTLGAWGLGWECWCDGME+SQFTYFQQV G EC P+SGE+TYGLER+AMYVQ V
Sbjct: 125 EDDWENPTLGAWGLGWECWCDGMEVSQFTYFQQVAGFECKPVSGELTYGLERIAMYVQGV 184

Query: 182 NSVYDIVFNAIEGQ-NVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKK 240
           ++VYD+ FN +EG   V YGD+F Q+EQEYSR+NFE+++ E+L  HF D E+EC  LL  
Sbjct: 185 DNVYDLNFNGLEGDEKVTYGDVFLQAEQEYSRHNFEHSDTEMLFRHFADHERECKRLLAA 244

Query: 241 G---IPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGE 297
               +          V PAYDQ +K SH+FNLLDARGVIS TERQ YILR+R L+KACG 
Sbjct: 245 SAEAMEKAGDGLQKVVLPAYDQALKCSHVFNLLDARGVISVTERQSYILRVRELSKACGA 304

Query: 298 AFLMTPNGG 306
           AFL T  GG
Sbjct: 305 AFLQTEAGG 313


>gi|254562268|ref|YP_003069363.1| glycine tRNA synthetase subunit alpha [Methylobacterium extorquens
           DM4]
 gi|254269546|emb|CAX25512.1| glycine tRNA synthetase, alpha subunit [Methylobacterium extorquens
           DM4]
          Length = 312

 Score =  572 bits (1476), Expect = e-161,   Method: Composition-based stats.
 Identities = 214/308 (69%), Positives = 245/308 (79%), Gaps = 1/308 (0%)

Query: 1   MAPIHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKA 60
           M    +     SFQ +ILTL ++WA +GC ILQPYDMEVGAGTFHP+TTLRALGP  WKA
Sbjct: 1   MPSDADLSPTRSFQGLILTLQRFWAAKGCVILQPYDMEVGAGTFHPATTLRALGPKPWKA 60

Query: 61  AYVQPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRF 120
           AYVQPSRRP DGRY ENPNRLQHYYQFQVI+KPNP NLQ LY+ SL+A+G+D  +HD+RF
Sbjct: 61  AYVQPSRRPKDGRYGENPNRLQHYYQFQVILKPNPPNLQELYLASLEAIGVDLKLHDIRF 120

Query: 121 VEDNWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQN 180
           VED+WESPTLGAWGLGWECWCDGME+SQFTYFQQV G EC+P++GE+TYGLERLAMYVQ 
Sbjct: 121 VEDDWESPTLGAWGLGWECWCDGMEVSQFTYFQQVAGFECAPVAGELTYGLERLAMYVQG 180

Query: 181 VNSVYDIVFNAIEG-QNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLK 239
           V +VYD+ FN  EG   V YGD+F Q+EQEYSR+NFE A+  +L  HF D+EK C   L+
Sbjct: 181 VENVYDLNFNGGEGDDKVTYGDVFLQAEQEYSRHNFEAADTAMLFRHFADAEKACRLYLE 240

Query: 240 KGIPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAF 299
            G        H  V PAYDQCIKASH+FNLLDARGVIS TERQ YILR+R LAKACG A+
Sbjct: 241 AGASESEGARHRIVQPAYDQCIKASHVFNLLDARGVISVTERQSYILRVRELAKACGAAW 300

Query: 300 LMTPNGGH 307
           L T  GGH
Sbjct: 301 LKTEAGGH 308


>gi|220936412|ref|YP_002515311.1| Glycine--tRNA ligase [Thioalkalivibrio sp. HL-EbGR7]
 gi|219997722|gb|ACL74324.1| Glycine--tRNA ligase [Thioalkalivibrio sp. HL-EbGR7]
          Length = 306

 Score =  572 bits (1475), Expect = e-161,   Method: Composition-based stats.
 Identities = 189/299 (63%), Positives = 226/299 (75%), Gaps = 10/299 (3%)

Query: 7   KKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPS 66
           K + LSFQ +ILTL QYWA++GC +LQPYDME+GAGTFH +T LRA+GP  W+AAYVQPS
Sbjct: 8   KHHGLSFQELILTLQQYWAERGCVVLQPYDMEMGAGTFHSATFLRAIGPEPWRAAYVQPS 67

Query: 67  RRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWE 126
           RRP DGRY ENPNRLQHYYQFQVI+KP+P  +Q LY+ SLKA+GIDPL+HD+RFVEDNWE
Sbjct: 68  RRPTDGRYGENPNRLQHYYQFQVILKPSPAEIQELYLGSLKAIGIDPLVHDIRFVEDNWE 127

Query: 127 SPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYD 186
           SPTLGAWGLGWE W +GME++QFTYFQQV G++C P+SGEITYGLERLAMY+Q V SVYD
Sbjct: 128 SPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLDCRPVSGEITYGLERLAMYLQGVESVYD 187

Query: 187 IVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEH 246
           + +       V YGD++ Q+E E S YNFE+AN E L   F   E E   L++ G+P   
Sbjct: 188 LTWTEGPQGRVSYGDVYHQNEVEQSAYNFEHANVEALFAWFETCEGESKRLIEAGLP--- 244

Query: 247 HRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNG 305
                   PAY+Q +KASH FNLLDAR  IS TERQ YILR+R LA+A  EA+      
Sbjct: 245 -------LPAYEQMLKASHTFNLLDARRAISVTERQGYILRVRELARAVAEAYYNAREA 296


>gi|222147717|ref|YP_002548674.1| glycyl-tRNA synthetase subunit alpha [Agrobacterium vitis S4]
 gi|221734705|gb|ACM35668.1| glycyl-tRNA synthetase alpha subunit [Agrobacterium vitis S4]
          Length = 323

 Score =  571 bits (1473), Expect = e-161,   Method: Composition-based stats.
 Identities = 229/308 (74%), Positives = 258/308 (83%), Gaps = 3/308 (0%)

Query: 2   APIHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAA 61
           A   +     SFQ +ILTL  YWA +GC +LQPYDMEVGAGTFHP+TTLRALGP  WKAA
Sbjct: 9   ASAPHMDPKRSFQALILTLHNYWADKGCAVLQPYDMEVGAGTFHPATTLRALGPKPWKAA 68

Query: 62  YVQPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFV 121
           YVQPSRRP DGRY ENPNRLQHYYQ+QVI+KPNP NLQ LY+ SLKA+G+DPL+HDVRFV
Sbjct: 69  YVQPSRRPSDGRYGENPNRLQHYYQYQVILKPNPSNLQELYLGSLKAIGLDPLLHDVRFV 128

Query: 122 EDNWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNV 181
           ED+WESPTLGAWGLGWECWCDGME+SQFTYFQQVCGIECSP++GE+TYGLERLAMYVQ V
Sbjct: 129 EDDWESPTLGAWGLGWECWCDGMEVSQFTYFQQVCGIECSPVAGELTYGLERLAMYVQGV 188

Query: 182 NSVYDIVFNAIEG-QNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKK 240
           ++VYD+ FN  EG + + YGD+F Q+EQEYSR+NFEYAN E+L  HF D+EKEC  LL  
Sbjct: 189 DNVYDLNFNGREGEEKISYGDVFLQAEQEYSRHNFEYANTEMLLRHFTDAEKECQALLDA 248

Query: 241 GIPNEHHRH--HLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEA 298
           G P E      H CVFPAYDQCIKASH+FNLLDARGVIS TERQ YILR+R+LAKACGEA
Sbjct: 249 GAPGESANQVLHKCVFPAYDQCIKASHVFNLLDARGVISVTERQSYILRVRTLAKACGEA 308

Query: 299 FLMTPNGG 306
           FL T  GG
Sbjct: 309 FLQTDAGG 316


>gi|120552982|ref|YP_957333.1| glycyl-tRNA synthetase subunit alpha [Marinobacter aquaeolei VT8]
 gi|120322831|gb|ABM17146.1| glycyl-tRNA synthetase alpha chain [Marinobacter aquaeolei VT8]
          Length = 364

 Score =  571 bits (1472), Expect = e-161,   Method: Composition-based stats.
 Identities = 179/302 (59%), Positives = 231/302 (76%), Gaps = 10/302 (3%)

Query: 2   APIHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAA 61
           A  ++  +  +FQ +IL L  +WAQ GC +LQP DMEVGAGTFHP+T LR++GP +W +A
Sbjct: 29  ATNNSAPDIKTFQGLILALQNFWAQHGCVVLQPLDMEVGAGTFHPATFLRSIGPETWNSA 88

Query: 62  YVQPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFV 121
           YVQPSRRP DGRY ENPNRLQHYYQFQV++KP+P N+Q LY++SL+A+G+DPL+HD+RFV
Sbjct: 89  YVQPSRRPTDGRYGENPNRLQHYYQFQVVLKPSPDNIQELYLDSLRALGLDPLVHDIRFV 148

Query: 122 EDNWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNV 181
           EDNWESPTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GE+TYGLER+AMY+Q V
Sbjct: 149 EDNWESPTLGAWGLGWEIWLNGMEVTQFTYFQQVGGLECYPVTGELTYGLERIAMYLQGV 208

Query: 182 NSVYDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKG 241
           +SVYD+V+       V YGD+F Q E E S YNFE+A+ E L + F   E+E   L+  G
Sbjct: 209 DSVYDLVWTNGPDGVVTYGDVFHQQEVEMSTYNFEHADTEFLFHSFDVYERESARLIDAG 268

Query: 242 IPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLM 301
           +P           PAY+Q +KASH FNLLDAR  IS TERQR+ILR+R+LA++  +A+  
Sbjct: 269 LP----------LPAYEQVLKASHTFNLLDARHAISVTERQRFILRVRTLARSVAQAYFE 318

Query: 302 TP 303
           + 
Sbjct: 319 SR 320


>gi|307941590|ref|ZP_07656945.1| glycyl-tRNA synthetase, alpha subunit [Roseibium sp. TrichSKD4]
 gi|307775198|gb|EFO34404.1| glycyl-tRNA synthetase, alpha subunit [Roseibium sp. TrichSKD4]
          Length = 312

 Score =  571 bits (1472), Expect = e-161,   Method: Composition-based stats.
 Identities = 212/299 (70%), Positives = 247/299 (82%), Gaps = 4/299 (1%)

Query: 12  SFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPLD 71
           SFQ +ILTL ++WA QGC +LQPYDMEVGAGTFHP+TTLR+LGP  WKAAYVQPSRRP D
Sbjct: 6   SFQGLILTLQRFWADQGCVVLQPYDMEVGAGTFHPATTLRSLGPRPWKAAYVQPSRRPTD 65

Query: 72  GRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTLG 131
           GRY ENPNRLQHYYQFQ I+KP+P NLQ LY+ SLKA+G+D  +HDVRFVED+WESPTLG
Sbjct: 66  GRYGENPNRLQHYYQFQAILKPSPPNLQELYLNSLKAIGLDTELHDVRFVEDDWESPTLG 125

Query: 132 AWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFNA 191
           AWGLGWECWCDGME+SQFTYFQQV G ECSP+SGE+TYGLERLAMY+Q V+ VY++ +N 
Sbjct: 126 AWGLGWECWCDGMEVSQFTYFQQVAGFECSPVSGELTYGLERLAMYIQGVDDVYELNYNG 185

Query: 192 IEG-QNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLK---KGIPNEHH 247
           +EG   V YGD+F Q+EQEYSR+NFE+A+ ++L  HF D+E EC  LL+   K    +  
Sbjct: 186 MEGDDKVTYGDVFLQAEQEYSRHNFEHADTDMLFRHFKDAEGECRSLLEAGAKQREEKGA 245

Query: 248 RHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNGG 306
           + H  V PAYDQCIKASH+FNLLDARGVIS TERQ YILR+R LAKACG AFL T  GG
Sbjct: 246 KVHQVVLPAYDQCIKASHVFNLLDARGVISVTERQSYILRVRELAKACGAAFLETEAGG 304


>gi|311696631|gb|ADP99504.1| glycyl-tRNA synthetase alpha subunit [marine bacterium HP15]
          Length = 366

 Score =  570 bits (1471), Expect = e-161,   Method: Composition-based stats.
 Identities = 181/302 (59%), Positives = 229/302 (75%), Gaps = 10/302 (3%)

Query: 2   APIHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAA 61
           A      +  +FQ +IL L  +WAQ GC +LQP DMEVGAGTFHP+T LRA+GP +W AA
Sbjct: 30  ATKQTTPDIGTFQGLILALQNFWAQHGCVVLQPLDMEVGAGTFHPATFLRAIGPETWNAA 89

Query: 62  YVQPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFV 121
           YVQPSRRP DGRY ENPNRLQHYYQFQV++KP+P N+Q LY++SL+A+G+DPL+HD+RFV
Sbjct: 90  YVQPSRRPTDGRYGENPNRLQHYYQFQVVLKPSPDNIQELYLDSLRALGLDPLVHDIRFV 149

Query: 122 EDNWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNV 181
           EDNWESPTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GE+TYGLER+AMY+Q V
Sbjct: 150 EDNWESPTLGAWGLGWEIWLNGMEVTQFTYFQQVGGLECFPVTGELTYGLERIAMYLQGV 209

Query: 182 NSVYDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKG 241
           +SVYD+V+       V YGD+F Q E E S YNFE+A+ E L + F   E+E   L++ G
Sbjct: 210 DSVYDLVWTEGPDGVVTYGDVFHQQEVEMSTYNFEHADTEFLFHSFDVHERESARLIEAG 269

Query: 242 IPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLM 301
           +            PAY+Q +KASH FNLLDAR  IS TERQR+ILR+R+LA+A  +A+  
Sbjct: 270 L----------ALPAYEQVLKASHTFNLLDARHAISVTERQRFILRVRTLARAVAQAYFD 319

Query: 302 TP 303
           + 
Sbjct: 320 SR 321


>gi|13476181|ref|NP_107751.1| glycyl-tRNA synthetase subunit alpha [Mesorhizobium loti
           MAFF303099]
 gi|25009317|sp|Q986B6|SYGA_RHILO RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|14026941|dbj|BAB53537.1| glycyl-tRNA synthetase, alpha chain [Mesorhizobium loti MAFF303099]
          Length = 314

 Score =  570 bits (1471), Expect = e-161,   Method: Composition-based stats.
 Identities = 222/304 (73%), Positives = 252/304 (82%), Gaps = 3/304 (0%)

Query: 6   NKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQP 65
           +     SFQ +ILTL  YWA  GC ILQPYDMEVGAGTFHP+TTLRALGP  W AAYVQP
Sbjct: 8   HMHPSRSFQGLILTLHNYWAAYGCVILQPYDMEVGAGTFHPATTLRALGPKRWNAAYVQP 67

Query: 66  SRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNW 125
           SRRP DGRY ENPNRLQHYYQ+QVI+KPNP NLQ LY+ SL A+G+DPL+HD+RFVED+W
Sbjct: 68  SRRPKDGRYGENPNRLQHYYQYQVILKPNPPNLQELYLGSLAAIGVDPLLHDIRFVEDDW 127

Query: 126 ESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVY 185
           ESPTLGAWGLGWECWCDGME+SQFTYFQQVCGIEC+P++GE+TYGLERLAMYVQ V++VY
Sbjct: 128 ESPTLGAWGLGWECWCDGMEVSQFTYFQQVCGIECAPVAGELTYGLERLAMYVQGVDNVY 187

Query: 186 DIVFNAIEG-QNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIP- 243
           D+ FN  EG   V YGD+F Q+EQEYSR+NFEYA+  +L  HF D+E EC  LL  G P 
Sbjct: 188 DLNFNGREGADKVTYGDVFLQAEQEYSRHNFEYADTAMLLRHFEDAEAECKALLDAGAPA 247

Query: 244 -NEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMT 302
            N++   H  VFPAYDQCIKASH+FNLLDARGVIS TERQ YILR+R+LAKACGEAFL T
Sbjct: 248 SNDNLPMHKMVFPAYDQCIKASHVFNLLDARGVISVTERQSYILRVRNLAKACGEAFLKT 307

Query: 303 PNGG 306
             GG
Sbjct: 308 QAGG 311


>gi|149375622|ref|ZP_01893391.1| Glycyl-tRNA synthetase, alpha subunit [Marinobacter algicola DG893]
 gi|149360024|gb|EDM48479.1| Glycyl-tRNA synthetase, alpha subunit [Marinobacter algicola DG893]
          Length = 355

 Score =  570 bits (1471), Expect = e-161,   Method: Composition-based stats.
 Identities = 182/302 (60%), Positives = 230/302 (76%), Gaps = 10/302 (3%)

Query: 2   APIHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAA 61
           A   N  +  +FQ +IL L  +WAQ GC +LQP DMEVGAGTFHP+T LR++GP +W AA
Sbjct: 19  ATSANTPDIKTFQGLILALQNFWAQHGCVVLQPLDMEVGAGTFHPATFLRSIGPETWNAA 78

Query: 62  YVQPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFV 121
           YVQPSRRP DGRY ENPNRLQHYYQFQV++KP+P N+Q LY++SLKA+G+DPL+HD+RFV
Sbjct: 79  YVQPSRRPTDGRYGENPNRLQHYYQFQVVLKPSPDNIQELYLDSLKALGLDPLVHDIRFV 138

Query: 122 EDNWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNV 181
           EDNWESPTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GE+TYGLER+AMY+Q V
Sbjct: 139 EDNWESPTLGAWGLGWEIWLNGMEVTQFTYFQQVGGLECYPVTGELTYGLERIAMYLQGV 198

Query: 182 NSVYDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKG 241
           +SVYD+V+       V YGD+F Q E E S YNFE+A+ E L + F   E+E   L++ G
Sbjct: 199 DSVYDLVWTEGPDGVVTYGDVFHQQEVEMSTYNFEHADTEFLFHSFDVHERESARLIEAG 258

Query: 242 IPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLM 301
           +            PAY+Q +KASH FNLLDAR  IS TERQR+ILR+R+LA+A  +A+  
Sbjct: 259 L----------ALPAYEQVLKASHTFNLLDARHAISVTERQRFILRVRTLARAVAQAYFD 308

Query: 302 TP 303
           + 
Sbjct: 309 SR 310


>gi|319784745|ref|YP_004144221.1| glycyl-tRNA synthetase subunit alpha [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317170633|gb|ADV14171.1| glycyl-tRNA synthetase, alpha subunit [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 314

 Score =  570 bits (1470), Expect = e-161,   Method: Composition-based stats.
 Identities = 222/304 (73%), Positives = 252/304 (82%), Gaps = 3/304 (0%)

Query: 6   NKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQP 65
           +     SFQ +ILTL  YWA  GC ILQPYDMEVGAGTFHP+TTLRALGP  W AAYVQP
Sbjct: 8   HMHPSRSFQGLILTLHNYWAAYGCVILQPYDMEVGAGTFHPATTLRALGPKRWNAAYVQP 67

Query: 66  SRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNW 125
           SRRP DGRY ENPNRLQHYYQ+QVI+KPNP NLQ LY+ SL A+G+DPL+HD+RFVED+W
Sbjct: 68  SRRPKDGRYGENPNRLQHYYQYQVILKPNPPNLQELYLGSLAAIGVDPLLHDIRFVEDDW 127

Query: 126 ESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVY 185
           ESPTLGAWGLGWECWCDGME+SQFTYFQQVCGIEC+P++GE+TYGLERLAMYVQ V++VY
Sbjct: 128 ESPTLGAWGLGWECWCDGMEVSQFTYFQQVCGIECAPVAGELTYGLERLAMYVQGVDNVY 187

Query: 186 DIVFNAIEG-QNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIP- 243
           D+ FN  EG   V YGD+F Q+EQEYSR+NFE+AN  +L  HF D+E EC  LL  G P 
Sbjct: 188 DLNFNGREGADKVTYGDVFLQAEQEYSRHNFEHANTAMLLRHFEDAETECKALLDAGAPA 247

Query: 244 -NEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMT 302
            N++   H  VFPAYDQCIKASH+FNLLDARGVIS TERQ YILR+R+LAKACGEAFL T
Sbjct: 248 SNDNLPMHRMVFPAYDQCIKASHVFNLLDARGVISVTERQSYILRVRNLAKACGEAFLKT 307

Query: 303 PNGG 306
             GG
Sbjct: 308 QAGG 311


>gi|254780757|ref|YP_003065170.1| glycyl-tRNA synthetase subunit alpha [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040434|gb|ACT57230.1| glycyl-tRNA synthetase subunit alpha [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 307

 Score =  570 bits (1470), Expect = e-160,   Method: Composition-based stats.
 Identities = 307/307 (100%), Positives = 307/307 (100%)

Query: 1   MAPIHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKA 60
           MAPIHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKA
Sbjct: 1   MAPIHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKA 60

Query: 61  AYVQPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRF 120
           AYVQPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRF
Sbjct: 61  AYVQPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRF 120

Query: 121 VEDNWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQN 180
           VEDNWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQN
Sbjct: 121 VEDNWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQN 180

Query: 181 VNSVYDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKK 240
           VNSVYDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKK
Sbjct: 181 VNSVYDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKK 240

Query: 241 GIPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFL 300
           GIPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFL
Sbjct: 241 GIPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFL 300

Query: 301 MTPNGGH 307
           MTPNGGH
Sbjct: 301 MTPNGGH 307


>gi|292490370|ref|YP_003525809.1| glycyl-tRNA synthetase subunit alpha [Nitrosococcus halophilus Nc4]
 gi|291578965|gb|ADE13422.1| glycyl-tRNA synthetase, alpha subunit [Nitrosococcus halophilus
           Nc4]
          Length = 314

 Score =  570 bits (1469), Expect = e-160,   Method: Composition-based stats.
 Identities = 183/296 (61%), Positives = 224/296 (75%), Gaps = 10/296 (3%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
             +FQ +IL L QYWA+QGC +LQPYDMEVGAGTFHP T LRA+GP  W AAYVQPSRRP
Sbjct: 13  PATFQELILRLQQYWAEQGCVLLQPYDMEVGAGTFHPGTFLRAIGPEPWSAAYVQPSRRP 72

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY +NPNRLQHYYQ+QV++KP+PL +Q+LY+ SL+ +GI PL+HD+RFVEDNWESPT
Sbjct: 73  TDGRYGDNPNRLQHYYQYQVVLKPSPLEIQDLYLGSLQMLGISPLVHDIRFVEDNWESPT 132

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GMEI+QFTYFQQV G+EC P++GEITYGLER+AMY+Q V+SVYD+++
Sbjct: 133 LGAWGLGWEVWLNGMEITQFTYFQQVGGLECRPVTGEITYGLERIAMYLQGVSSVYDLIW 192

Query: 190 NAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRH 249
                  + YGD+F Q+E E S YNFE A+ E L   F   E E   L++ G+P      
Sbjct: 193 TDGPLGRITYGDVFHQNEVEMSTYNFEQADTESLFAWFNSCEAESKRLIEAGLP------ 246

Query: 250 HLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNG 305
                PAY+  +KASH FNLLDAR  IS TERQRYILR+R+LA+A  EA+L     
Sbjct: 247 ----LPAYEMVLKASHTFNLLDARRAISVTERQRYILRVRALARAVAEAYLARREA 298


>gi|260460349|ref|ZP_05808601.1| glycyl-tRNA synthetase, alpha subunit [Mesorhizobium opportunistum
           WSM2075]
 gi|259033994|gb|EEW35253.1| glycyl-tRNA synthetase, alpha subunit [Mesorhizobium opportunistum
           WSM2075]
          Length = 314

 Score =  570 bits (1469), Expect = e-160,   Method: Composition-based stats.
 Identities = 223/304 (73%), Positives = 253/304 (83%), Gaps = 3/304 (0%)

Query: 6   NKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQP 65
           +     SFQ +ILTL  YWA  GC ILQPYDMEVGAGTFHP+TTLRALGP  W AAYVQP
Sbjct: 8   HMHPSRSFQGLILTLHNYWAAYGCVILQPYDMEVGAGTFHPATTLRALGPRGWNAAYVQP 67

Query: 66  SRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNW 125
           SRRP DGRY ENPNRLQHYYQ+QVI+KPNP NLQ LY+ SL A+G+DPL+HD+RFVED+W
Sbjct: 68  SRRPKDGRYGENPNRLQHYYQYQVILKPNPPNLQELYLGSLAAIGVDPLLHDIRFVEDDW 127

Query: 126 ESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVY 185
           ESPTLGAWGLGWECWCDGME+SQFTYFQQVCGIEC+P++GE+TYGLERLAMYVQ V+++Y
Sbjct: 128 ESPTLGAWGLGWECWCDGMEVSQFTYFQQVCGIECAPVAGELTYGLERLAMYVQGVDNIY 187

Query: 186 DIVFNAIEG-QNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIP- 243
           D+ FN  EG + V YGD+F Q+EQEYSRYNFEYAN  +L  HF D+E EC  LL  G P 
Sbjct: 188 DLNFNGREGAEKVTYGDVFLQAEQEYSRYNFEYANTAMLLRHFEDAEAECKALLDAGAPA 247

Query: 244 -NEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMT 302
            N++   H  VFPAYDQCIKASH+FNLLDARGVIS TERQ YILR+R+LAKACGEAFL T
Sbjct: 248 SNDNLPMHRMVFPAYDQCIKASHVFNLLDARGVISVTERQSYILRVRNLAKACGEAFLKT 307

Query: 303 PNGG 306
             GG
Sbjct: 308 RAGG 311


>gi|83642935|ref|YP_431370.1| glycyl-tRNA synthetase subunit alpha [Hahella chejuensis KCTC 2396]
 gi|83630978|gb|ABC26945.1| Glycyl-tRNA synthetase, alpha subunit [Hahella chejuensis KCTC
           2396]
          Length = 315

 Score =  569 bits (1468), Expect = e-160,   Method: Composition-based stats.
 Identities = 184/299 (61%), Positives = 226/299 (75%), Gaps = 10/299 (3%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
            NK +  +FQ +I TL  YWA+QGC ILQP DMEVGAGTFHP+T LRA+GP +W AAYVQ
Sbjct: 4   TNKPDVKTFQGLIRTLQDYWARQGCVILQPLDMEVGAGTFHPATFLRAIGPETWNAAYVQ 63

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQ+QV++KP+P N+Q LY+ SL+ +GIDPL+HD+RFVEDN
Sbjct: 64  PSRRPTDGRYGENPNRLQHYYQYQVVLKPSPDNIQELYLGSLREMGIDPLVHDIRFVEDN 123

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WESPTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLER+AMY+Q V+SV
Sbjct: 124 WESPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECYPVTGEITYGLERIAMYLQGVDSV 183

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+++       V YGD+F Q+E E S YNFE A+   L  HF   E+E   L++KG+P 
Sbjct: 184 YDLIWTHGPQGPVTYGDVFHQNEVEMSTYNFEEADTTELFRHFDTYERESKRLIEKGLP- 242

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTP 303
                     PAY+  +KASH FNLLDAR  IS TERQR+ILR+R LAK   +A+    
Sbjct: 243 ---------LPAYEMVLKASHTFNLLDARHAISVTERQRFILRVRGLAKDVAQAYFDRR 292


>gi|146339075|ref|YP_001204123.1| glycyl-tRNA synthetase subunit alpha [Bradyrhizobium sp. ORS278]
 gi|146191881|emb|CAL75886.1| glycine tRNA synthetase, alpha subunit [Bradyrhizobium sp. ORS278]
          Length = 313

 Score =  569 bits (1468), Expect = e-160,   Method: Composition-based stats.
 Identities = 207/311 (66%), Positives = 245/311 (78%), Gaps = 5/311 (1%)

Query: 1   MAPIHNKKNDL----SFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPL 56
           M  + +    +    SFQ  IL L ++WA+QGC ILQPYDME+GAGTFHP+TTLRALGP 
Sbjct: 1   MPTMDSLPPHMRPERSFQGFILALQRFWAEQGCVILQPYDMEMGAGTFHPATTLRALGPK 60

Query: 57  SWKAAYVQPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIH 116
            W AAYVQPSRRP DGRY ENPNR+QHYYQFQVI+KP+P NLQ LY++SL A+GID  +H
Sbjct: 61  PWNAAYVQPSRRPKDGRYGENPNRMQHYYQFQVIMKPSPPNLQELYLKSLGAIGIDAAVH 120

Query: 117 DVRFVEDNWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAM 176
           D+RFVED+WESPTLGAWGLGWECWCDGME+SQFTYFQQV G EC+P++GE+TYGLERLAM
Sbjct: 121 DIRFVEDDWESPTLGAWGLGWECWCDGMEVSQFTYFQQVAGFECAPVAGELTYGLERLAM 180

Query: 177 YVQNVNSVYDIVFNAIEGQ-NVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECL 235
           YVQ V+ VYD+ FN  +G   V YGD+F Q+EQEYSR+NFE+A+  +L   F  +E  C 
Sbjct: 181 YVQGVDRVYDLNFNGRDGDAKVTYGDVFLQAEQEYSRHNFEHADTAVLFEQFKMAESACR 240

Query: 236 DLLKKGIPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKAC 295
             L  G  + + + HL   PAYDQCIKASH+FNLLDARGVIS TERQ YILR+R LAKAC
Sbjct: 241 KYLDAGWRDGNRKEHLMALPAYDQCIKASHVFNLLDARGVISVTERQSYILRVRELAKAC 300

Query: 296 GEAFLMTPNGG 306
           GEA+L T  GG
Sbjct: 301 GEAWLHTEAGG 311


>gi|304393463|ref|ZP_07375391.1| glycyl-tRNA synthetase, alpha subunit [Ahrensia sp. R2A130]
 gi|303294470|gb|EFL88842.1| glycyl-tRNA synthetase, alpha subunit [Ahrensia sp. R2A130]
          Length = 329

 Score =  569 bits (1468), Expect = e-160,   Method: Composition-based stats.
 Identities = 211/306 (68%), Positives = 248/306 (81%), Gaps = 2/306 (0%)

Query: 3   PIHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAY 62
            +       SFQ +ILTL  YWA+ GC ILQP+DMEVGAGTFHP+TTLRALGP  WKAAY
Sbjct: 13  TMSTHDPKTSFQGLILTLHDYWAKHGCVILQPFDMEVGAGTFHPATTLRALGPKPWKAAY 72

Query: 63  VQPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVE 122
           VQPSRRP DGRY ENPNRLQHYYQ+QV++KP+P NLQ LY+ SL A+GIDPL+HD+RFVE
Sbjct: 73  VQPSRRPTDGRYGENPNRLQHYYQYQVLLKPSPPNLQELYLGSLAAIGIDPLLHDIRFVE 132

Query: 123 DNWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVN 182
           D+WESPTLGAWGLGWE WCDGME+SQFTYFQQ+CG ECSP++GE+TYGLERLAMYVQNV+
Sbjct: 133 DDWESPTLGAWGLGWEVWCDGMEVSQFTYFQQICGQECSPVAGELTYGLERLAMYVQNVD 192

Query: 183 SVYDIVFNAIEG-QNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKK- 240
            VYD+ FN  EG + V YG+IF Q+E+EYSR+NF+ A+ E L  HF D+EKEC ++L   
Sbjct: 193 DVYDLNFNGGEGEERVSYGEIFQQTEREYSRWNFDVADTETLLRHFEDAEKECRNILAAD 252

Query: 241 GIPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFL 300
            +  +  R  +   PAYDQCIKASH+FNLLDARGVIS TERQ YI R+R L+KACGEAFL
Sbjct: 253 PVDPKKGRAIVMAHPAYDQCIKASHVFNLLDARGVISVTERQNYIGRVRDLSKACGEAFL 312

Query: 301 MTPNGG 306
            T  GG
Sbjct: 313 ATEAGG 318


>gi|299134687|ref|ZP_07027879.1| glycyl-tRNA synthetase, alpha subunit [Afipia sp. 1NLS2]
 gi|298590497|gb|EFI50700.1| glycyl-tRNA synthetase, alpha subunit [Afipia sp. 1NLS2]
          Length = 309

 Score =  569 bits (1468), Expect = e-160,   Method: Composition-based stats.
 Identities = 206/303 (67%), Positives = 248/303 (81%), Gaps = 1/303 (0%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
            + + + SFQ +ILTL +YWA  GC ILQPYDMEVGAGTFHP+TTLRALGP +W AAYVQ
Sbjct: 6   PHMRPEKSFQGLILTLQRYWADHGCVILQPYDMEVGAGTFHPATTLRALGPKTWNAAYVQ 65

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQVI+KP+P ++Q+LY++SLKA+G+D  +HD+RFVED+
Sbjct: 66  PSRRPKDGRYGENPNRLQHYYQFQVILKPSPPDIQDLYLKSLKAIGVDAALHDIRFVEDD 125

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WESPTLGAWGLGWECWCDGME+SQFTYFQQV G+EC+P++GE+TYGLERLAMYVQ V+ V
Sbjct: 126 WESPTLGAWGLGWECWCDGMEVSQFTYFQQVAGVECAPVAGELTYGLERLAMYVQGVDRV 185

Query: 185 YDIVFNAIEG-QNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIP 243
           YD+ FN  EG + V YGD+F Q+EQEYSR+NFE+++  +L   F  +E  C   L+ G  
Sbjct: 186 YDLNFNGREGAEKVTYGDVFLQAEQEYSRHNFEHSDTGMLFEQFKMAEGACKKYLEAGWA 245

Query: 244 NEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTP 303
           +     HL   PAYDQCIKASH+FNLLDARGVIS TERQ YILR+R LAKACGEA++ T 
Sbjct: 246 DGKKERHLMALPAYDQCIKASHVFNLLDARGVISVTERQSYILRVRELAKACGEAWIATE 305

Query: 304 NGG 306
            GG
Sbjct: 306 AGG 308


>gi|209886068|ref|YP_002289925.1| glycyl-tRNA synthetase, alpha subunit [Oligotropha carboxidovorans
           OM5]
 gi|229558517|sp|B6JEV8|SYGA_OLICO RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|209874264|gb|ACI94060.1| glycyl-tRNA synthetase, alpha subunit [Oligotropha carboxidovorans
           OM5]
          Length = 304

 Score =  569 bits (1467), Expect = e-160,   Method: Composition-based stats.
 Identities = 205/301 (68%), Positives = 246/301 (81%), Gaps = 1/301 (0%)

Query: 7   KKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPS 66
            + + SFQ +ILTL +YWA  GC ILQPYDMEVGAGTFHP+TTLRALGP  W AAYVQPS
Sbjct: 1   MRPEKSFQGLILTLQRYWADYGCIILQPYDMEVGAGTFHPATTLRALGPKRWNAAYVQPS 60

Query: 67  RRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWE 126
           RRP DGRY ENPNRLQHYYQFQVI+KP+P ++Q+LY++SL A+G+D  +HD+RFVED+WE
Sbjct: 61  RRPKDGRYGENPNRLQHYYQFQVILKPSPEDIQDLYLKSLAAIGVDAALHDIRFVEDDWE 120

Query: 127 SPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYD 186
           SPTLGAWGLGWECWCDGME+SQFTYFQQV G+EC+P++GE+TYGLERLAMYVQ V++VYD
Sbjct: 121 SPTLGAWGLGWECWCDGMEVSQFTYFQQVAGVECAPVAGELTYGLERLAMYVQGVDNVYD 180

Query: 187 IVFNAIEG-QNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNE 245
           + FN  +G + V YGD+F Q+EQEYSR+NFE+A+  +L   F  +E  C   L  G  ++
Sbjct: 181 LNFNGRDGAEKVTYGDVFLQAEQEYSRHNFEHADTAMLFEQFKMAEGACKKYLDAGWASD 240

Query: 246 HHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNG 305
               HL   PAYDQCIKASH+FNLLDARGVIS TERQ YILR+R LAKACGEA++ T  G
Sbjct: 241 KKDKHLMALPAYDQCIKASHVFNLLDARGVISVTERQSYILRVRELAKACGEAWIHTEAG 300

Query: 306 G 306
           G
Sbjct: 301 G 301


>gi|227821042|ref|YP_002825012.1| glycyl-tRNA synthetase subunit alpha [Sinorhizobium fredii NGR234]
 gi|227340041|gb|ACP24259.1| glycyl-tRNA synthetase alpha chain [Sinorhizobium fredii NGR234]
          Length = 320

 Score =  569 bits (1467), Expect = e-160,   Method: Composition-based stats.
 Identities = 225/304 (74%), Positives = 262/304 (86%), Gaps = 3/304 (0%)

Query: 6   NKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQP 65
           +     SFQ +ILTL  YWA +GC +LQPYDMEVGAGTFHP+TTLRALGP  W+AAYVQP
Sbjct: 9   HMNPKRSFQALILTLHSYWADKGCAVLQPYDMEVGAGTFHPATTLRALGPKPWRAAYVQP 68

Query: 66  SRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNW 125
           SRRP DGRY ENPNRLQHYYQ+QV++KPNP NLQ LY+ SL+A+G+DPL+HD+RFVED+W
Sbjct: 69  SRRPTDGRYGENPNRLQHYYQYQVLLKPNPSNLQELYLGSLEAIGLDPLLHDIRFVEDDW 128

Query: 126 ESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVY 185
           ESPTLGAWGLGWECWCDGME+SQFTYFQQVCGIECSP+SGE+TYGLERLAMYVQ V++VY
Sbjct: 129 ESPTLGAWGLGWECWCDGMEVSQFTYFQQVCGIECSPVSGELTYGLERLAMYVQGVDNVY 188

Query: 186 DIVFNAIEG-QNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           D+ FN  EG + + YGD+F Q+EQEYSR+NFEYAN  +LH HF+D+EKECL LL  G P 
Sbjct: 189 DLNFNGREGAEKITYGDVFLQAEQEYSRHNFEYANTAMLHQHFVDAEKECLALLAAGAPG 248

Query: 245 E--HHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMT 302
           +  ++R H CV PAYDQCIKASH+FNLLDARGVIS TERQ YILR+R+LAKACGEAFL+T
Sbjct: 249 DASNNRLHKCVLPAYDQCIKASHVFNLLDARGVISVTERQSYILRVRTLAKACGEAFLLT 308

Query: 303 PNGG 306
             GG
Sbjct: 309 DAGG 312


>gi|27377646|ref|NP_769175.1| glycyl-tRNA synthetase subunit alpha [Bradyrhizobium japonicum USDA
           110]
 gi|81738834|sp|Q89S70|SYGA_BRAJA RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|27350791|dbj|BAC47800.1| glycyl-tRNA synthetase, alpha subunit [Bradyrhizobium japonicum
           USDA 110]
          Length = 311

 Score =  569 bits (1467), Expect = e-160,   Method: Composition-based stats.
 Identities = 203/296 (68%), Positives = 239/296 (80%), Gaps = 1/296 (0%)

Query: 12  SFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPLD 71
           SFQ  IL L ++WA+QGC ILQPYDME+GAGTFHP+TTLRALGP  W AAYVQPSRRP D
Sbjct: 14  SFQGFILALQRFWAEQGCVILQPYDMEMGAGTFHPATTLRALGPKPWNAAYVQPSRRPKD 73

Query: 72  GRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTLG 131
           GRY ENPNR+QHYYQFQVI+KP+P NLQ LY++SL A+GID  +HD+RFVED+WESPTLG
Sbjct: 74  GRYGENPNRMQHYYQFQVIMKPSPPNLQELYLKSLAAIGIDSAVHDIRFVEDDWESPTLG 133

Query: 132 AWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFNA 191
           AWGLGWECWCDGME+SQFTYFQQV G EC+P++GE+TYGLERLAMYVQ V+ VYD+ FN 
Sbjct: 134 AWGLGWECWCDGMEVSQFTYFQQVAGFECAPVAGELTYGLERLAMYVQGVDRVYDLNFNG 193

Query: 192 IEGQ-NVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHH 250
            +G   V YGD+F Q+E+EYS++NFE A+  +L   F  +E  C   L  G    + + H
Sbjct: 194 RDGDAKVTYGDVFLQAEREYSKHNFEVADTAMLFEQFKMAEAACRKYLDAGWREGNRKEH 253

Query: 251 LCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNGG 306
           L   PAYDQCIKASH+FNLLDARGVIS TERQ YILR+R LAKACGEA++ T  GG
Sbjct: 254 LMALPAYDQCIKASHVFNLLDARGVISVTERQSYILRVRELAKACGEAWIHTEAGG 309


>gi|332139417|ref|YP_004425155.1| glycyl-tRNA synthetase subunit alpha [Alteromonas macleodii str.
           'Deep ecotype']
 gi|238693288|sp|B4S278|SYGA_ALTMD RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|327549439|gb|AEA96157.1| glycyl-tRNA synthetase subunit alpha [Alteromonas macleodii str.
           'Deep ecotype']
          Length = 301

 Score =  569 bits (1467), Expect = e-160,   Method: Composition-based stats.
 Identities = 186/301 (61%), Positives = 223/301 (74%), Gaps = 10/301 (3%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +IL L  YWA+QGC I+QP DMEVGAGTFHP T LR+LGP    +AYVQ
Sbjct: 1   MQKYDIKTFQGLILALQDYWARQGCVIIQPLDMEVGAGTFHPMTFLRSLGPEPMSSAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           P RRP DGRY ENPNRLQHYYQFQV++KP+P N+Q LY+ SLK +G DPL+HD+RFVEDN
Sbjct: 61  PCRRPTDGRYGENPNRLQHYYQFQVMLKPSPDNIQELYLGSLKELGFDPLVHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WESPTLGAWGLGWE W +GME++QFTYFQQV GIEC P++GEITYGLERLAMYVQ V+S+
Sbjct: 121 WESPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGIECKPVTGEITYGLERLAMYVQGVDSI 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V+       V YGD+F Q+E E S YNFE+AN E L   F + E E   L++  +P 
Sbjct: 181 YDLVWTDGPMGKVTYGDVFHQNEVEQSTYNFEHANVEALFRTFDECEAESKKLIENSLP- 239

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY+Q +KASH FNLLDAR  IS TERQRYILR+R+LAKAC E++     
Sbjct: 240 ---------LPAYEQVMKASHAFNLLDARHAISVTERQRYILRVRTLAKACAESYYQARE 290

Query: 305 G 305
            
Sbjct: 291 A 291


>gi|239993758|ref|ZP_04714282.1| glycyl-tRNA synthetase subunit alpha [Alteromonas macleodii ATCC
           27126]
          Length = 301

 Score =  569 bits (1467), Expect = e-160,   Method: Composition-based stats.
 Identities = 185/301 (61%), Positives = 223/301 (74%), Gaps = 10/301 (3%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +IL L  YWA+QGC I+QP DMEVGAGTFHP T LR+LGP    +AYVQ
Sbjct: 1   MQKYDIKTFQGLILALQDYWARQGCVIIQPLDMEVGAGTFHPMTFLRSLGPEPMSSAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           P RRP DGRY ENPNRLQHYYQFQV++KP+P N+Q LY+ SLK +G DPL+HD+RFVEDN
Sbjct: 61  PCRRPTDGRYGENPNRLQHYYQFQVMLKPSPDNIQELYLGSLKELGFDPLVHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WESPTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLERLAMYVQ V+S+
Sbjct: 121 WESPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGLERLAMYVQGVDSI 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V+       V YGD+F Q+E E S YNFE+AN E L   F + E E   L++  +P 
Sbjct: 181 YDLVWTDGPMGKVTYGDVFHQNEVEQSTYNFEHANVEALFRTFDECEAESKKLIENNLP- 239

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY+Q +KASH FNLLDAR  IS TERQRYILR+R+LAKAC E++     
Sbjct: 240 ---------LPAYEQVMKASHAFNLLDARHAISVTERQRYILRVRTLAKACAESYYQARE 290

Query: 305 G 305
            
Sbjct: 291 A 291


>gi|316932587|ref|YP_004107569.1| glycyl-tRNA synthetase subunit alpha [Rhodopseudomonas palustris
           DX-1]
 gi|315600301|gb|ADU42836.1| glycyl-tRNA synthetase, alpha subunit [Rhodopseudomonas palustris
           DX-1]
          Length = 311

 Score =  568 bits (1466), Expect = e-160,   Method: Composition-based stats.
 Identities = 203/303 (66%), Positives = 244/303 (80%), Gaps = 1/303 (0%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
            + + + SFQ +ILTL ++WA  GC ILQPYDMEVGAGTFHP+TTLRALGP  W AAYVQ
Sbjct: 6   PHMRPERSFQGLILTLQRFWADHGCVILQPYDMEVGAGTFHPATTLRALGPKHWNAAYVQ 65

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQVI+KP+P N+Q+LY++SL A+G+D  +HD+RFVED+
Sbjct: 66  PSRRPKDGRYGENPNRLQHYYQFQVILKPSPPNIQDLYLQSLAAIGVDSGLHDIRFVEDD 125

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WESPTLGAWGLGWECWCDGME+SQFTYFQQV G+EC+P++GE+TYGLERLAMYVQ ++ V
Sbjct: 126 WESPTLGAWGLGWECWCDGMEVSQFTYFQQVAGVECAPVAGELTYGLERLAMYVQGIDRV 185

Query: 185 YDIVFNAIEG-QNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIP 243
           YD+ FN  +G   V YGD+F Q+E+EYS++NFE A+ E+L   F  +E  C   L  G  
Sbjct: 186 YDLNFNGRDGADKVTYGDVFLQAEKEYSKHNFEVADTEMLFEQFKMAEAACKKYLDAGWV 245

Query: 244 NEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTP 303
           ++    H    PAYDQCIKASH+FNLLDARGVIS TERQ YILR+R LAKACGEA+L T 
Sbjct: 246 SDKREAHAMALPAYDQCIKASHVFNLLDARGVISVTERQSYILRVRELAKACGEAWLHTE 305

Query: 304 NGG 306
            GG
Sbjct: 306 AGG 308


>gi|119773168|ref|YP_925908.1| glycyl-tRNA synthetase subunit alpha [Shewanella amazonensis SB2B]
 gi|166200566|sp|A1S1I2|SYGA_SHEAM RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|119765668|gb|ABL98238.1| Glycine--tRNA ligase [Shewanella amazonensis SB2B]
          Length = 301

 Score =  568 bits (1466), Expect = e-160,   Method: Composition-based stats.
 Identities = 189/302 (62%), Positives = 223/302 (73%), Gaps = 8/302 (2%)

Query: 4   IHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYV 63
           +  K +  +FQ  ILTL  YWAQQGC I+QP DMEVGAGTFHP T LRALGP    +AYV
Sbjct: 1   MTTKYDVKTFQGFILTLQDYWAQQGCAIVQPLDMEVGAGTFHPQTFLRALGPEPMSSAYV 60

Query: 64  QPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVED 123
           QPSRRP DGRY ENPNRLQHYYQFQV++KP+P N+Q LY+ SL+A+GID  IHD+RFVED
Sbjct: 61  QPSRRPTDGRYGENPNRLQHYYQFQVVLKPSPDNIQELYLGSLRALGIDTQIHDIRFVED 120

Query: 124 NWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNS 183
           NWESPTLGAWGLGWE W +GME++QFTYFQQV GIECSP++GEITYGLERLAMY+Q V+S
Sbjct: 121 NWESPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGIECSPVTGEITYGLERLAMYIQGVDS 180

Query: 184 VYDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIP 243
           VYD+V+       + YGD+F Q+E E S YNFE+A+ + L   F   EK C  LL    P
Sbjct: 181 VYDLVWTDGPMGRITYGDVFHQNEVEQSTYNFEHADVDFLFGMFDQCEKACQHLLSLETP 240

Query: 244 NEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTP 303
                      PAY+Q +KASH FNLLDAR  IS TERQRYILR+R++AKA  EA+    
Sbjct: 241 --------LPLPAYEQVMKASHAFNLLDARHAISVTERQRYILRVRTMAKAVAEAYYKAR 292

Query: 304 NG 305
             
Sbjct: 293 EA 294


>gi|217977295|ref|YP_002361442.1| glycyl-tRNA synthetase subunit alpha [Methylocella silvestris BL2]
 gi|217502671|gb|ACK50080.1| glycyl-tRNA synthetase, alpha subunit [Methylocella silvestris BL2]
          Length = 322

 Score =  568 bits (1466), Expect = e-160,   Method: Composition-based stats.
 Identities = 210/296 (70%), Positives = 244/296 (82%), Gaps = 4/296 (1%)

Query: 12  SFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPLD 71
           SFQ +I+TL ++WA+QGC ILQPYDMEVGAGTFHP+TTLRALGP  WKAAYVQPSRRP D
Sbjct: 27  SFQGLIMTLQRFWAEQGCVILQPYDMEVGAGTFHPATTLRALGPKPWKAAYVQPSRRPKD 86

Query: 72  GRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTLG 131
           GRY ENPNRLQHYYQFQVI+KP+P +LQ LY+ SL A+G+D  +HD+RFVED+WESPTLG
Sbjct: 87  GRYGENPNRLQHYYQFQVILKPSPPDLQALYLRSLAAIGVDLKLHDIRFVEDDWESPTLG 146

Query: 132 AWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFNA 191
           AWGLGWECWCDGME+SQFTYFQQV G+EC+P++GE+TYGLERLAMYVQ V SV+D+ FN 
Sbjct: 147 AWGLGWECWCDGMEVSQFTYFQQVAGVECAPVAGELTYGLERLAMYVQGVESVFDLNFNG 206

Query: 192 IEGQ-NVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHH 250
            +G   V YGD+F Q+EQEYSR+NFE A+ E+L  HF D+E EC  LL      E     
Sbjct: 207 RDGDEKVTYGDVFRQAEQEYSRFNFEAADVELLARHFRDAEAECKALLAA---GEVGERA 263

Query: 251 LCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNGG 306
           L V PAYDQC+KASH+FNLLDARGVIS TERQ YILR+R LAKACG A+L T  GG
Sbjct: 264 LIVLPAYDQCLKASHLFNLLDARGVISVTERQSYILRVRELAKACGAAWLKTRAGG 319


>gi|126668180|ref|ZP_01739141.1| glycyl-tRNA synthetase subunit alpha [Marinobacter sp. ELB17]
 gi|126627329|gb|EAZ97965.1| glycyl-tRNA synthetase subunit alpha [Marinobacter sp. ELB17]
          Length = 355

 Score =  568 bits (1465), Expect = e-160,   Method: Composition-based stats.
 Identities = 186/302 (61%), Positives = 230/302 (76%), Gaps = 10/302 (3%)

Query: 2   APIHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAA 61
           A    K +  +FQ +IL L  +WA+ GC ILQP DMEVGAGTFHP+T LRA+GP SW AA
Sbjct: 5   ATNTPKPHIKTFQGLILELQTFWAKHGCVILQPLDMEVGAGTFHPATFLRAIGPESWNAA 64

Query: 62  YVQPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFV 121
           YVQPSRRP DGRY ENPNRLQHYYQFQV++KP+P NLQ LY++SLKA+G+DPL+HD+RFV
Sbjct: 65  YVQPSRRPTDGRYGENPNRLQHYYQFQVVLKPSPDNLQELYLDSLKALGLDPLVHDIRFV 124

Query: 122 EDNWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNV 181
           EDNWESPTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GE+TYGLER+AMY+Q V
Sbjct: 125 EDNWESPTLGAWGLGWEIWLNGMEVTQFTYFQQVGGLECYPVTGELTYGLERIAMYLQGV 184

Query: 182 NSVYDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKG 241
           +SVYD+V+       V YGD+F Q E E S YNFEYA+ E L   F   E+E   L++ G
Sbjct: 185 DSVYDLVWTEGPNGVVTYGDVFLQQEVEMSTYNFEYADTEFLFYSFDVYERESAKLIEAG 244

Query: 242 IPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLM 301
           +P           PAY+Q +KASH FN+LDAR  IS TERQRYILR+R+LA+A  +++  
Sbjct: 245 LP----------LPAYEQVLKASHTFNMLDARHAISVTERQRYILRVRTLARAVAQSYFD 294

Query: 302 TP 303
           + 
Sbjct: 295 SR 296


>gi|310816496|ref|YP_003964460.1| glycyl-tRNA synthetase subunit alpha [Ketogulonicigenium vulgare
           Y25]
 gi|308755231|gb|ADO43160.1| glycyl-tRNA synthetase subunit alpha [Ketogulonicigenium vulgare
           Y25]
          Length = 313

 Score =  568 bits (1465), Expect = e-160,   Method: Composition-based stats.
 Identities = 201/306 (65%), Positives = 239/306 (78%), Gaps = 2/306 (0%)

Query: 4   IHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYV 63
           + + +   SFQ IIL L  YWA QGC +LQPYDMEVGAGTFHP+TTLRALG   W AAYV
Sbjct: 1   MTDTRAPRSFQEIILRLQNYWAAQGCAVLQPYDMEVGAGTFHPATTLRALGSKPWAAAYV 60

Query: 64  QPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVED 123
           QPSRRP DGRY ENPNRLQHYYQ+QV++KP+P NLQ LY+ SL A+GID  +HDVRFVED
Sbjct: 61  QPSRRPTDGRYGENPNRLQHYYQYQVLVKPSPPNLQELYLGSLDAIGIDTRLHDVRFVED 120

Query: 124 NWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNS 183
           +WESPTLGAWGLGWE WCDGME+SQFTYFQQV G +C P++GE+TYGLERLAMYV  V+ 
Sbjct: 121 DWESPTLGAWGLGWEVWCDGMEVSQFTYFQQVGGHDCKPVAGELTYGLERLAMYVLGVDH 180

Query: 184 VYDIVFNAIEGQN-VLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKG- 241
           V D+ FN  +    + YGDIF Q+E+EYSR+NF+ AN E L  HF D+E EC  LL +  
Sbjct: 181 VMDMPFNDPDAPIALTYGDIFHQTEEEYSRHNFDAANTEKLLKHFEDAEAECKALLDQPA 240

Query: 242 IPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLM 301
           I  +  +  + V PAYDQCIKASH+FNLLDARGVIS TERQ YI R+R+LAKAC +AF++
Sbjct: 241 IDPKTGKRIIMVHPAYDQCIKASHLFNLLDARGVISVTERQAYIGRVRTLAKACADAFVL 300

Query: 302 TPNGGH 307
           T   G+
Sbjct: 301 TGAAGY 306


>gi|83311750|ref|YP_422014.1| glycyl-tRNA synthetase subunit alpha [Magnetospirillum magneticum
           AMB-1]
 gi|82946591|dbj|BAE51455.1| Glycyl-tRNA synthetase [Magnetospirillum magneticum AMB-1]
          Length = 294

 Score =  568 bits (1465), Expect = e-160,   Method: Composition-based stats.
 Identities = 204/306 (66%), Positives = 245/306 (80%), Gaps = 15/306 (4%)

Query: 1   MAPIHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKA 60
           M  +  KK   SFQ++ILTL  +WA+QGC ILQPYDMEVGAGTFHP+TTLRALGP  WK 
Sbjct: 1   MGIVGTKKP--SFQSLILTLQAFWAEQGCVILQPYDMEVGAGTFHPATTLRALGPDHWKC 58

Query: 61  AYVQPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRF 120
           AYVQPSRRP DGRY ENPNRLQHYYQ+QV++KP+P N Q LY+ESL+ +G+DPL HD+RF
Sbjct: 59  AYVQPSRRPKDGRYGENPNRLQHYYQYQVLLKPSPPNAQELYLESLRRLGVDPLAHDIRF 118

Query: 121 VEDNWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQN 180
           VED+WESPTLGAWGLGWE WCDGME++QFTYFQQV GIEC P++ E+TYGLERLAMY+Q 
Sbjct: 119 VEDDWESPTLGAWGLGWEVWCDGMEVTQFTYFQQVGGIECDPVAVELTYGLERLAMYIQG 178

Query: 181 VNSVYDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKK 240
           V +VYD+ FN   G  V YGD+F Q+E+EYS +NFE+A+ ++L  HF+D+EKEC +LL+K
Sbjct: 179 VENVYDLDFN---GDGVTYGDVFLQAEKEYSAHNFEHADTDMLLQHFLDAEKECKNLLEK 235

Query: 241 GIPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFL 300
           G+            PAYDQCIKASH FNLLDARGVIS TERQ YI R+R+LAKAC E +L
Sbjct: 236 GV----------ALPAYDQCIKASHRFNLLDARGVISVTERQAYIGRVRALAKACCEGWL 285

Query: 301 MTPNGG 306
            +   G
Sbjct: 286 ASRTTG 291


>gi|53803632|ref|YP_114480.1| glycyl-tRNA synthetase subunit alpha [Methylococcus capsulatus str.
           Bath]
 gi|53757393|gb|AAU91684.1| glycyl-tRNA synthetase, alpha subunit [Methylococcus capsulatus
           str. Bath]
          Length = 309

 Score =  568 bits (1464), Expect = e-160,   Method: Composition-based stats.
 Identities = 185/303 (61%), Positives = 224/303 (73%), Gaps = 10/303 (3%)

Query: 3   PIHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAY 62
           P  N     SFQ++ILTL +YWA+QGC ILQP D+EVGAGTFHP+T LRA+GP  W  AY
Sbjct: 2   PTSNAPETPSFQDLILTLQRYWAEQGCVILQPLDLEVGAGTFHPATFLRAIGPEPWNTAY 61

Query: 63  VQPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVE 122
           VQPSRRP DGRY +NPNRLQHYYQFQV++KP+P ++Q LY+ SL+ +G D L HDVRFVE
Sbjct: 62  VQPSRRPTDGRYGDNPNRLQHYYQFQVVLKPSPPDIQELYLGSLRLLGFDLLEHDVRFVE 121

Query: 123 DNWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVN 182
           DNWESPTLGAWGLGWE W +GME++QFTYFQQV G++C P+SGEITYGLER+AMYVQ V 
Sbjct: 122 DNWESPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLDCRPVSGEITYGLERIAMYVQGVE 181

Query: 183 SVYDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGI 242
           +VYD+V+       V YGD+F Q+E E S +NFE+AN E L + F   E+EC  L+  G+
Sbjct: 182 NVYDLVWTRGPQGIVRYGDVFHQNEVEMSAFNFEHANTEFLFSAFDTYERECRQLIALGL 241

Query: 243 PNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMT 302
           P           PAY+  +KASH FNLLDAR  IS TERQR+ILR+R LAKA  EA+   
Sbjct: 242 P----------LPAYEMVLKASHTFNLLDARRAISVTERQRFILRVRELAKAVAEAYYQR 291

Query: 303 PNG 305
              
Sbjct: 292 REA 294


>gi|315121920|ref|YP_004062409.1| glycyl-tRNA synthetase subunit alpha [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495322|gb|ADR51921.1| glycyl-tRNA synthetase subunit alpha [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 308

 Score =  568 bits (1464), Expect = e-160,   Method: Composition-based stats.
 Identities = 277/307 (90%), Positives = 292/307 (95%)

Query: 1   MAPIHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKA 60
           MAPIH+KKN  SFQNI+L LT+YWA+QGCTILQPYDMEVGAGTFHPSTTLRALGPL WKA
Sbjct: 1   MAPIHDKKNKTSFQNIVLILTEYWAKQGCTILQPYDMEVGAGTFHPSTTLRALGPLPWKA 60

Query: 61  AYVQPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRF 120
           AYVQPSRRPLDGRYA+NPNRLQHYYQFQVIIKPNPL+LQ LYIESL+AVGIDPL+HD+RF
Sbjct: 61  AYVQPSRRPLDGRYAQNPNRLQHYYQFQVIIKPNPLDLQKLYIESLQAVGIDPLVHDIRF 120

Query: 121 VEDNWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQN 180
           VEDNWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQN
Sbjct: 121 VEDNWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQN 180

Query: 181 VNSVYDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKK 240
           VNSV+DIVFN IEG+NVLYGDIFAQSEQEYSRYNFEYAN  ILHNHFID EKEC  LL+ 
Sbjct: 181 VNSVFDIVFNTIEGKNVLYGDIFAQSEQEYSRYNFEYANTNILHNHFIDHEKECQKLLEA 240

Query: 241 GIPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFL 300
           G PN+HH HHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFL
Sbjct: 241 GAPNKHHNHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFL 300

Query: 301 MTPNGGH 307
           MT +GG+
Sbjct: 301 MTSSGGY 307


>gi|116250717|ref|YP_766555.1| glycyl-tRNA synthetase subunit alpha [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|115255365|emb|CAK06440.1| putative glycyl-tRNA synthetase alpha chain [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 318

 Score =  568 bits (1464), Expect = e-160,   Method: Composition-based stats.
 Identities = 229/310 (73%), Positives = 264/310 (85%), Gaps = 4/310 (1%)

Query: 1   MAPIHNKKNDL-SFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWK 59
           M+ I +  N   SFQ +ILTL  YWA +GC +LQPYDMEVGAGTFHP+TTLRALGP  WK
Sbjct: 1   MSAIPDHMNPKRSFQALILTLHNYWADKGCAVLQPYDMEVGAGTFHPATTLRALGPKPWK 60

Query: 60  AAYVQPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVR 119
           AAYVQPSRRP DGRY ENPNRLQHYYQ+QVI+KPNP NLQ LY+ SL A+G+DPL+HD+R
Sbjct: 61  AAYVQPSRRPSDGRYGENPNRLQHYYQYQVILKPNPPNLQELYLGSLAAIGLDPLLHDIR 120

Query: 120 FVEDNWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQ 179
           FVED+WESPTLGAWGLGWECWCDGME+SQFTYFQQVCGIECSP++GE+TYGLERLAMYVQ
Sbjct: 121 FVEDDWESPTLGAWGLGWECWCDGMEVSQFTYFQQVCGIECSPVAGELTYGLERLAMYVQ 180

Query: 180 NVNSVYDIVFNAIEGQ-NVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLL 238
            V++VYD+ FN  +G   + YGD+F Q+EQEYSR+NFE+AN E+LH HF+D+EKEC  LL
Sbjct: 181 GVDNVYDLNFNGRDGDEKISYGDVFLQAEQEYSRHNFEFANTEMLHRHFVDAEKECRALL 240

Query: 239 KKGIP--NEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACG 296
             G P  N + R H CVFPAYDQCIKASH+FNLLDARGVIS TERQ YILR+R+LAKACG
Sbjct: 241 DAGAPGDNANQRLHKCVFPAYDQCIKASHVFNLLDARGVISVTERQSYILRVRTLAKACG 300

Query: 297 EAFLMTPNGG 306
           EAFL+T  GG
Sbjct: 301 EAFLLTDAGG 310


>gi|327192812|gb|EGE59739.1| glycyl-tRNA synthetase subunit alpha [Rhizobium etli CNPAF512]
          Length = 318

 Score =  568 bits (1464), Expect = e-160,   Method: Composition-based stats.
 Identities = 228/310 (73%), Positives = 265/310 (85%), Gaps = 4/310 (1%)

Query: 1   MAPIHNKKNDL-SFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWK 59
           M+ I +  N   SFQ +ILTL  YWA +GC +LQPYDMEVGAGTFHP+TTLRALGP  WK
Sbjct: 1   MSAIPDHMNPKRSFQALILTLHSYWADKGCAVLQPYDMEVGAGTFHPATTLRALGPKPWK 60

Query: 60  AAYVQPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVR 119
           AAYVQPSRRP DGRY ENPNRLQHYYQ+QVI+KPNP NLQ LY+ SL A+G+DPL+HD+R
Sbjct: 61  AAYVQPSRRPSDGRYGENPNRLQHYYQYQVILKPNPPNLQELYLGSLAAIGLDPLLHDIR 120

Query: 120 FVEDNWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQ 179
           FVED+WESPTLGAWGLGWECWCDGME+SQFTYFQQVCGIEC+P++GE+TYGLERLAMYVQ
Sbjct: 121 FVEDDWESPTLGAWGLGWECWCDGMEVSQFTYFQQVCGIECAPVAGELTYGLERLAMYVQ 180

Query: 180 NVNSVYDIVFNAIEGQ-NVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLL 238
            V++VYD+ FN  EG   + YGD+F Q+EQEYSR+NFE+AN E+LH HF+D+EKEC  LL
Sbjct: 181 GVDNVYDLNFNGREGDEKISYGDVFLQAEQEYSRHNFEFANTEMLHRHFVDAEKECRALL 240

Query: 239 KKGIPNE--HHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACG 296
             G P++  + R H CVFPAYDQCIKASH+FNLLDARGVIS TERQ YILR+R+LAKACG
Sbjct: 241 DAGAPDDSANLRLHKCVFPAYDQCIKASHVFNLLDARGVISVTERQSYILRVRTLAKACG 300

Query: 297 EAFLMTPNGG 306
           EAFL+T  GG
Sbjct: 301 EAFLLTDAGG 310


>gi|291279041|ref|YP_003495876.1| glycyl-tRNA synthetase subunit alpha [Deferribacter desulfuricans
           SSM1]
 gi|290753743|dbj|BAI80120.1| glycyl-tRNA synthetase, alpha subunit [Deferribacter desulfuricans
           SSM1]
          Length = 290

 Score =  567 bits (1463), Expect = e-160,   Method: Composition-based stats.
 Identities = 182/294 (61%), Positives = 224/294 (76%), Gaps = 14/294 (4%)

Query: 11  LSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPL 70
           + FQ++IL L Q+WA  GC I QPYD+EVGAGTF+P+T LR LGP  W  AYV+PSRRP 
Sbjct: 1   MYFQDVILKLQQFWADHGCIIYQPYDIEVGAGTFNPATFLRCLGPEPWNVAYVEPSRRPT 60

Query: 71  DGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTL 130
           DGRY ENPNRLQHYYQFQVI+KP+P N+Q LY++SLK +GIDPL HD+RFVED+WESPTL
Sbjct: 61  DGRYGENPNRLQHYYQFQVILKPSPDNIQELYLDSLKYLGIDPLEHDIRFVEDDWESPTL 120

Query: 131 GAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFN 190
           GAWGLGWE W DGMEI+QFTYFQQ  GI+ SP+SGEITYGLER+AMY+Q V+SV+D+ +N
Sbjct: 121 GAWGLGWEVWLDGMEITQFTYFQQAGGIDLSPVSGEITYGLERIAMYLQKVDSVFDLKWN 180

Query: 191 AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHH 250
               ++V YGD++ ++E E+S+YNFE A+ E+L   F   EKEC+ L++KG+        
Sbjct: 181 ----KDVTYGDVYHRNEVEFSKYNFEEADTEMLFTLFNMYEKECVRLVEKGLS------- 229

Query: 251 LCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
               PAYD C+K SH FNLLDAR  IS TER  YI R+R LAK C E +L T  
Sbjct: 230 ---LPAYDYCLKCSHTFNLLDARNAISVTERTGYIARVRHLAKLCAENYLKTRE 280


>gi|114771719|ref|ZP_01449123.1| glycyl-tRNA synthetase alpha subunit [alpha proteobacterium
           HTCC2255]
 gi|114547791|gb|EAU50681.1| glycyl-tRNA synthetase alpha subunit [alpha proteobacterium
           HTCC2255]
          Length = 307

 Score =  567 bits (1463), Expect = e-160,   Method: Composition-based stats.
 Identities = 201/296 (67%), Positives = 233/296 (78%), Gaps = 2/296 (0%)

Query: 13  FQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPLDG 72
           FQ+IIL L  YWA+QGC ILQPYDMEVGAGTFHP+TTLRALGP  W AAYVQPSRRP DG
Sbjct: 9   FQDIILRLQNYWAEQGCAILQPYDMEVGAGTFHPATTLRALGPKPWAAAYVQPSRRPTDG 68

Query: 73  RYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTLGA 132
           RY ENPNRLQHYYQ+QVIIKP+P N Q LY+ SL A+GID  +HD+RFVED+WESPTLGA
Sbjct: 69  RYGENPNRLQHYYQYQVIIKPSPENFQELYLGSLNAIGIDMELHDIRFVEDDWESPTLGA 128

Query: 133 WGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFNAI 192
           WGLGWE WCDGME+SQFTYFQQV G +C P+SGE+TYGLERLAMYV  V+ V D+ FN+ 
Sbjct: 129 WGLGWEVWCDGMEVSQFTYFQQVGGHDCKPVSGELTYGLERLAMYVLGVDHVMDMPFNSP 188

Query: 193 EG-QNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLL-KKGIPNEHHRHH 250
                + YGDIF Q+EQEYSR+NF+ A+  IL  HF D+E EC  +L +  +  +     
Sbjct: 189 GSITELKYGDIFRQTEQEYSRWNFDVADTNILLQHFEDAEAECKRILNEPDVDPKTGNKI 248

Query: 251 LCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNGG 306
           +   PAYDQCIKASH+FNLLDARGVIS TERQ YI R+RSLAK C ++FL T  GG
Sbjct: 249 VMAHPAYDQCIKASHLFNLLDARGVISVTERQSYIGRVRSLAKTCADSFLKTEAGG 304


>gi|86356527|ref|YP_468419.1| glycyl-tRNA synthetase subunit alpha [Rhizobium etli CFN 42]
 gi|86280629|gb|ABC89692.1| glycyl-tRNA synthetase, alpha subunit protein [Rhizobium etli CFN
           42]
          Length = 318

 Score =  567 bits (1463), Expect = e-160,   Method: Composition-based stats.
 Identities = 228/310 (73%), Positives = 265/310 (85%), Gaps = 4/310 (1%)

Query: 1   MAPIHNKKNDL-SFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWK 59
           M+ I +  N   SFQ +ILTL  YWA +GC +LQPYDMEVGAGTFHP+TTLRALGP  WK
Sbjct: 1   MSAIPDHMNPKRSFQALILTLHSYWADKGCAVLQPYDMEVGAGTFHPATTLRALGPKPWK 60

Query: 60  AAYVQPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVR 119
           AAYVQPSRRP DGRY ENPNRLQHYYQ+QVI+KPNP NLQ LY+ SL A+G+DPL+HD+R
Sbjct: 61  AAYVQPSRRPSDGRYGENPNRLQHYYQYQVILKPNPPNLQELYLGSLAAIGLDPLLHDIR 120

Query: 120 FVEDNWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQ 179
           FVED+WESPTLGAWGLGWECWCDGME+SQFTYFQQVCGIEC+P++GE+TYGLERLAMYVQ
Sbjct: 121 FVEDDWESPTLGAWGLGWECWCDGMEVSQFTYFQQVCGIECAPVAGELTYGLERLAMYVQ 180

Query: 180 NVNSVYDIVFNAIEGQ-NVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLL 238
            V++VYD+ FN  EG   + YGD+F Q+EQEYSR+NFE+AN E+LH HF+D+EKEC  LL
Sbjct: 181 GVDNVYDLNFNGREGDEKISYGDVFLQAEQEYSRHNFEFANTEMLHRHFVDAEKECRSLL 240

Query: 239 KKGIPNE--HHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACG 296
             G P++  + R H CVFPAYDQCIKASH+FNLLDARGVIS TERQ YILR+R+LAKACG
Sbjct: 241 DAGAPDDSANQRLHKCVFPAYDQCIKASHVFNLLDARGVISVTERQSYILRVRTLAKACG 300

Query: 297 EAFLMTPNGG 306
           EAFL+T  GG
Sbjct: 301 EAFLLTDAGG 310


>gi|190890592|ref|YP_001977134.1| glycyl-tRNA synthetase, alpha subunit [Rhizobium etli CIAT 652]
 gi|190695871|gb|ACE89956.1| glycyl-tRNA synthetase protein, alpha subunit [Rhizobium etli CIAT
           652]
          Length = 318

 Score =  567 bits (1463), Expect = e-160,   Method: Composition-based stats.
 Identities = 228/310 (73%), Positives = 265/310 (85%), Gaps = 4/310 (1%)

Query: 1   MAPIHNKKNDL-SFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWK 59
           M+ I +  N   SFQ +ILTL  YWA +GC +LQPYDMEVGAGTFHP+TTLRALGP  WK
Sbjct: 1   MSAIPDHMNPKRSFQALILTLHSYWADKGCAVLQPYDMEVGAGTFHPATTLRALGPKPWK 60

Query: 60  AAYVQPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVR 119
           AAYVQPSRRP DGRY ENPNRLQHYYQ+QVI+KPNP NLQ LY+ SL A+G+DPL+HD+R
Sbjct: 61  AAYVQPSRRPSDGRYGENPNRLQHYYQYQVILKPNPPNLQELYLGSLAAIGLDPLLHDIR 120

Query: 120 FVEDNWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQ 179
           FVED+WESPTLGAWGLGWECWCDGME+SQFTYFQQVCGIEC+P++GE+TYGLERLAMYVQ
Sbjct: 121 FVEDDWESPTLGAWGLGWECWCDGMEVSQFTYFQQVCGIECAPVAGELTYGLERLAMYVQ 180

Query: 180 NVNSVYDIVFNAIEGQ-NVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLL 238
            V++VYD+ FN  EG   + YGD+F Q+EQEYSR+NFE+AN E+LH HF+D+EKEC  LL
Sbjct: 181 GVDNVYDLNFNGREGDEKISYGDVFLQAEQEYSRHNFEFANTEMLHRHFVDAEKECRALL 240

Query: 239 KKGIPNE--HHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACG 296
             G P++  + R H CVFPAYDQCIKASH+FNLLDARGVIS TERQ YILR+R+LAKACG
Sbjct: 241 DAGAPDDSANQRLHKCVFPAYDQCIKASHVFNLLDARGVISVTERQSYILRVRTLAKACG 300

Query: 297 EAFLMTPNGG 306
           EAFL+T  GG
Sbjct: 301 EAFLLTDAGG 310


>gi|307309350|ref|ZP_07589013.1| glycyl-tRNA synthetase, alpha subunit [Sinorhizobium meliloti
           BL225C]
 gi|307320086|ref|ZP_07599507.1| glycyl-tRNA synthetase, alpha subunit [Sinorhizobium meliloti AK83]
 gi|306894301|gb|EFN25066.1| glycyl-tRNA synthetase, alpha subunit [Sinorhizobium meliloti AK83]
 gi|306900219|gb|EFN30837.1| glycyl-tRNA synthetase, alpha subunit [Sinorhizobium meliloti
           BL225C]
          Length = 320

 Score =  567 bits (1463), Expect = e-160,   Method: Composition-based stats.
 Identities = 231/310 (74%), Positives = 268/310 (86%), Gaps = 4/310 (1%)

Query: 1   MAPIHNKKNDL-SFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWK 59
           +AP+ +  N   SFQ +ILTL  YWA +GC +LQPYDMEVGAGTFHP+TTLRALGP  W+
Sbjct: 3   IAPLPDHMNPKRSFQALILTLHNYWADKGCAVLQPYDMEVGAGTFHPATTLRALGPKPWR 62

Query: 60  AAYVQPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVR 119
           AAYVQPSRRP DGRY ENPNRLQHYYQ+QVI+KPNP NLQ LY+ SL+A+G+DPL+HD+R
Sbjct: 63  AAYVQPSRRPTDGRYGENPNRLQHYYQYQVILKPNPSNLQELYLGSLEAIGLDPLLHDIR 122

Query: 120 FVEDNWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQ 179
           FVED+WESPTLGAWGLGWECWCDGME+SQFTYFQQVCGIECSP+SGE+TYGLERLAMYVQ
Sbjct: 123 FVEDDWESPTLGAWGLGWECWCDGMEVSQFTYFQQVCGIECSPVSGELTYGLERLAMYVQ 182

Query: 180 NVNSVYDIVFNAIEG-QNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLL 238
            V++VYD+ FN  EG + + YGD+F Q+EQEYSR+NFEYAN  +LH HFID+EKECL LL
Sbjct: 183 GVDNVYDLNFNGREGAEKISYGDVFLQAEQEYSRHNFEYANTAMLHQHFIDAEKECLALL 242

Query: 239 KKGIPNE--HHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACG 296
             G P +  ++R H CVFPAYDQCIKASH+FNLLDARGVIS TERQ YILR+R+LAKACG
Sbjct: 243 AAGAPGDSSNNRLHKCVFPAYDQCIKASHVFNLLDARGVISVTERQSYILRVRTLAKACG 302

Query: 297 EAFLMTPNGG 306
           EAFL+T  GG
Sbjct: 303 EAFLLTEAGG 312


>gi|110633070|ref|YP_673278.1| glycyl-tRNA synthetase subunit alpha [Mesorhizobium sp. BNC1]
 gi|123058177|sp|Q11KG2|SYGA_MESSB RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|110284054|gb|ABG62113.1| glycyl-tRNA synthetase alpha chain [Chelativorans sp. BNC1]
          Length = 318

 Score =  567 bits (1462), Expect = e-160,   Method: Composition-based stats.
 Identities = 221/305 (72%), Positives = 253/305 (82%), Gaps = 3/305 (0%)

Query: 2   APIHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAA 61
           + + +     SFQ +ILTL  YWA QGC ILQPYDMEVGAGTFHP+TTLR+LGP  W AA
Sbjct: 4   SALPHMHPSRSFQGLILTLHSYWAAQGCVILQPYDMEVGAGTFHPATTLRSLGPRPWNAA 63

Query: 62  YVQPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFV 121
           YVQPSRRP DGRY ENPNRLQHYYQ+QVI+KPNP NLQ LY+ SL A+G+DPL+HD+RFV
Sbjct: 64  YVQPSRRPKDGRYGENPNRLQHYYQYQVILKPNPPNLQELYLGSLAAIGLDPLLHDIRFV 123

Query: 122 EDNWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNV 181
           ED+WESPTLGAWGLGWECWCDGME+SQFTYFQQVCGIEC+P+SGE+TYGLERLAMYVQ V
Sbjct: 124 EDDWESPTLGAWGLGWECWCDGMEVSQFTYFQQVCGIECAPVSGELTYGLERLAMYVQGV 183

Query: 182 NSVYDIVFNAIEG-QNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKK 240
           ++VYD+ FN +EG   V YG++F Q+EQEYSR+NFEYAN E+L  HF D+E+EC  LL+ 
Sbjct: 184 DNVYDLNFNGLEGSDKVTYGEVFLQAEQEYSRHNFEYANTEMLFRHFEDAERECRALLEA 243

Query: 241 GIPNEHHRH--HLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEA 298
           G P        H  VFPAYDQCIKASH+FNLLDARGVIS TERQ YILR+R LAKACGEA
Sbjct: 244 GAPRPSDNAALHRMVFPAYDQCIKASHVFNLLDARGVISVTERQSYILRVRDLAKACGEA 303

Query: 299 FLMTP 303
           FL T 
Sbjct: 304 FLNTE 308


>gi|218682936|ref|ZP_03530537.1| glycyl-tRNA synthetase subunit alpha [Rhizobium etli CIAT 894]
          Length = 318

 Score =  567 bits (1462), Expect = e-160,   Method: Composition-based stats.
 Identities = 229/310 (73%), Positives = 264/310 (85%), Gaps = 4/310 (1%)

Query: 1   MAPIHNKKNDL-SFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWK 59
           M+ I +  N   SFQ +ILTL  YWA +GC +LQPYDMEVGAGTFHP+TTLRALGP  WK
Sbjct: 1   MSAIPDHMNPKRSFQALILTLHSYWADKGCAVLQPYDMEVGAGTFHPATTLRALGPKPWK 60

Query: 60  AAYVQPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVR 119
           AAYVQPSRRP DGRY ENPNRLQHYYQ+QVI+KPNP NLQ LY+ SL A+G+DPL+HD+R
Sbjct: 61  AAYVQPSRRPSDGRYGENPNRLQHYYQYQVILKPNPPNLQELYLGSLAAIGLDPLLHDIR 120

Query: 120 FVEDNWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQ 179
           FVED+WESPTLGAWGLGWECWCDGME+SQFTYFQQVCGIEC+P++GE+TYGLERLAMYVQ
Sbjct: 121 FVEDDWESPTLGAWGLGWECWCDGMEVSQFTYFQQVCGIECAPVAGELTYGLERLAMYVQ 180

Query: 180 NVNSVYDIVFNAIEGQ-NVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLL 238
            V++VYD+ FN  EG   + YGD+F Q+EQEYSR+NFE+AN E+LH HF+D+EKEC  LL
Sbjct: 181 GVDNVYDLNFNGREGDEKISYGDVFLQAEQEYSRHNFEFANTEMLHRHFVDAEKECRALL 240

Query: 239 KKGIP--NEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACG 296
             G P  N + R H CVFPAYDQCIKASH+FNLLDARGVIS TERQ YILR+R+LAKACG
Sbjct: 241 DAGAPGDNANQRLHKCVFPAYDQCIKASHVFNLLDARGVISVTERQSYILRVRTLAKACG 300

Query: 297 EAFLMTPNGG 306
           EAFL+T  GG
Sbjct: 301 EAFLLTDAGG 310


>gi|241203320|ref|YP_002974416.1| glycyl-tRNA synthetase subunit alpha [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240857210|gb|ACS54877.1| glycyl-tRNA synthetase, alpha subunit [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 311

 Score =  567 bits (1462), Expect = e-160,   Method: Composition-based stats.
 Identities = 226/303 (74%), Positives = 259/303 (85%), Gaps = 3/303 (0%)

Query: 7   KKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPS 66
                SFQ +ILTL  YWA +GC +LQPYDMEVGAGTFHP+TTLRALGP  WKAAYVQPS
Sbjct: 1   MNPKRSFQALILTLHNYWADKGCAVLQPYDMEVGAGTFHPATTLRALGPKPWKAAYVQPS 60

Query: 67  RRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWE 126
           RRP DGRY ENPNRLQHYYQ+QVI+KPNP NLQ LY+ SL A+G+DPL+HD+RFVED+WE
Sbjct: 61  RRPSDGRYGENPNRLQHYYQYQVILKPNPPNLQELYLGSLAAIGLDPLLHDIRFVEDDWE 120

Query: 127 SPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYD 186
           SPTLGAWGLGWECWCDGME+SQFTYFQQVCGIECSP++GE+TYGLERLAMYVQ V++VYD
Sbjct: 121 SPTLGAWGLGWECWCDGMEVSQFTYFQQVCGIECSPVAGELTYGLERLAMYVQGVDNVYD 180

Query: 187 IVFNAIEGQ-NVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIP-- 243
           + FN  +G   + YGD+F Q+EQEYSR+NFE+AN E+LH HF+D+EKEC  LL  G P  
Sbjct: 181 LNFNGRDGDEKISYGDVFLQAEQEYSRHNFEFANTEMLHRHFVDAEKECRALLDAGAPGD 240

Query: 244 NEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTP 303
           N + R H CVFPAYDQCIKASH+FNLLDARGVIS TERQ YILR+R+LAKACGEAFL+T 
Sbjct: 241 NANQRLHKCVFPAYDQCIKASHVFNLLDARGVISVTERQSYILRVRTLAKACGEAFLLTD 300

Query: 304 NGG 306
            GG
Sbjct: 301 AGG 303


>gi|86137958|ref|ZP_01056534.1| glycyl-tRNA synthetase alpha subunit [Roseobacter sp. MED193]
 gi|85825550|gb|EAQ45749.1| glycyl-tRNA synthetase alpha subunit [Roseobacter sp. MED193]
          Length = 329

 Score =  566 bits (1461), Expect = e-159,   Method: Composition-based stats.
 Identities = 194/308 (62%), Positives = 235/308 (76%), Gaps = 2/308 (0%)

Query: 1   MAPIHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKA 60
           M     +    SFQ IIL L  YWA +GC I+QPYDMEVGAGTFHP+TTLR+LG   W A
Sbjct: 19  MTAGETRSTPRSFQEIILRLQSYWASKGCAIMQPYDMEVGAGTFHPATTLRSLGSKPWAA 78

Query: 61  AYVQPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRF 120
           AYVQPSRRP DGRY ENPNRLQHYYQFQ +IKP+P NLQ LY+ SL+A+G+D  +HD+RF
Sbjct: 79  AYVQPSRRPTDGRYGENPNRLQHYYQFQALIKPSPPNLQELYLGSLEAIGVDMALHDIRF 138

Query: 121 VEDNWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQN 180
           VED+WESPTLGAWGLGWE WCDGME+SQFTYFQQV G +C P+SGE+TYGLERLAMYV  
Sbjct: 139 VEDDWESPTLGAWGLGWEVWCDGMEVSQFTYFQQVGGHDCHPVSGELTYGLERLAMYVLG 198

Query: 181 VNSVYDIVFNAIEGQ-NVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLL- 238
           V+ V D+ FN       + YGD+F Q+E+EY+R+NF+ AN ++L  HF ++E EC  +L 
Sbjct: 199 VDHVMDMPFNDPNAPIPLTYGDVFKQTEEEYARWNFDVANTDVLLRHFEEAEAECATILA 258

Query: 239 KKGIPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEA 298
           ++    +  +  +   PAYDQCIKASHIFNLLDARGVIS TERQ YI R+R+LAK C +A
Sbjct: 259 QEHDDPKTGKRIIMAHPAYDQCIKASHIFNLLDARGVISVTERQAYIGRVRNLAKQCADA 318

Query: 299 FLMTPNGG 306
           F+ T  GG
Sbjct: 319 FVQTSAGG 326


>gi|148654008|ref|YP_001281101.1| glycyl-tRNA synthetase subunit alpha [Psychrobacter sp. PRwf-1]
 gi|148573092|gb|ABQ95151.1| Glycine--tRNA ligase [Psychrobacter sp. PRwf-1]
          Length = 317

 Score =  566 bits (1460), Expect = e-159,   Method: Composition-based stats.
 Identities = 180/294 (61%), Positives = 222/294 (75%), Gaps = 10/294 (3%)

Query: 11  LSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPL 70
           ++FQ +ILTL  YWA +GC +LQPYDMEVGAGTFH +T LR+LGP  W AAYVQPSRRP 
Sbjct: 1   MTFQELILTLQTYWANKGCVVLQPYDMEVGAGTFHTATFLRSLGPEVWNAAYVQPSRRPT 60

Query: 71  DGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTL 130
           DGRY  NPNRLQHYYQFQV++KPNP N+Q LY+ SL+A+GID L HDVRFVEDNWESPTL
Sbjct: 61  DGRYGNNPNRLQHYYQFQVVMKPNPPNIQELYLGSLEAIGIDTLTHDVRFVEDNWESPTL 120

Query: 131 GAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFN 190
           GAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLERLAMY+Q V+SVYD+V+ 
Sbjct: 121 GAWGLGWEVWLNGMEVTQFTYFQQVGGLECFPVTGEITYGLERLAMYIQGVDSVYDLVWT 180

Query: 191 AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHH 250
             E   V YGD+F Q+E E S YNFE+A+   +   F   E++   L++  +P       
Sbjct: 181 DGEFGKVTYGDVFHQNEVEQSTYNFEHADVPKMFELFDFYEQQADKLVEADLP------- 233

Query: 251 LCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
               PAY+  +KASH FNLLDARG IS TERQR+ILR+R+LA+   + ++    
Sbjct: 234 ---LPAYEMVLKASHTFNLLDARGAISVTERQRFILRVRTLARKVAQGYVQARA 284


>gi|39934120|ref|NP_946396.1| glycyl-tRNA synthetase subunit alpha [Rhodopseudomonas palustris
           CGA009]
 gi|39647968|emb|CAE26488.1| glycyl-tRNA synthetase alpha chain [Rhodopseudomonas palustris
           CGA009]
          Length = 316

 Score =  566 bits (1460), Expect = e-159,   Method: Composition-based stats.
 Identities = 201/302 (66%), Positives = 243/302 (80%), Gaps = 1/302 (0%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
            + + + SFQ +ILTL ++WA  GC ILQPYDMEVGAGTFHP+TTLRALGP  W AAYVQ
Sbjct: 12  PHMRPERSFQGLILTLQRFWADYGCVILQPYDMEVGAGTFHPATTLRALGPKRWNAAYVQ 71

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQVI+KP+P ++Q+LY++SL A+G+D  +HDVRFVED+
Sbjct: 72  PSRRPKDGRYGENPNRLQHYYQFQVILKPSPPDIQDLYLKSLAAIGVDTALHDVRFVEDD 131

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WESPTLGAWGLGWECWCDGME+SQFTYFQQV G+EC+P++GE+TYGLERLAMYVQ ++ V
Sbjct: 132 WESPTLGAWGLGWECWCDGMEVSQFTYFQQVAGVECAPVAGELTYGLERLAMYVQGIDRV 191

Query: 185 YDIVFNAIEG-QNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIP 243
           YD+ FN  +G   V YGD+F Q+E+EYS++NFE A+ ++L   F  +E  C   L  G  
Sbjct: 192 YDLNFNGRDGDDKVTYGDVFLQAEKEYSKHNFEVADTDMLFEQFKMAEAACKKYLDAGWS 251

Query: 244 NEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTP 303
           +     HL   PAYDQCIKASH+FNLLDARGVIS TERQ YILR+R LAKACGEA++ T 
Sbjct: 252 DGKREAHLMALPAYDQCIKASHVFNLLDARGVISVTERQSYILRVRELAKACGEAWVHTE 311

Query: 304 NG 305
            G
Sbjct: 312 AG 313


>gi|109896341|ref|YP_659596.1| glycyl-tRNA synthetase subunit alpha [Pseudoalteromonas atlantica
           T6c]
 gi|332304395|ref|YP_004432246.1| glycyl-tRNA synthetase, alpha subunit [Glaciecola agarilytica
           4H-3-7+YE-5]
 gi|122972457|sp|Q15ZY9|SYGA_PSEA6 RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|109698622|gb|ABG38542.1| glycyl-tRNA synthetase alpha chain [Pseudoalteromonas atlantica
           T6c]
 gi|332171724|gb|AEE20978.1| glycyl-tRNA synthetase, alpha subunit [Glaciecola agarilytica
           4H-3-7+YE-5]
          Length = 301

 Score =  566 bits (1460), Expect = e-159,   Method: Composition-based stats.
 Identities = 186/300 (62%), Positives = 227/300 (75%), Gaps = 10/300 (3%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
            NK +  +FQ +IL+L  YWA+QGC I+QP DMEVGAGTFHP T LR++GP    +AYVQ
Sbjct: 1   MNKFDSKTFQGLILSLQDYWARQGCVIIQPLDMEVGAGTFHPMTFLRSIGPEPISSAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           P RRP DGRY ENPNRLQHYYQFQV++KP+P N+Q LY+ SLK +G DPL+HD+RFVEDN
Sbjct: 61  PCRRPTDGRYGENPNRLQHYYQFQVMLKPSPSNIQELYLGSLKELGFDPLVHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WESPTLGAWGLGWE W +GME++QFTYFQQV GIECSP++GEITYGLERLAMY+Q V+S+
Sbjct: 121 WESPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGIECSPVTGEITYGLERLAMYIQGVDSI 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V+       V YGD+F Q+E E S YNFEYA+ + L   F   EKE   +++ G+P 
Sbjct: 181 YDLVWTDGPMGKVTYGDVFHQNEVEQSTYNFEYADVDALFGMFDHCEKESQKMIEAGLP- 239

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY+Q +KASH FNLLDAR  IS TERQRYILR+R+L+KAC EA+     
Sbjct: 240 ---------LPAYEQVMKASHAFNLLDARHAISVTERQRYILRVRTLSKACAEAYYQARE 290


>gi|90425821|ref|YP_534191.1| glycyl-tRNA synthetase subunit alpha [Rhodopseudomonas palustris
           BisB18]
 gi|123394771|sp|Q20YB4|SYGA_RHOPB RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|90107835|gb|ABD89872.1| Glycine--tRNA ligase [Rhodopseudomonas palustris BisB18]
          Length = 318

 Score =  566 bits (1459), Expect = e-159,   Method: Composition-based stats.
 Identities = 202/296 (68%), Positives = 239/296 (80%), Gaps = 1/296 (0%)

Query: 12  SFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPLD 71
           SFQ +IL L +YWA  GC ILQPYDMEVGAGTFHP+TTLRALGP  W+AAYVQPSRRP D
Sbjct: 6   SFQGLILALQRYWADYGCVILQPYDMEVGAGTFHPATTLRALGPKPWRAAYVQPSRRPKD 65

Query: 72  GRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTLG 131
           GRY ENPNRLQHYYQFQVI+KP+P ++Q LY++SL A+G+D  +HD+RFVED+WESPTLG
Sbjct: 66  GRYGENPNRLQHYYQFQVILKPSPPDIQELYLKSLAAIGVDSHLHDIRFVEDDWESPTLG 125

Query: 132 AWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFNA 191
           AWGLGWECWCDGME+SQFTYFQQV G+EC+P++GE+TYGLERLAMYVQ V+ VYD+ FN 
Sbjct: 126 AWGLGWECWCDGMEVSQFTYFQQVAGVECAPVAGELTYGLERLAMYVQGVDRVYDLNFNG 185

Query: 192 IEG-QNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHH 250
            +G   V YGD+F Q+E+EYSR+NFE+++  +L   F  +E  C   L  G  ++    H
Sbjct: 186 RDGADKVTYGDVFLQAEKEYSRHNFEHSDAAMLFEQFKMAESACQKYLAAGWDSDKREAH 245

Query: 251 LCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNGG 306
           L   PAYDQCIKASH FNLLDARGVIS TERQ YILR+R LAKACG A+L T  GG
Sbjct: 246 LMALPAYDQCIKASHAFNLLDARGVISVTERQSYILRVRELAKACGAAWLHTEAGG 301


>gi|209548135|ref|YP_002280052.1| glycyl-tRNA synthetase subunit alpha [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|238064844|sp|B5ZS33|SYGA_RHILW RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|209533891|gb|ACI53826.1| glycyl-tRNA synthetase, alpha subunit [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 311

 Score =  566 bits (1459), Expect = e-159,   Method: Composition-based stats.
 Identities = 226/303 (74%), Positives = 259/303 (85%), Gaps = 3/303 (0%)

Query: 7   KKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPS 66
                SFQ +ILTL  YWA +GC +LQPYDMEVGAGTFHP+TTLRALGP  WKAAYVQPS
Sbjct: 1   MNPKRSFQALILTLHSYWADKGCAVLQPYDMEVGAGTFHPATTLRALGPKPWKAAYVQPS 60

Query: 67  RRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWE 126
           RRP DGRY ENPNRLQHYYQ+QVI+KPNP NLQ LY+ SL A+G+DPL+HD+RFVED+WE
Sbjct: 61  RRPSDGRYGENPNRLQHYYQYQVILKPNPPNLQELYLGSLAAIGLDPLLHDIRFVEDDWE 120

Query: 127 SPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYD 186
           SPTLGAWGLGWECWCDGME+SQFTYFQQVCGIEC+P++GE+TYGLERLAMYVQ V++VYD
Sbjct: 121 SPTLGAWGLGWECWCDGMEVSQFTYFQQVCGIECAPVAGELTYGLERLAMYVQGVDNVYD 180

Query: 187 IVFNAIEGQ-NVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIP-- 243
           + FN  EG   + YGD+F Q+EQEYSR+NFE+AN E+LH HF+D+EKEC  LL  G P  
Sbjct: 181 LNFNGREGDEKISYGDVFLQAEQEYSRHNFEFANTEMLHRHFVDAEKECRALLDAGAPAD 240

Query: 244 NEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTP 303
           N + R H CVFPAYDQCIKASH+FNLLDARGVIS TERQ YILR+R+LAKACGEAFL+T 
Sbjct: 241 NANQRLHKCVFPAYDQCIKASHVFNLLDARGVISVTERQSYILRVRTLAKACGEAFLLTD 300

Query: 304 NGG 306
            GG
Sbjct: 301 AGG 303


>gi|304309659|ref|YP_003809257.1| Glycyl-tRNA synthetase alpha-chain [gamma proteobacterium HdN1]
 gi|301795392|emb|CBL43590.1| Glycyl-tRNA synthetase alpha-chain [gamma proteobacterium HdN1]
          Length = 317

 Score =  566 bits (1459), Expect = e-159,   Method: Composition-based stats.
 Identities = 181/300 (60%), Positives = 227/300 (75%), Gaps = 10/300 (3%)

Query: 4   IHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYV 63
             +K +  +FQ +IL L  YWA +GC I+QP D+EVGAGTFHP+T LRA+GP +W AAYV
Sbjct: 2   TQHKHDTRTFQGLILALQSYWASKGCVIIQPLDLEVGAGTFHPATFLRAIGPETWSAAYV 61

Query: 64  QPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVED 123
           QPSRRP DGRY ENPNRLQHYYQFQV++KP+P ++Q LY+ESL+ +GIDP +HD+RFVED
Sbjct: 62  QPSRRPTDGRYGENPNRLQHYYQFQVVLKPSPDDIQALYLESLETLGIDPRVHDIRFVED 121

Query: 124 NWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNS 183
           NWESPTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLER+AMY+Q V+S
Sbjct: 122 NWESPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECFPVTGEITYGLERVAMYLQGVDS 181

Query: 184 VYDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIP 243
           VYD+V+       V YGD+F Q+E E S++NFE AN E+L + F   EKEC  L+   +P
Sbjct: 182 VYDLVWAEGPFGKVTYGDVFLQNEIEMSKFNFECANVEMLLSQFDFYEKECNKLIDTKLP 241

Query: 244 NEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTP 303
                      PAY+  +K SH FNLLDAR  IS TERQRYILR+R++A+A  EA+    
Sbjct: 242 ----------LPAYEYVLKCSHTFNLLDARRAISVTERQRYILRVRTMARAVAEAYFEAR 291


>gi|150395688|ref|YP_001326155.1| glycyl-tRNA synthetase subunit alpha [Sinorhizobium medicae WSM419]
 gi|150027203|gb|ABR59320.1| glycyl-tRNA synthetase, alpha subunit [Sinorhizobium medicae
           WSM419]
          Length = 320

 Score =  566 bits (1459), Expect = e-159,   Method: Composition-based stats.
 Identities = 227/304 (74%), Positives = 263/304 (86%), Gaps = 3/304 (0%)

Query: 6   NKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQP 65
           +     SFQ +ILTL  YWA +GC +LQPYDMEVGAGTFHP+TTLRALGP  W+AAYVQP
Sbjct: 9   HMNPKRSFQALILTLHNYWADKGCAVLQPYDMEVGAGTFHPATTLRALGPKPWRAAYVQP 68

Query: 66  SRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNW 125
           SRRP DGRY ENPNRLQHYYQ+QVI+KPNP NLQ LY+ SL+A+G+DPL+HD+RFVED+W
Sbjct: 69  SRRPTDGRYGENPNRLQHYYQYQVILKPNPSNLQELYLGSLEAIGLDPLLHDIRFVEDDW 128

Query: 126 ESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVY 185
           ESPTLGAWGLGWECWCDGME+SQFTYFQQVCGIECSP+SGE+TYGLERLAMYVQ V++VY
Sbjct: 129 ESPTLGAWGLGWECWCDGMEVSQFTYFQQVCGIECSPVSGELTYGLERLAMYVQGVDNVY 188

Query: 186 DIVFNAIEG-QNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           D+ FN  +G + + YGD+F Q+EQEYSR+NFEYAN  +LH HFID+EKECL LL  G P 
Sbjct: 189 DLNFNGRDGAEKISYGDVFLQAEQEYSRHNFEYANTAMLHQHFIDAEKECLALLAAGAPG 248

Query: 245 E--HHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMT 302
           +  ++R H CVFPAYDQCIKASH+FNLLDARGVIS TERQ YILR+R+LAKACGEAFL+T
Sbjct: 249 DASNNRLHRCVFPAYDQCIKASHVFNLLDARGVISVTERQSYILRVRTLAKACGEAFLLT 308

Query: 303 PNGG 306
             GG
Sbjct: 309 DAGG 312


>gi|332968465|gb|EGK07531.1| glycyl-tRNA synthetase alpha subunit [Psychrobacter sp. 1501(2011)]
          Length = 317

 Score =  566 bits (1459), Expect = e-159,   Method: Composition-based stats.
 Identities = 183/294 (62%), Positives = 226/294 (76%), Gaps = 10/294 (3%)

Query: 11  LSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPL 70
           ++FQ +ILTL  YWA++GC +LQPYDMEVGAGTFH +T LR+LGP +W AAYVQPSRRP 
Sbjct: 1   MTFQQLILTLQTYWAEKGCVVLQPYDMEVGAGTFHTATFLRSLGPEAWNAAYVQPSRRPT 60

Query: 71  DGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTL 130
           DGRY  NPNRLQHYYQFQV++KPNP N+Q LY+ SL+A+GID L HDVRFVEDNWESPTL
Sbjct: 61  DGRYGNNPNRLQHYYQFQVVMKPNPPNIQELYLGSLEAIGIDTLTHDVRFVEDNWESPTL 120

Query: 131 GAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFN 190
           GAWGLGWE W +GME++QFTYFQQV GIEC P++GEITYGLERLAMY+Q V+SVYD+V+ 
Sbjct: 121 GAWGLGWEVWLNGMEVTQFTYFQQVGGIECFPVTGEITYGLERLAMYIQGVDSVYDLVWT 180

Query: 191 AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHH 250
             E   V YGD+F Q+E E S YNFEYA+   + + F   E++   L++ G+P       
Sbjct: 181 DGEFGKVTYGDVFHQNEVEQSTYNFEYADVPKMFDLFDFYEQQADKLVEAGLP------- 233

Query: 251 LCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
               PAY+  +KASH FNLLDARG IS TERQR+ILR+R+LA+   + ++    
Sbjct: 234 ---LPAYEMVLKASHTFNLLDARGAISVTERQRFILRVRTLARKVAQGYVQARA 284


>gi|23013834|ref|ZP_00053689.1| COG0752: Glycyl-tRNA synthetase, alpha subunit [Magnetospirillum
           magnetotacticum MS-1]
          Length = 294

 Score =  566 bits (1459), Expect = e-159,   Method: Composition-based stats.
 Identities = 204/303 (67%), Positives = 242/303 (79%), Gaps = 15/303 (4%)

Query: 1   MAPIHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKA 60
           M  +  KK   SFQ++ILTL  +WA+QGC ILQPYDMEVGAGTFHP+TTLRALGP  WK 
Sbjct: 1   MGNVGTKKP--SFQSLILTLQAFWAEQGCVILQPYDMEVGAGTFHPATTLRALGPDHWKC 58

Query: 61  AYVQPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRF 120
           AYVQPSRRP DGRY ENPNRLQHYYQ+QV++KP+P N Q LY+ESLK +GIDPL HD+RF
Sbjct: 59  AYVQPSRRPKDGRYGENPNRLQHYYQYQVLLKPSPPNAQELYLESLKRLGIDPLAHDIRF 118

Query: 121 VEDNWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQN 180
           VED+WESPTLGAWGLGWE WCDGME++QFTYFQQV GIEC P++ E+TYGLERLAMY+Q 
Sbjct: 119 VEDDWESPTLGAWGLGWEVWCDGMEVTQFTYFQQVGGIECDPVAVELTYGLERLAMYIQG 178

Query: 181 VNSVYDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKK 240
           V +VYD+ FN   G  V YGD+F Q+E+EYS +NFE+A+ ++L  HF+D+E EC +LL K
Sbjct: 179 VENVYDLDFN---GDGVTYGDVFLQAEREYSAHNFEHADTDMLLQHFLDAETECKNLLDK 235

Query: 241 GIPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFL 300
           G+            PAYDQCIKASH FNLLDARGVIS TERQ YI R+R+LAKAC E +L
Sbjct: 236 GV----------ALPAYDQCIKASHRFNLLDARGVISVTERQAYIGRVRALAKACCEGWL 285

Query: 301 MTP 303
            + 
Sbjct: 286 ASR 288


>gi|291612939|ref|YP_003523096.1| glycyl-tRNA synthetase, subunit alpha [Sideroxydans lithotrophicus
           ES-1]
 gi|291583051|gb|ADE10709.1| glycyl-tRNA synthetase, alpha subunit [Sideroxydans lithotrophicus
           ES-1]
          Length = 320

 Score =  566 bits (1459), Expect = e-159,   Method: Composition-based stats.
 Identities = 169/294 (57%), Positives = 219/294 (74%), Gaps = 10/294 (3%)

Query: 12  SFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPLD 71
           +FQ +ILTL Q+W +QGC +LQPYD+EVGAGTFH +T LRA+GP  W+AAYVQPSRRP D
Sbjct: 25  TFQQVILTLQQFWDKQGCALLQPYDIEVGAGTFHTATFLRAIGPEPWRAAYVQPSRRPKD 84

Query: 72  GRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTLG 131
           GRY ENPNRLQHYYQ+QV++KP+P N+Q LY++SL+A+GID   HD+RFVED+WESPTLG
Sbjct: 85  GRYGENPNRLQHYYQYQVVLKPSPDNIQELYLDSLRALGIDTGEHDIRFVEDDWESPTLG 144

Query: 132 AWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFNA 191
           AWGLGWE W DGME++QFTYFQ+V  + C P+ GEITYGLERLAMY+Q V +V+D+V+  
Sbjct: 145 AWGLGWEVWLDGMEVTQFTYFQEVGSLTCKPVLGEITYGLERLAMYLQGVENVFDLVWAK 204

Query: 192 IEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHHL 251
                + YGD++ Q+E E S+YNFE++N E+L  HF + E E   L+  G+P        
Sbjct: 205 NGDTVITYGDVYHQNEVEQSKYNFEHSNVEMLFRHFNEYEGEAKRLMDAGLP-------- 256

Query: 252 CVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNG 305
              P ++  +K SH FNLLDARG IS TER  YI R+R+LA+   +A+  +   
Sbjct: 257 --LPGFEMVMKCSHTFNLLDARGAISVTERAAYIGRVRALARQVAQAYYDSREA 308


>gi|212711579|ref|ZP_03319707.1| hypothetical protein PROVALCAL_02654 [Providencia alcalifaciens DSM
           30120]
 gi|212685681|gb|EEB45209.1| hypothetical protein PROVALCAL_02654 [Providencia alcalifaciens DSM
           30120]
          Length = 302

 Score =  566 bits (1459), Expect = e-159,   Method: Composition-based stats.
 Identities = 188/301 (62%), Positives = 221/301 (73%), Gaps = 8/301 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +ILTL  YWA+QGCTI+QP DMEVGAGT HP T LRALGP    AAYVQ
Sbjct: 1   MQKFDTKTFQGLILTLQDYWARQGCTIVQPLDMEVGAGTSHPMTCLRALGPEPIAAAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQVIIKP+P N+Q LY+ SLK +GIDP +HD+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVIIKPSPDNIQELYLGSLKELGIDPTVHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLERLAMY+Q V+SV
Sbjct: 121 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGLERLAMYIQGVDSV 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V+         YGDI+ Q+E E S YNFE+AN E L   F + EKE   LL    P 
Sbjct: 181 YDLVWCDGPLGKTTYGDIYHQNEVEQSTYNFEHANVEFLFKCFEEYEKEAQYLLALETP- 239

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY++ +KA+H FNLLDAR  IS TERQRYILRIR+L K   EA+  +  
Sbjct: 240 -------LPLPAYERILKAAHTFNLLDARKAISVTERQRYILRIRTLTKGVAEAYYASRE 292

Query: 305 G 305
            
Sbjct: 293 A 293


>gi|15964604|ref|NP_384957.1| glycyl-tRNA synthetase subunit alpha [Sinorhizobium meliloti 1021]
 gi|25009315|sp|Q92RL5|SYGA_RHIME RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|15073782|emb|CAC45423.1| Probable glycyl-tRNA synthetase alpha chain [Sinorhizobium meliloti
           1021]
          Length = 311

 Score =  566 bits (1459), Expect = e-159,   Method: Composition-based stats.
 Identities = 228/303 (75%), Positives = 262/303 (86%), Gaps = 3/303 (0%)

Query: 7   KKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPS 66
                SFQ +ILTL  YWA +GC +LQPYDMEVGAGTFHP+TTLRALGP  W+AAYVQPS
Sbjct: 1   MNPKRSFQALILTLHNYWADKGCAVLQPYDMEVGAGTFHPATTLRALGPKPWRAAYVQPS 60

Query: 67  RRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWE 126
           RRP DGRY ENPNRLQHYYQ+QVI+KPNP NLQ LY+ SL+A+G+DPL+HD+RFVED+WE
Sbjct: 61  RRPTDGRYGENPNRLQHYYQYQVILKPNPSNLQELYLGSLEAIGLDPLLHDIRFVEDDWE 120

Query: 127 SPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYD 186
           SPTLGAWGLGWECWCDGME+SQFTYFQQVCGIECSP+SGE+TYGLERLAMYVQ V++VYD
Sbjct: 121 SPTLGAWGLGWECWCDGMEVSQFTYFQQVCGIECSPVSGELTYGLERLAMYVQGVDNVYD 180

Query: 187 IVFNAIEG-QNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNE 245
           + FN  EG + + YGD+F Q+EQEYSR+NFEYAN  +LH HFID+EKECL LL  G P +
Sbjct: 181 LNFNGREGAEKISYGDVFLQAEQEYSRHNFEYANTAMLHQHFIDAEKECLALLAAGAPGD 240

Query: 246 --HHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTP 303
             ++R H CVFPAYDQCIKASH+FNLLDARGVIS TERQ YILR+R+LAKACGEAFL+T 
Sbjct: 241 SSNNRLHKCVFPAYDQCIKASHVFNLLDARGVISVTERQSYILRVRTLAKACGEAFLLTE 300

Query: 304 NGG 306
            GG
Sbjct: 301 AGG 303


>gi|121602247|ref|YP_988700.1| glycyl-tRNA synthetase subunit alpha [Bartonella bacilliformis
           KC583]
 gi|120614424|gb|ABM45025.1| glycyl-tRNA synthetase, alpha subunit [Bartonella bacilliformis
           KC583]
          Length = 316

 Score =  566 bits (1459), Expect = e-159,   Method: Composition-based stats.
 Identities = 225/306 (73%), Positives = 255/306 (83%), Gaps = 1/306 (0%)

Query: 1   MAPIHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKA 60
           M    +     SFQ +ILTL  YWA  GC ILQPYDMEVGAGTFHP+TTLR+LGP  WKA
Sbjct: 1   MNLSEHLNPTHSFQGLILTLQSYWAHYGCAILQPYDMEVGAGTFHPATTLRSLGPRPWKA 60

Query: 61  AYVQPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRF 120
           AYVQPSRRP DGRY +NPNRLQHYYQFQVIIKP+P NLQ LYI SLKA+G+D  +HD+RF
Sbjct: 61  AYVQPSRRPTDGRYGKNPNRLQHYYQFQVIIKPSPPNLQELYINSLKAIGLDTNLHDIRF 120

Query: 121 VEDNWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQN 180
           VED+WESPTLGAWGLGWECWCDGMEISQFTYFQ+VCGIEC+P+SGEITYGLERLAMY+Q 
Sbjct: 121 VEDDWESPTLGAWGLGWECWCDGMEISQFTYFQKVCGIECAPVSGEITYGLERLAMYIQG 180

Query: 181 VNSVYDIVFNAIEG-QNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLK 239
           V++VYD+ FN +EG   + YGDIF Q+EQEYS YNFE+AN E LH HFID+E+EC+ LL+
Sbjct: 181 VDNVYDLNFNGLEGEDRISYGDIFLQAEQEYSHYNFEFANTEFLHQHFIDAERECITLLE 240

Query: 240 KGIPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAF 299
            G PN+    HLCV PAYDQCIKASHIFNLL ARGVIS TERQ YILR+R LA+ CGEAF
Sbjct: 241 AGKPNKEGDFHLCVLPAYDQCIKASHIFNLLQARGVISVTERQNYILRVRDLARRCGEAF 300

Query: 300 LMTPNG 305
           L+T  G
Sbjct: 301 LLTEAG 306


>gi|262375082|ref|ZP_06068316.1| glycyl-tRNA synthetase, alpha subunit [Acinetobacter lwoffii SH145]
 gi|262310095|gb|EEY91224.1| glycyl-tRNA synthetase, alpha subunit [Acinetobacter lwoffii SH145]
          Length = 327

 Score =  565 bits (1458), Expect = e-159,   Method: Composition-based stats.
 Identities = 188/293 (64%), Positives = 228/293 (77%), Gaps = 10/293 (3%)

Query: 12  SFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPLD 71
           +FQ +IL L  YWA+QGC ILQPYDME+GAGTFH +T LRALGP +W AAYVQPSRRP D
Sbjct: 10  TFQGLILALQTYWAEQGCVILQPYDMEMGAGTFHTATFLRALGPETWNAAYVQPSRRPKD 69

Query: 72  GRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTLG 131
           GRY ENPNRLQHYYQFQV++KPNP N+Q LY++SLKA+GIDPL+HD+RFVEDNWESPTLG
Sbjct: 70  GRYGENPNRLQHYYQFQVVLKPNPDNIQQLYLDSLKAIGIDPLVHDIRFVEDNWESPTLG 129

Query: 132 AWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFNA 191
           AWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLERLAMY+Q V+SVYD+V+  
Sbjct: 130 AWGLGWEVWLNGMEVTQFTYFQQVGGVECYPVTGEITYGLERLAMYLQGVDSVYDLVWTK 189

Query: 192 IEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHHL 251
            +   V YGD+F Q+E E S YNFEYAN E +   F   E E   L++  +P        
Sbjct: 190 GQFGTVTYGDVFHQNEVEQSTYNFEYANVEKMFELFDFYEAEATRLIEAKLP-------- 241

Query: 252 CVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
              PAY+Q +KASH FNLLDARG IS TERQRYILR+R+LA++   +++    
Sbjct: 242 --LPAYEQVVKASHSFNLLDARGAISVTERQRYILRVRTLARSIATSYVAARA 292


>gi|325292021|ref|YP_004277885.1| glycyl-tRNA synthetase alpha chain [Agrobacterium sp. H13-3]
 gi|325059874|gb|ADY63565.1| glycyl-tRNA synthetase alpha chain [Agrobacterium sp. H13-3]
          Length = 320

 Score =  565 bits (1458), Expect = e-159,   Method: Composition-based stats.
 Identities = 228/313 (72%), Positives = 267/313 (85%), Gaps = 7/313 (2%)

Query: 1   MAPIHNKKNDLS----FQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPL 56
           M  + +  + ++    FQ +ILTL  YWA +GC +LQPYDMEVGAGTFHP+TTLRALGP 
Sbjct: 1   MTAMTDIPDHMNPKRSFQALILTLHNYWADKGCAVLQPYDMEVGAGTFHPATTLRALGPK 60

Query: 57  SWKAAYVQPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIH 116
            WKAAYVQPSRRP DGRY ENPNRLQHYYQ+QVI+KPNP NLQ LY+ SLKA+G+DPL+H
Sbjct: 61  PWKAAYVQPSRRPSDGRYGENPNRLQHYYQYQVILKPNPSNLQELYLGSLKAIGLDPLLH 120

Query: 117 DVRFVEDNWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAM 176
           DVRFVED+WESPTLGAWGLGWECWCDGME+SQFTYFQQVCGIECSP++GE+TYGLERLAM
Sbjct: 121 DVRFVEDDWESPTLGAWGLGWECWCDGMEVSQFTYFQQVCGIECSPVAGELTYGLERLAM 180

Query: 177 YVQNVNSVYDIVFNAIEG-QNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECL 235
           YVQ V++VYD+ FN  EG + + YGD+F Q+EQEYSR+NFE+A+  +LH HFID+EKECL
Sbjct: 181 YVQGVDNVYDLNFNGREGEEKISYGDVFLQAEQEYSRHNFEFADTGMLHRHFIDAEKECL 240

Query: 236 DLLKKGIP--NEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAK 293
            LL  G P  +++ R H CVFPAYDQCIKASH+FNLLDARGVIS TERQ YILR+R+LAK
Sbjct: 241 ALLAAGAPGDDDNQRLHKCVFPAYDQCIKASHVFNLLDARGVISVTERQSYILRVRTLAK 300

Query: 294 ACGEAFLMTPNGG 306
           ACGEAFL+T  GG
Sbjct: 301 ACGEAFLLTDAGG 313


>gi|262370017|ref|ZP_06063344.1| glycyl-tRNA synthetase subunit alpha [Acinetobacter johnsonii
           SH046]
 gi|262315056|gb|EEY96096.1| glycyl-tRNA synthetase subunit alpha [Acinetobacter johnsonii
           SH046]
          Length = 329

 Score =  565 bits (1458), Expect = e-159,   Method: Composition-based stats.
 Identities = 187/293 (63%), Positives = 227/293 (77%), Gaps = 10/293 (3%)

Query: 12  SFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPLD 71
           +FQ +IL L  YWA+QGC ILQPYDME+GAGTFH +T LRALGP +W AAYVQPSRRP D
Sbjct: 10  TFQGLILALQNYWAEQGCVILQPYDMEMGAGTFHTATFLRALGPETWNAAYVQPSRRPKD 69

Query: 72  GRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTLG 131
           GRY ENPNRLQHYYQFQV++KPNP N+Q LY++SL+A+GID L HD+RFVEDNWESPTLG
Sbjct: 70  GRYGENPNRLQHYYQFQVVLKPNPDNIQQLYLDSLEAIGIDTLTHDIRFVEDNWESPTLG 129

Query: 132 AWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFNA 191
           AWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLERLAMY+Q V+SVYD+V+  
Sbjct: 130 AWGLGWEVWLNGMEVTQFTYFQQVGGVECYPVTGEITYGLERLAMYLQGVDSVYDLVWTK 189

Query: 192 IEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHHL 251
            +   V YGD+F Q+E E S YNFEYAN E +   F   E E   L++  +P        
Sbjct: 190 GQFGTVTYGDVFHQNEVEQSTYNFEYANVEKMFELFDFYEAEATRLMEAELP-------- 241

Query: 252 CVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
              PAY+Q IKASH FNLLDARG IS TERQRYILR+R+LA++  ++++    
Sbjct: 242 --LPAYEQVIKASHSFNLLDARGAISVTERQRYILRVRTLARSIAQSYVAARA 292


>gi|114561195|ref|YP_748708.1| glycyl-tRNA synthetase subunit alpha [Shewanella frigidimarina
           NCIMB 400]
 gi|122301219|sp|Q08A45|SYGA_SHEFN RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|114332488|gb|ABI69870.1| Glycine--tRNA ligase [Shewanella frigidimarina NCIMB 400]
          Length = 301

 Score =  565 bits (1457), Expect = e-159,   Method: Composition-based stats.
 Identities = 186/302 (61%), Positives = 224/302 (74%), Gaps = 8/302 (2%)

Query: 4   IHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYV 63
           +  K +  +FQ  ILTL +YWAQQGC I+QP DMEVGAGTFHP T LR+LGP    +AYV
Sbjct: 1   MTTKHDVKTFQGFILTLQEYWAQQGCAIVQPLDMEVGAGTFHPQTFLRSLGPEPMSSAYV 60

Query: 64  QPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVED 123
           QPSRRP DGRY ENPNRLQHYYQFQV++KP+P N+Q LY+ SL+A+GID  +HD+RFVED
Sbjct: 61  QPSRRPTDGRYGENPNRLQHYYQFQVVLKPSPDNIQELYLGSLEALGIDTKVHDIRFVED 120

Query: 124 NWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNS 183
           NWESPTLGAWGLGWE W +GME++QFTYFQQV GIECSP++GEITYGLERLAMY+Q V+S
Sbjct: 121 NWESPTLGAWGLGWEIWLNGMEVTQFTYFQQVGGIECSPVTGEITYGLERLAMYIQEVDS 180

Query: 184 VYDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIP 243
           VYD+V+       V YGDIF Q+E E S YNFE+A+ + +   F   EK C+ LL    P
Sbjct: 181 VYDLVWTDGPLGRVTYGDIFHQNEVEQSTYNFEHADVDFMFTLFDQCEKMCMHLLSLEKP 240

Query: 244 NEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTP 303
                      PAY+Q +KASH FNLLDAR  IS TERQRYILR+R++AK   E++    
Sbjct: 241 --------LPLPAYEQVMKASHAFNLLDARHAISVTERQRYILRVRTMAKGVAESYYQAR 292

Query: 304 NG 305
             
Sbjct: 293 EA 294


>gi|24371615|ref|NP_715657.1| glycyl-tRNA synthetase subunit alpha [Shewanella oneidensis MR-1]
 gi|113968355|ref|YP_732148.1| glycyl-tRNA synthetase subunit alpha [Shewanella sp. MR-4]
 gi|114045522|ref|YP_736072.1| glycyl-tRNA synthetase subunit alpha [Shewanella sp. MR-7]
 gi|117918476|ref|YP_867668.1| glycyl-tRNA synthetase subunit alpha [Shewanella sp. ANA-3]
 gi|120596840|ref|YP_961414.1| glycyl-tRNA synthetase subunit alpha [Shewanella sp. W3-18-1]
 gi|146291118|ref|YP_001181542.1| glycyl-tRNA synthetase subunit alpha [Shewanella putrefaciens
           CN-32]
 gi|30316225|sp|Q8EKS5|SYGA_SHEON RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|123030118|sp|Q0HPC6|SYGA_SHESM RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|123031070|sp|Q0I0U0|SYGA_SHESR RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|166200193|sp|A4Y1B0|SYGA_SHEPC RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|166200194|sp|A0KR43|SYGA_SHESA RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|166200569|sp|A1RDW5|SYGA_SHESW RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|24345368|gb|AAN53102.1|AE015453_4 glycyl-tRNA synthetase, alpha subunit [Shewanella oneidensis MR-1]
 gi|113883039|gb|ABI37091.1| glycyl-tRNA synthetase, alpha subunit [Shewanella sp. MR-4]
 gi|113886964|gb|ABI41015.1| glycyl-tRNA synthetase, alpha subunit [Shewanella sp. MR-7]
 gi|117610808|gb|ABK46262.1| glycyl-tRNA synthetase, alpha subunit [Shewanella sp. ANA-3]
 gi|120556933|gb|ABM22860.1| Glycine--tRNA ligase [Shewanella sp. W3-18-1]
 gi|145562808|gb|ABP73743.1| Glycine--tRNA ligase [Shewanella putrefaciens CN-32]
 gi|319424424|gb|ADV52498.1| glycyl-tRNA synthetase, alpha subunit [Shewanella putrefaciens 200]
          Length = 301

 Score =  565 bits (1457), Expect = e-159,   Method: Composition-based stats.
 Identities = 185/302 (61%), Positives = 224/302 (74%), Gaps = 8/302 (2%)

Query: 4   IHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYV 63
           +  K +  +FQ  ILTL +YWAQQGC I+QP DMEVGAGTFHP T LR+LGP    +AYV
Sbjct: 1   MTTKHDVKTFQGFILTLQEYWAQQGCAIVQPLDMEVGAGTFHPQTFLRSLGPEPMSSAYV 60

Query: 64  QPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVED 123
           QPSRRP DGRY ENPNRLQHYYQFQV++KP+P N+Q LY+ SL+A+GID  IHD+RFVED
Sbjct: 61  QPSRRPTDGRYGENPNRLQHYYQFQVVLKPSPDNIQELYLGSLQALGIDTQIHDIRFVED 120

Query: 124 NWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNS 183
           NWESPTLGAWGLGWE W +GME++QFTYFQQV G+ECSP++GEITYGLERLAMY+Q V+S
Sbjct: 121 NWESPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECSPVTGEITYGLERLAMYIQGVDS 180

Query: 184 VYDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIP 243
           VYD+V+       + YGD+F Q+E E S YNFE+A+ + +   F   EK C  LL    P
Sbjct: 181 VYDLVWTDGPMGRITYGDVFHQNEVEQSTYNFEHADVDFMFALFDQCEKMCQHLLSLEKP 240

Query: 244 NEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTP 303
                      PAY+Q +KASH FNLLDAR  IS TERQRYILR+R++AKA  E++    
Sbjct: 241 --------LPLPAYEQVMKASHAFNLLDARHAISVTERQRYILRVRTMAKAVAESYYQAR 292

Query: 304 NG 305
             
Sbjct: 293 EA 294


>gi|148253847|ref|YP_001238432.1| glycyl-tRNA synthetase subunit alpha [Bradyrhizobium sp. BTAi1]
 gi|146406020|gb|ABQ34526.1| glycyl-tRNA synthetase alpha chain [Bradyrhizobium sp. BTAi1]
          Length = 315

 Score =  565 bits (1457), Expect = e-159,   Method: Composition-based stats.
 Identities = 207/307 (67%), Positives = 245/307 (79%), Gaps = 5/307 (1%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
            + + + SFQ  IL L ++WA+QGC ILQPYDME+GAGTFHP+TTLRALGP  W AAYVQ
Sbjct: 6   QHMRPERSFQGFILALQRFWAEQGCVILQPYDMEMGAGTFHPATTLRALGPKPWNAAYVQ 65

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNR+QHYYQFQVI+KP+P NLQ LY++SL A+GID  +HD+RFVED+
Sbjct: 66  PSRRPKDGRYGENPNRMQHYYQFQVIMKPSPPNLQELYLKSLGAIGIDAAVHDIRFVEDD 125

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WESPTLGAWGLGWECWCDGME+SQFTYFQQV G EC+P++GE+TYGLERLAMYVQ V+ V
Sbjct: 126 WESPTLGAWGLGWECWCDGMEVSQFTYFQQVAGFECAPVAGELTYGLERLAMYVQGVDRV 185

Query: 185 YDIVFNAIEGQ-NVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIP 243
           YD+ FN  +G   V YGD+F Q+EQEYSR+NFE+A+ E+L   F  +E  C   L  G  
Sbjct: 186 YDLNFNGRDGDAKVTYGDVFLQAEQEYSRHNFEHADTEMLFEQFKMAEGACRKYLAAGWQ 245

Query: 244 NE----HHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAF 299
           +     + + HL   PAYDQCIKASH+FNLLDARGVIS TERQ YILR+R LAKACGEA+
Sbjct: 246 DNSKLGNRKEHLMALPAYDQCIKASHVFNLLDARGVISVTERQSYILRVRELAKACGEAW 305

Query: 300 LMTPNGG 306
           L T  GG
Sbjct: 306 LHTEAGG 312


>gi|300719082|ref|YP_003743885.1| glycyl-tRNA synthetase alpha chain [Erwinia billingiae Eb661]
 gi|299064918|emb|CAX62038.1| Glycyl-tRNA synthetase alpha chain [Erwinia billingiae Eb661]
          Length = 304

 Score =  565 bits (1457), Expect = e-159,   Method: Composition-based stats.
 Identities = 188/301 (62%), Positives = 221/301 (73%), Gaps = 8/301 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +ILTL  YWA+QGCTI+QP DMEVGAGT HP T LRALGP    AAYVQ
Sbjct: 1   MQKFDTKTFQGLILTLQDYWARQGCTIVQPLDMEVGAGTSHPMTCLRALGPEPIAAAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQVIIKP+P N+Q LY+ SLK +G+DP IHD+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVIIKPSPDNIQELYLGSLKELGMDPTIHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLERLAMY+Q V+SV
Sbjct: 121 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGMECKPVTGEITYGLERLAMYIQGVDSV 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V++        YGD+F Q+E E S YNFEYA+ + L   F   EKE   LL    P 
Sbjct: 181 YDLVWSDGPLGTTTYGDVFHQNEVEQSTYNFEYADVDFLFTCFEQYEKEAQSLLALEKP- 239

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY++ +KA H FNLLDAR  IS TERQRYILRIR+L KA  EA+  +  
Sbjct: 240 -------LPLPAYERILKAGHTFNLLDARKAISVTERQRYILRIRTLTKAVAEAYYASRE 292

Query: 305 G 305
            
Sbjct: 293 A 293


>gi|254491269|ref|ZP_05104450.1| glycyl-tRNA synthetase, alpha subunit [Methylophaga thiooxidans
           DMS010]
 gi|224463782|gb|EEF80050.1| glycyl-tRNA synthetase, alpha subunit [Methylophaga thiooxydans
           DMS010]
          Length = 319

 Score =  565 bits (1457), Expect = e-159,   Method: Composition-based stats.
 Identities = 177/302 (58%), Positives = 227/302 (75%), Gaps = 10/302 (3%)

Query: 3   PIHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAY 62
            +   +   +FQ +IL L +YWA+QGC +LQPYDMEVGAGTFHP+T LRA+GP  W AAY
Sbjct: 12  AVMKAETPRTFQELILRLQKYWAEQGCVLLQPYDMEVGAGTFHPATFLRAIGPEPWSAAY 71

Query: 63  VQPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVE 122
           VQPSRRP DGRY ENPNRLQHYYQFQV++KP+P+N+Q LY+ SL+ +G+D  +HD+RFVE
Sbjct: 72  VQPSRRPTDGRYGENPNRLQHYYQFQVVLKPSPINIQELYLGSLEMLGLDTSVHDIRFVE 131

Query: 123 DNWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVN 182
           DNWESPTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLER+AMY+Q V+
Sbjct: 132 DNWESPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECRPVTGEITYGLERIAMYLQGVS 191

Query: 183 SVYDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGI 242
           SVYD+++       V YGD+F Q+E E S YNFE A+ E L + F   E+E   +++ G+
Sbjct: 192 SVYDLIWADGPMGTVTYGDVFLQNEVEMSAYNFEQADVENLFHTFDTCERESQRMIEAGL 251

Query: 243 PNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMT 302
           P           PAY+  +KASH FN+LDAR  IS TERQR+ILR+R+LA+A  +A+   
Sbjct: 252 P----------LPAYELVLKASHTFNMLDARKAISVTERQRFILRVRTLARAVAQAYYDR 301

Query: 303 PN 304
             
Sbjct: 302 RE 303


>gi|152988775|ref|YP_001345405.1| glycyl-tRNA synthetase subunit alpha [Pseudomonas aeruginosa PA7]
 gi|166200561|sp|A6UX70|SYGA_PSEA7 RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|150963933|gb|ABR85958.1| glycyl-tRNA synthetase alpha chain [Pseudomonas aeruginosa PA7]
          Length = 315

 Score =  565 bits (1457), Expect = e-159,   Method: Composition-based stats.
 Identities = 184/293 (62%), Positives = 223/293 (76%), Gaps = 10/293 (3%)

Query: 12  SFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPLD 71
           +FQ++IL L  YWA+QGC +LQPYDMEVGAGTFH +T LRA+GP +W AAYVQPSRRP D
Sbjct: 10  TFQDLILALQNYWAEQGCVVLQPYDMEVGAGTFHTATFLRAIGPETWNAAYVQPSRRPTD 69

Query: 72  GRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTLG 131
           GRY ENPNRLQHYYQFQV++KPNP N Q LY+ SLKA+GIDPL+HD+RFVEDNWESPTLG
Sbjct: 70  GRYGENPNRLQHYYQFQVVLKPNPENFQELYLGSLKAIGIDPLVHDIRFVEDNWESPTLG 129

Query: 132 AWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFNA 191
           AWGLGWE W +GME++QFTYFQQV GIEC P++GEITYGLERLAMY+Q V+SVYD+++  
Sbjct: 130 AWGLGWEIWLNGMEVTQFTYFQQVGGIECYPVTGEITYGLERLAMYLQGVDSVYDLIWTD 189

Query: 192 IEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHHL 251
                V YGD+F Q+E E S +NFE+AN   L   F   E E   L++  +P        
Sbjct: 190 GPFGKVTYGDVFHQNEVEQSTFNFEHANVPKLFELFDFYESEANRLIELELP-------- 241

Query: 252 CVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
              P Y+  +KASH FNLLDAR  IS TERQRYILR+R+LA+A  +++L    
Sbjct: 242 --LPTYEMVLKASHTFNLLDARRAISVTERQRYILRVRTLARAVAQSYLQARA 292


>gi|170747572|ref|YP_001753832.1| glycyl-tRNA synthetase subunit alpha [Methylobacterium
           radiotolerans JCM 2831]
 gi|238688885|sp|B1M1W4|SYGA_METRJ RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|170654094|gb|ACB23149.1| glycyl-tRNA synthetase, alpha subunit [Methylobacterium
           radiotolerans JCM 2831]
          Length = 303

 Score =  565 bits (1456), Expect = e-159,   Method: Composition-based stats.
 Identities = 210/301 (69%), Positives = 239/301 (79%), Gaps = 1/301 (0%)

Query: 7   KKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPS 66
                SFQ +ILTL ++WA QGC ILQPYDMEVGAGTFHP+TTLRALGP  WKAAYVQPS
Sbjct: 1   MSQKKSFQGLILTLQEFWAAQGCVILQPYDMEVGAGTFHPATTLRALGPKPWKAAYVQPS 60

Query: 67  RRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWE 126
           RRP DGRY ENPNRLQHYYQFQVI+KPNP NLQ LY+ SL A+G+D  +HD+RFVED+WE
Sbjct: 61  RRPKDGRYGENPNRLQHYYQFQVILKPNPPNLQELYLASLAAIGVDLKLHDIRFVEDDWE 120

Query: 127 SPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYD 186
           SPTLGAWGLGWECWCDGME+SQFTYFQQV G EC+P++GE+TYGLERLAMYVQ V +VYD
Sbjct: 121 SPTLGAWGLGWECWCDGMEVSQFTYFQQVAGFECAPVAGELTYGLERLAMYVQGVENVYD 180

Query: 187 IVFNAIEG-QNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNE 245
           + FN  EG   + YGD+F Q+EQEYSR+NFE A+  +L   F D+E  C   L  G P+ 
Sbjct: 181 LDFNGAEGPDRITYGDVFLQAEQEYSRHNFEAADTAMLFRQFTDAEAACRSYLAAGAPDA 240

Query: 246 HHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNG 305
               H    PAYDQCIKASH+FNLLDARGVIS TERQ YILR+R LAKACG A+L T  G
Sbjct: 241 EGARHRMAQPAYDQCIKASHVFNLLDARGVISVTERQSYILRVRELAKACGAAWLKTAAG 300

Query: 306 G 306
           G
Sbjct: 301 G 301


>gi|126172270|ref|YP_001048419.1| glycyl-tRNA synthetase subunit alpha [Shewanella baltica OS155]
 gi|152998564|ref|YP_001364245.1| glycyl-tRNA synthetase subunit alpha [Shewanella baltica OS185]
 gi|160873139|ref|YP_001552455.1| glycyl-tRNA synthetase subunit alpha [Shewanella baltica OS195]
 gi|217971229|ref|YP_002355980.1| glycyl-tRNA synthetase subunit alpha [Shewanella baltica OS223]
 gi|304412717|ref|ZP_07394320.1| glycyl-tRNA synthetase, alpha subunit [Shewanella baltica OS183]
 gi|307305818|ref|ZP_07585564.1| glycyl-tRNA synthetase, alpha subunit [Shewanella baltica BA175]
 gi|166200192|sp|A6WH93|SYGA_SHEB8 RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|166200567|sp|A3CYI7|SYGA_SHEB5 RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|189082261|sp|A9KU84|SYGA_SHEB9 RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|254781830|sp|B8E3Q6|SYGA_SHEB2 RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|125995475|gb|ABN59550.1| Glycine--tRNA ligase [Shewanella baltica OS155]
 gi|151363182|gb|ABS06182.1| glycyl-tRNA synthetase, alpha subunit [Shewanella baltica OS185]
 gi|160858661|gb|ABX47195.1| glycyl-tRNA synthetase, alpha subunit [Shewanella baltica OS195]
 gi|217496364|gb|ACK44557.1| glycyl-tRNA synthetase, alpha subunit [Shewanella baltica OS223]
 gi|304348927|gb|EFM13342.1| glycyl-tRNA synthetase, alpha subunit [Shewanella baltica OS183]
 gi|306911311|gb|EFN41737.1| glycyl-tRNA synthetase, alpha subunit [Shewanella baltica BA175]
 gi|315265364|gb|ADT92217.1| glycyl-tRNA synthetase, alpha subunit [Shewanella baltica OS678]
          Length = 301

 Score =  565 bits (1456), Expect = e-159,   Method: Composition-based stats.
 Identities = 186/302 (61%), Positives = 224/302 (74%), Gaps = 8/302 (2%)

Query: 4   IHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYV 63
           +  K +  +FQ  ILTL +YWAQQGC I+QP DMEVGAGTFHP T LR+LGP    +AYV
Sbjct: 1   MTTKHDVKTFQGFILTLQEYWAQQGCAIVQPLDMEVGAGTFHPQTFLRSLGPEPMSSAYV 60

Query: 64  QPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVED 123
           QPSRRP DGRY ENPNRLQHYYQFQV++KP+P N+Q LY+ SL+A+GID  IHD+RFVED
Sbjct: 61  QPSRRPTDGRYGENPNRLQHYYQFQVVLKPSPDNIQELYLGSLQALGIDTQIHDIRFVED 120

Query: 124 NWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNS 183
           NWESPTLGAWGLGWE W +GME++QFTYFQQV GIECSP++GEITYGLERLAMY+Q V+S
Sbjct: 121 NWESPTLGAWGLGWEIWLNGMEVTQFTYFQQVGGIECSPVTGEITYGLERLAMYIQGVDS 180

Query: 184 VYDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIP 243
           VYD+V+       + YGD+F Q+E E S YNFE+A+ + +   F   EK C  LL    P
Sbjct: 181 VYDLVWTDGPLGRITYGDVFHQNEVEQSTYNFEHADVDFMFTLFDQCEKMCQHLLSLEKP 240

Query: 244 NEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTP 303
                      PAY+Q +KASH FNLLDAR  IS TERQRYILR+R++AKA  E++    
Sbjct: 241 --------LPLPAYEQVMKASHAFNLLDARHAISVTERQRYILRVRTMAKAVAESYYQAR 292

Query: 304 NG 305
             
Sbjct: 293 EA 294


>gi|90420147|ref|ZP_01228055.1| glycyl-tRNA synthetase alpha subunit [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90335481|gb|EAS49231.1| glycyl-tRNA synthetase alpha subunit [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 316

 Score =  565 bits (1456), Expect = e-159,   Method: Composition-based stats.
 Identities = 220/293 (75%), Positives = 249/293 (84%), Gaps = 1/293 (0%)

Query: 12  SFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPLD 71
           SFQ +ILTL +YWA  GC +LQPYDMEVGAGTFHP+TTLRALGP  W AAYVQPSRRP D
Sbjct: 13  SFQALILTLHRYWADYGCVVLQPYDMEVGAGTFHPATTLRALGPKPWNAAYVQPSRRPKD 72

Query: 72  GRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTLG 131
           GRY ENPNRLQHYYQ+QVI+KPNP NLQ LY+ SL+A+GID  +HD+RFVED+WESPTLG
Sbjct: 73  GRYGENPNRLQHYYQYQVILKPNPSNLQELYLGSLQAIGIDTGLHDIRFVEDDWESPTLG 132

Query: 132 AWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFNA 191
           AWGLGWECWCDGME+SQFTYFQQVCGIEC+P++GE+TYGLERLAMYVQNV++VYD+ FN 
Sbjct: 133 AWGLGWECWCDGMEVSQFTYFQQVCGIECAPVAGELTYGLERLAMYVQNVDNVYDLNFNG 192

Query: 192 IEGQ-NVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHH 250
            EG   V YGD+F Q+EQEYSRYNFE AN  +L  HF D+E ECL +L  G P+     H
Sbjct: 193 REGDEKVTYGDVFLQAEQEYSRYNFEIANTAVLLKHFEDAEAECLAVLAAGAPDGASPLH 252

Query: 251 LCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTP 303
            CV PAYDQCIKASH+FNLLDARGVIS TERQ YILR+R+LAKACGEAFLMT 
Sbjct: 253 RCVLPAYDQCIKASHVFNLLDARGVISVTERQSYILRVRTLAKACGEAFLMTE 305


>gi|37524311|ref|NP_927655.1| glycyl-tRNA synthetase subunit alpha [Photorhabdus luminescens
           subsp. laumondii TTO1]
 gi|81572749|sp|Q7N9M7|SYGA_PHOLL RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|36783734|emb|CAE12588.1| glycyl-tRNA synthetase alpha chain (glycine--tRNA ligase alpha
           chain) (GlyRS) [Photorhabdus luminescens subsp.
           laumondii TTO1]
          Length = 304

 Score =  565 bits (1456), Expect = e-159,   Method: Composition-based stats.
 Identities = 188/301 (62%), Positives = 223/301 (74%), Gaps = 8/301 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +ILTL  YWA+QGCTI+QP DMEVGAGT HP T LRALGP    AAYVQ
Sbjct: 1   MQKFDTKTFQGLILTLQDYWARQGCTIVQPLDMEVGAGTSHPITCLRALGPEPIAAAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQVIIKP+P N+Q LY++SLKA+G+DP +HD+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVIIKPSPDNIQELYLDSLKALGLDPTVHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLERLAMY+Q V+SV
Sbjct: 121 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGLERLAMYIQGVDSV 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V+         YGDI+ Q+E E S YNFE+A+ + L   F   EKE  DLL    P 
Sbjct: 181 YDLVWCDGPLGKTTYGDIYHQNEVEQSTYNFEHADVDFLFTCFEQYEKEAQDLLALETP- 239

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY++ +KA H FNLLDAR  IS TERQRYILRIR+L KA  EA+  +  
Sbjct: 240 -------LPLPAYERILKAGHTFNLLDARKAISVTERQRYILRIRTLTKAVAEAYYASRE 292

Query: 305 G 305
            
Sbjct: 293 A 293


>gi|169632312|ref|YP_001706048.1| glycyl-tRNA synthetase subunit alpha [Acinetobacter baumannii SDF]
 gi|169794556|ref|YP_001712349.1| glycyl-tRNA synthetase subunit alpha [Acinetobacter baumannii AYE]
 gi|184159638|ref|YP_001847977.1| glycyl-tRNA synthetase subunit alpha [Acinetobacter baumannii
           ACICU]
 gi|213158872|ref|YP_002320870.1| glycyl-tRNA synthetase, alpha subunit [Acinetobacter baumannii
           AB0057]
 gi|215482144|ref|YP_002324326.1| Glycyl-tRNA synthetase alpha chain(Glycine--tRNA ligasealpha chain)
           (GlyRS) [Acinetobacter baumannii AB307-0294]
 gi|239503275|ref|ZP_04662585.1| glycyl-tRNA synthetase subunit alpha [Acinetobacter baumannii
           AB900]
 gi|260549880|ref|ZP_05824096.1| glycyl-tRNA synthetase subunit alpha(Glycine-tRNA ligasealpha)
           [Acinetobacter sp. RUH2624]
 gi|260556988|ref|ZP_05829205.1| glycyl-tRNA synthetase, alpha subunit [Acinetobacter baumannii ATCC
           19606]
 gi|301348165|ref|ZP_07228906.1| glycyl-tRNA synthetase subunit alpha [Acinetobacter baumannii
           AB056]
 gi|301511529|ref|ZP_07236766.1| glycyl-tRNA synthetase subunit alpha [Acinetobacter baumannii
           AB058]
 gi|301595663|ref|ZP_07240671.1| glycyl-tRNA synthetase subunit alpha [Acinetobacter baumannii
           AB059]
 gi|332856633|ref|ZP_08436242.1| glycine--tRNA ligase, alpha subunit [Acinetobacter baumannii
           6013150]
 gi|332868663|ref|ZP_08438310.1| glycine--tRNA ligase, alpha subunit [Acinetobacter baumannii
           6013113]
 gi|332876123|ref|ZP_08443907.1| glycine--tRNA ligase, alpha subunit [Acinetobacter baumannii
           6014059]
 gi|169147483|emb|CAM85344.1| glycyl-tRNA synthetase, alpha chain [Acinetobacter baumannii AYE]
 gi|169151104|emb|CAO99766.1| glycyl-tRNA synthetase, alpha chain [Acinetobacter baumannii]
 gi|183211232|gb|ACC58630.1| Glycyl-tRNA synthetase, alpha subunit [Acinetobacter baumannii
           ACICU]
 gi|193078507|gb|ABO13515.2| glycyl-tRNA synthetase alpha chain [Acinetobacter baumannii ATCC
           17978]
 gi|213058032|gb|ACJ42934.1| glycyl-tRNA synthetase, alpha subunit [Acinetobacter baumannii
           AB0057]
 gi|213987112|gb|ACJ57411.1| Glycyl-tRNA synthetase alpha chain(Glycine--tRNA ligasealpha chain)
           (GlyRS) [Acinetobacter baumannii AB307-0294]
 gi|260407130|gb|EEX00607.1| glycyl-tRNA synthetase subunit alpha(Glycine-tRNA ligasealpha)
           [Acinetobacter sp. RUH2624]
 gi|260409594|gb|EEX02895.1| glycyl-tRNA synthetase, alpha subunit [Acinetobacter baumannii ATCC
           19606]
 gi|322509548|gb|ADX05002.1| glyQ [Acinetobacter baumannii 1656-2]
 gi|323519568|gb|ADX93949.1| glycyl-tRNA synthetase subunit alpha [Acinetobacter baumannii
           TCDC-AB0715]
 gi|332727026|gb|EGJ58516.1| glycine--tRNA ligase, alpha subunit [Acinetobacter baumannii
           6013150]
 gi|332733235|gb|EGJ64430.1| glycine--tRNA ligase, alpha subunit [Acinetobacter baumannii
           6013113]
 gi|332735741|gb|EGJ66784.1| glycine--tRNA ligase, alpha subunit [Acinetobacter baumannii
           6014059]
          Length = 325

 Score =  565 bits (1456), Expect = e-159,   Method: Composition-based stats.
 Identities = 186/293 (63%), Positives = 226/293 (77%), Gaps = 10/293 (3%)

Query: 12  SFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPLD 71
           +FQ +IL L  YWA+QGC +LQPYDME+GAGTFH +T LRALGP +W AAYVQPSRRP D
Sbjct: 10  TFQGLILALQNYWAEQGCVVLQPYDMEMGAGTFHTATFLRALGPETWNAAYVQPSRRPKD 69

Query: 72  GRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTLG 131
           GRY ENPNRLQHYYQFQV++KPNP N+Q LY++SLKA+GID L HD+RFVEDNWESPTLG
Sbjct: 70  GRYGENPNRLQHYYQFQVVLKPNPDNIQQLYLDSLKAIGIDTLTHDIRFVEDNWESPTLG 129

Query: 132 AWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFNA 191
           AWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLERLAMY+Q V+SVYD+V+  
Sbjct: 130 AWGLGWEVWLNGMEVTQFTYFQQVGGVECYPVTGEITYGLERLAMYLQGVDSVYDLVWTK 189

Query: 192 IEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHHL 251
            +   V YGD+F Q+E E S YNFEYA  + L   F   E E   L++  +P        
Sbjct: 190 GQFGTVTYGDVFHQNEVEQSTYNFEYAPVDKLFELFDFYESEANRLMEAKLP-------- 241

Query: 252 CVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
              PAY+Q +KASH FNLLDARG IS TERQRYILR+R+LA+A  ++++    
Sbjct: 242 --LPAYEQVVKASHTFNLLDARGAISVTERQRYILRVRTLARAIAQSYVQARA 292


>gi|226953822|ref|ZP_03824286.1| glycyl-tRNA synthetase, alpha chain [Acinetobacter sp. ATCC 27244]
 gi|294651683|ref|ZP_06728985.1| glycyl-tRNA synthetase subunit alpha [Acinetobacter haemolyticus
           ATCC 19194]
 gi|226835413|gb|EEH67796.1| glycyl-tRNA synthetase, alpha chain [Acinetobacter sp. ATCC 27244]
 gi|292822402|gb|EFF81303.1| glycyl-tRNA synthetase subunit alpha [Acinetobacter haemolyticus
           ATCC 19194]
          Length = 329

 Score =  564 bits (1455), Expect = e-159,   Method: Composition-based stats.
 Identities = 186/293 (63%), Positives = 226/293 (77%), Gaps = 10/293 (3%)

Query: 12  SFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPLD 71
           +FQ +IL L  YWA+QGC +LQPYDME+GAGTFH +T LRALGP +W AAYVQPSRRP D
Sbjct: 10  TFQGLILALQNYWAEQGCVVLQPYDMEMGAGTFHTATFLRALGPETWNAAYVQPSRRPKD 69

Query: 72  GRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTLG 131
           GRY ENPNRLQHYYQFQV++KPNP N+Q LY++SLKA+GID L HD+RFVEDNWESPTLG
Sbjct: 70  GRYGENPNRLQHYYQFQVVLKPNPDNIQQLYLDSLKAIGIDTLTHDIRFVEDNWESPTLG 129

Query: 132 AWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFNA 191
           AWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLERLAMY+Q V+SVYD+V+  
Sbjct: 130 AWGLGWEVWLNGMEVTQFTYFQQVGGVECYPVTGEITYGLERLAMYLQGVDSVYDLVWTK 189

Query: 192 IEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHHL 251
            +   V YGD+F Q+E E S YNFEYA  + L   F   E E   L++  +P        
Sbjct: 190 GQFGTVTYGDVFHQNEVEQSTYNFEYAPVDKLFELFDFYEAEAARLMEAELP-------- 241

Query: 252 CVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
              PAY+Q IKASH FNLLDARG IS TERQRYILR+R+LA++  ++++    
Sbjct: 242 --LPAYEQVIKASHSFNLLDARGAISVTERQRYILRVRTLARSIAQSYVAARA 292


>gi|270264146|ref|ZP_06192413.1| glycyl-tRNA synthetase subunit alpha [Serratia odorifera 4Rx13]
 gi|270041795|gb|EFA14892.1| glycyl-tRNA synthetase subunit alpha [Serratia odorifera 4Rx13]
          Length = 345

 Score =  564 bits (1455), Expect = e-159,   Method: Composition-based stats.
 Identities = 188/301 (62%), Positives = 222/301 (73%), Gaps = 8/301 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +ILTL  YWA+QGCTI+QP DMEVGAGT HP T LRALGP    AAYVQ
Sbjct: 42  MQKFDTKTFQGLILTLQDYWARQGCTIVQPLDMEVGAGTSHPMTCLRALGPEPIAAAYVQ 101

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQVIIKP+P N+Q LY+ SLK +G+DP IHD+RFVEDN
Sbjct: 102 PSRRPTDGRYGENPNRLQHYYQFQVIIKPSPDNIQELYLGSLKELGLDPTIHDIRFVEDN 161

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLERLAMY+Q V+SV
Sbjct: 162 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGLERLAMYIQGVDSV 221

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V++        YGD+F Q+E E S YNFEYA+ + L + F   EKE   LL    P 
Sbjct: 222 YDLVWSDGPLGVTTYGDVFHQNEVEQSTYNFEYADVDFLFSCFEQYEKEAQSLLALEKP- 280

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY++ +KA H FNLLDAR  IS TERQRYILRIR+L KA  EA+  +  
Sbjct: 281 -------LPLPAYERILKAGHTFNLLDARKAISVTERQRYILRIRTLTKAVAEAYYASRE 333

Query: 305 G 305
            
Sbjct: 334 A 334


>gi|268592255|ref|ZP_06126476.1| glycyl-tRNA synthetase, alpha subunit [Providencia rettgeri DSM
           1131]
 gi|291312030|gb|EFE52483.1| glycyl-tRNA synthetase, alpha subunit [Providencia rettgeri DSM
           1131]
          Length = 302

 Score =  564 bits (1455), Expect = e-159,   Method: Composition-based stats.
 Identities = 187/301 (62%), Positives = 221/301 (73%), Gaps = 8/301 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +ILTL  YWA+QGCTI+QP DMEVGAGT HP T LRALGP    AAYVQ
Sbjct: 1   MQKFDTKTFQGLILTLQDYWARQGCTIVQPLDMEVGAGTSHPMTCLRALGPEPIAAAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQVIIKP+P N+Q LY+ SLK +G+DP +HD+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVIIKPSPDNIQELYLGSLKELGVDPTVHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLERLAMY+Q V+SV
Sbjct: 121 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGLERLAMYIQGVDSV 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V+         YGDI+ Q+E E S YNFEYAN + L   F + EKE   LL    P 
Sbjct: 181 YDLVWCDGPLGKTTYGDIYHQNEVEQSTYNFEYANVDFLFKCFEEYEKEAQHLLALETP- 239

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY++ +KA+H FNLLDAR  IS TERQRYILRIR+L K   EA+  +  
Sbjct: 240 -------LPLPAYERILKAAHTFNLLDARKAISVTERQRYILRIRTLTKGVAEAYYASRE 292

Query: 305 G 305
            
Sbjct: 293 A 293


>gi|183597048|ref|ZP_02958541.1| hypothetical protein PROSTU_00284 [Providencia stuartii ATCC 25827]
 gi|188023708|gb|EDU61748.1| hypothetical protein PROSTU_00284 [Providencia stuartii ATCC 25827]
          Length = 302

 Score =  564 bits (1455), Expect = e-159,   Method: Composition-based stats.
 Identities = 188/301 (62%), Positives = 221/301 (73%), Gaps = 8/301 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +ILTL  YWA+QGCTI+QP DMEVGAGT HP T LRALGP    AAYVQ
Sbjct: 1   MQKFDTKTFQGLILTLQDYWARQGCTIVQPLDMEVGAGTSHPMTCLRALGPEPIAAAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQVIIKP+P N+Q LY+ SLK +GIDP +HD+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVIIKPSPDNIQELYLGSLKELGIDPTVHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLERLAMY+Q V+SV
Sbjct: 121 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGLERLAMYIQGVDSV 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V+         YGDI+ Q+E E S YNFEYAN + L   F + EKE   LL    P 
Sbjct: 181 YDLVWCDGPLGKTTYGDIYHQNEVEQSTYNFEYANVDFLFKCFEEYEKEAQYLLSLETP- 239

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY++ +KA+H FNLLDAR  IS TERQRYILRIR+L K   EA+  +  
Sbjct: 240 -------LPLPAYERILKAAHTFNLLDARKAISVTERQRYILRIRTLTKGVAEAYYASRE 292

Query: 305 G 305
            
Sbjct: 293 A 293


>gi|313672707|ref|YP_004050818.1| glycyl-tRNA synthetase alpha chain [Calditerrivibrio nitroreducens
           DSM 19672]
 gi|312939463|gb|ADR18655.1| glycyl-tRNA synthetase alpha chain [Calditerrivibrio nitroreducens
           DSM 19672]
          Length = 292

 Score =  564 bits (1455), Expect = e-159,   Method: Composition-based stats.
 Identities = 179/294 (60%), Positives = 224/294 (76%), Gaps = 14/294 (4%)

Query: 11  LSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPL 70
           + FQ++IL L ++WA+ GC I QPYD+EVGAGTF+P+T LR LGP  W  AYV+PSRRP 
Sbjct: 1   MYFQDVILKLQEFWARNGCIIYQPYDIEVGAGTFNPATFLRCLGPEPWNVAYVEPSRRPT 60

Query: 71  DGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTL 130
           DGRY ENPNRLQHYYQFQVI+KP+P N+Q+LY++SLK +GIDPL HD+RFVED+WESPTL
Sbjct: 61  DGRYGENPNRLQHYYQFQVILKPSPDNIQDLYLDSLKQLGIDPLEHDIRFVEDDWESPTL 120

Query: 131 GAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFN 190
           GAWGLGWE W DGMEI+QFTYFQQ  GI+  P+SGEITYGLER+ MY+Q V SV+D+ +N
Sbjct: 121 GAWGLGWEVWLDGMEITQFTYFQQAGGIDLKPVSGEITYGLERITMYLQGVESVFDLKWN 180

Query: 191 AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHH 250
               +NV YGD++ ++E E+SR+NFE A+ E+    F   EKEC+ L++KG+        
Sbjct: 181 ----ENVTYGDVYHRNEVEFSRFNFEEADVEMNFKLFEMYEKECVRLVEKGL-------- 228

Query: 251 LCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
             V PAYD C+K SH FNLLDAR  IS TER  YI R+R+LAK C E +L +  
Sbjct: 229 --VLPAYDFCLKCSHTFNLLDARNAISVTERTGYIGRVRNLAKLCAEGYLKSRE 280


>gi|262373563|ref|ZP_06066841.1| glycyl-tRNA synthetase, alpha subunit [Acinetobacter junii SH205]
 gi|262311316|gb|EEY92402.1| glycyl-tRNA synthetase, alpha subunit [Acinetobacter junii SH205]
          Length = 326

 Score =  564 bits (1454), Expect = e-159,   Method: Composition-based stats.
 Identities = 186/293 (63%), Positives = 226/293 (77%), Gaps = 10/293 (3%)

Query: 12  SFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPLD 71
           +FQ +IL L  YWA+QGC +LQPYDME+GAGTFH +T LRALGP +W AAYVQPSRRP D
Sbjct: 10  TFQGLILALQNYWAEQGCVVLQPYDMEMGAGTFHTATFLRALGPETWNAAYVQPSRRPKD 69

Query: 72  GRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTLG 131
           GRY ENPNRLQHYYQFQV++KPNP N+Q LY++SLKA+GID L HD+RFVEDNWESPTLG
Sbjct: 70  GRYGENPNRLQHYYQFQVVLKPNPDNIQQLYLDSLKAIGIDTLTHDIRFVEDNWESPTLG 129

Query: 132 AWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFNA 191
           AWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLERLAMY+Q V+SVYD+V+  
Sbjct: 130 AWGLGWEVWLNGMEVTQFTYFQQVGGVECYPVTGEITYGLERLAMYLQGVDSVYDLVWTK 189

Query: 192 IEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHHL 251
            +   V YGD+F Q+E E S YNFEYA  + L   F   E E   L++  +P        
Sbjct: 190 GQFGTVTYGDVFHQNEVEQSTYNFEYAPVDKLFELFDFYEAEAARLMEAELP-------- 241

Query: 252 CVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
              PAY+Q IKASH FNLLDARG IS TERQRYILR+R+LA++  ++++    
Sbjct: 242 --LPAYEQVIKASHSFNLLDARGAISVTERQRYILRVRTLARSIAQSYVAARA 292


>gi|217969299|ref|YP_002354533.1| glycyl-tRNA synthetase subunit alpha [Thauera sp. MZ1T]
 gi|217506626|gb|ACK53637.1| glycyl-tRNA synthetase, alpha subunit [Thauera sp. MZ1T]
          Length = 308

 Score =  564 bits (1454), Expect = e-159,   Method: Composition-based stats.
 Identities = 170/304 (55%), Positives = 227/304 (74%), Gaps = 11/304 (3%)

Query: 3   PIHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAY 62
              ++    +FQ +ILTL  +W ++GC +LQPYD+EVGAGT H +T LRA+GP  W AAY
Sbjct: 2   TTESRLVKPTFQQVILTLQHFWGERGCVLLQPYDLEVGAGTSHTATFLRAIGPEPWNAAY 61

Query: 63  VQPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVE 122
           VQPSRRP DGRY ENPNRLQHYYQFQV++KP+PLN+Q LY++SL+A+GIDP +HD+RFVE
Sbjct: 62  VQPSRRPKDGRYGENPNRLQHYYQFQVVLKPSPLNIQELYLDSLRALGIDPTVHDIRFVE 121

Query: 123 DNWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVN 182
           D+WE+PTLGAWGLGWE W DGME++QFTYFQQV G++C P+ GEITYG+ERLAMY+Q V 
Sbjct: 122 DDWENPTLGAWGLGWEVWLDGMEVTQFTYFQQVGGLDCKPVLGEITYGIERLAMYLQGVE 181

Query: 183 SVYDIVFN-AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKG 241
           +VYD+V++ A +G+ V YGD++ Q+E E S +NFE++N + L + F + E E   +++  
Sbjct: 182 NVYDLVWSVAPDGRKVTYGDVYHQNEVEQSTFNFEHSNVDFLFSLFNNYESEARRVME-- 239

Query: 242 IPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLM 301
                        PAY+  +KA+H FNLLDARG IS TER  YI RIR+L++A  +A+  
Sbjct: 240 --------VGLALPAYEMVLKAAHTFNLLDARGAISVTERAAYIGRIRNLSRAVAQAYFE 291

Query: 302 TPNG 305
           +   
Sbjct: 292 SREA 295


>gi|226942181|ref|YP_002797254.1| glycyl-tRNA synthetase subunit alpha [Azotobacter vinelandii DJ]
 gi|226717108|gb|ACO76279.1| Glycyl-tRNA synthetase protein, alpha subunit [Azotobacter
           vinelandii DJ]
          Length = 318

 Score =  564 bits (1454), Expect = e-159,   Method: Composition-based stats.
 Identities = 182/293 (62%), Positives = 223/293 (76%), Gaps = 10/293 (3%)

Query: 12  SFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPLD 71
           +FQ++IL L  YWA+QGC +LQPYDMEVGAGTFH +T LRA+GP +W AAYVQPSRRP D
Sbjct: 13  TFQDLILALQNYWAEQGCVVLQPYDMEVGAGTFHTATFLRAIGPETWNAAYVQPSRRPAD 72

Query: 72  GRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTLG 131
           GRY ENPNRLQHYYQFQV++KPNP ++Q+LY+ESL+ +GID  +HDVRFVEDNWESPTLG
Sbjct: 73  GRYGENPNRLQHYYQFQVVLKPNPDDIQDLYLESLRRIGIDTRVHDVRFVEDNWESPTLG 132

Query: 132 AWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFNA 191
           AWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLERLAMY+Q V+SVYD+V+  
Sbjct: 133 AWGLGWEVWLNGMEVTQFTYFQQVGGVECYPVTGEITYGLERLAMYLQGVDSVYDLVWTD 192

Query: 192 IEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHHL 251
                V YGD+F Q+E E S YNFE+AN   L   F   E E   L++  +P        
Sbjct: 193 GPFGKVTYGDVFHQNEVEQSTYNFEHANVAKLFELFDFYESEANRLIELELP-------- 244

Query: 252 CVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
              P Y+  +KASH FNLLDAR  IS TERQRYILR+R+LA+A  +++L    
Sbjct: 245 --LPTYEMVLKASHTFNLLDARRAISVTERQRYILRVRTLARAVAQSYLQARA 295


>gi|15595207|ref|NP_064729.1| glycyl-tRNA synthetase subunit alpha [Pseudomonas aeruginosa PAO1]
 gi|107099003|ref|ZP_01362921.1| hypothetical protein PaerPA_01000009 [Pseudomonas aeruginosa PACS2]
 gi|116053729|ref|YP_788164.1| glycyl-tRNA synthetase subunit alpha [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|218888755|ref|YP_002437619.1| glycyl-tRNA synthetase subunit alpha [Pseudomonas aeruginosa
           LESB58]
 gi|254237748|ref|ZP_04931071.1| glycyl-tRNA synthetase alpha chain [Pseudomonas aeruginosa C3719]
 gi|254243122|ref|ZP_04936444.1| glycyl-tRNA synthetase alpha chain [Pseudomonas aeruginosa 2192]
 gi|296386481|ref|ZP_06875980.1| glycyl-tRNA synthetase subunit alpha [Pseudomonas aeruginosa PAb1]
 gi|313111469|ref|ZP_07797270.1| glycyl-tRNA synthetase alpha chain [Pseudomonas aeruginosa 39016]
 gi|25009323|sp|Q9I7B7|SYGA_PSEAE RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|122262136|sp|Q02V72|SYGA_PSEAB RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|226737042|sp|B7V0P4|SYGA_PSEA8 RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|9945827|gb|AAG03399.1|AE004440_9 glycyl-tRNA synthetase alpha chain [Pseudomonas aeruginosa PAO1]
 gi|115588950|gb|ABJ14965.1| glycyl-tRNA synthetase alpha chain [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|126169679|gb|EAZ55190.1| glycyl-tRNA synthetase alpha chain [Pseudomonas aeruginosa C3719]
 gi|126196500|gb|EAZ60563.1| glycyl-tRNA synthetase alpha chain [Pseudomonas aeruginosa 2192]
 gi|218768978|emb|CAW24736.1| glycyl-tRNA synthetase alpha chain [Pseudomonas aeruginosa LESB58]
 gi|310883772|gb|EFQ42366.1| glycyl-tRNA synthetase alpha chain [Pseudomonas aeruginosa 39016]
          Length = 315

 Score =  564 bits (1454), Expect = e-159,   Method: Composition-based stats.
 Identities = 185/293 (63%), Positives = 222/293 (75%), Gaps = 10/293 (3%)

Query: 12  SFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPLD 71
           +FQ++IL L  YWA+QGC +LQPYDMEVGAGTFH +T LRA+GP +W AAYVQPSRRP D
Sbjct: 10  TFQDLILALQNYWAEQGCVVLQPYDMEVGAGTFHTATFLRAIGPETWNAAYVQPSRRPTD 69

Query: 72  GRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTLG 131
           GRY ENPNRLQHYYQFQV++KPNP N Q LY+ SLKA+GIDPL+HD+RFVEDNWESPTLG
Sbjct: 70  GRYGENPNRLQHYYQFQVVLKPNPENFQELYLGSLKAIGIDPLVHDIRFVEDNWESPTLG 129

Query: 132 AWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFNA 191
           AWGLGWE W +GME++QFTYFQQV GIEC P++GEITYGLERLAMY+Q V+SVYD+V+  
Sbjct: 130 AWGLGWEIWLNGMEVTQFTYFQQVGGIECYPVTGEITYGLERLAMYLQGVDSVYDLVWTD 189

Query: 192 IEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHHL 251
                V YGD+F Q+E E S +NFE+AN   L   F   E E   L+   +P        
Sbjct: 190 GPFGKVTYGDVFHQNEVEQSTFNFEHANVPKLFELFDFYESEANRLIALELP-------- 241

Query: 252 CVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
              P Y+  +KASH FNLLDAR  IS TERQRYILR+R+LA+A  +++L    
Sbjct: 242 --LPTYEMVLKASHTFNLLDARRAISVTERQRYILRVRTLARAVAQSYLQARA 292


>gi|300725253|ref|YP_003714582.1| glycine tRNA synthetase subunit alpha [Xenorhabdus nematophila ATCC
           19061]
 gi|297631799|emb|CBJ92520.1| glycine tRNA synthetase, alpha subunit [Xenorhabdus nematophila
           ATCC 19061]
          Length = 306

 Score =  564 bits (1454), Expect = e-159,   Method: Composition-based stats.
 Identities = 186/301 (61%), Positives = 222/301 (73%), Gaps = 8/301 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +ILTL  YWA+QGCTI+Q  DMEVGAGT HP T LRALGP    AAYVQ
Sbjct: 1   MQKFDTKTFQGLILTLQDYWARQGCTIVQSLDMEVGAGTSHPITCLRALGPEPIAAAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQVIIKP+P N+Q LY+ SLKA+G+DP +HD+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVIIKPSPDNIQELYLGSLKALGLDPTVHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLERLAMY+Q V+SV
Sbjct: 121 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGLERLAMYIQGVDSV 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V++        YGDI+ Q+E E S YNFE+A+ + L   F   EKE   LL   +P 
Sbjct: 181 YDLVWSDGPLGKTTYGDIYHQNEVEQSTYNFEHADVDFLFTCFEQYEKEAQALLALEVP- 239

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY++ +KA H FNLLDAR  IS TERQRYILRIR+L KA  EA+  +  
Sbjct: 240 -------LPLPAYERILKAGHTFNLLDARKAISVTERQRYILRIRTLTKAVAEAYYASRE 292

Query: 305 G 305
            
Sbjct: 293 A 293


>gi|257453501|ref|ZP_05618791.1| glycyl-tRNA synthetase, alpha subunit [Enhydrobacter aerosaccus
           SK60]
 gi|257448959|gb|EEV23912.1| glycyl-tRNA synthetase, alpha subunit [Enhydrobacter aerosaccus
           SK60]
          Length = 322

 Score =  564 bits (1454), Expect = e-159,   Method: Composition-based stats.
 Identities = 182/295 (61%), Positives = 224/295 (75%), Gaps = 10/295 (3%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            ++FQ +ILTL  YWA++GC +LQPYDME+GAGTFH +T LRALGP  W AAYVQPSRRP
Sbjct: 1   MMTFQQLILTLQNYWAEKGCVVLQPYDMEMGAGTFHTATFLRALGPERWHAAYVQPSRRP 60

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY +NPNRLQHYYQFQV++KPNP ++Q LY+ SLKA+GID L HDVRFVEDNWESPT
Sbjct: 61  TDGRYGDNPNRLQHYYQFQVVLKPNPPDIQELYLGSLKAIGIDTLTHDVRFVEDNWESPT 120

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQQV GIEC P++GEITYGLERLAMY+Q V+SVYD+V+
Sbjct: 121 LGAWGLGWEVWLNGMEVTQFTYFQQVGGIECFPVTGEITYGLERLAMYIQGVDSVYDLVW 180

Query: 190 NAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRH 249
              E   V YGD+F Q+E E S YNFE+A+   +   F   E +   L+   +P      
Sbjct: 181 TDGEFGRVTYGDVFHQNEVEQSTYNFEHADVAKMFELFDFYESQADKLVGLNLP------ 234

Query: 250 HLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                PAY+  +KASH FNLLDARG IS TERQR+ILR+R+LA+   ++++ T  
Sbjct: 235 ----LPAYEMVLKASHTFNLLDARGAISVTERQRFILRVRTLARKVAQSYVETRA 285


>gi|260771057|ref|ZP_05879985.1| glycyl-tRNA synthetase alpha chain [Vibrio furnissii CIP 102972]
 gi|260613946|gb|EEX39137.1| glycyl-tRNA synthetase alpha chain [Vibrio furnissii CIP 102972]
          Length = 305

 Score =  564 bits (1454), Expect = e-159,   Method: Composition-based stats.
 Identities = 186/301 (61%), Positives = 221/301 (73%), Gaps = 8/301 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +IL L  YWAQQGCTI+QP DMEVGAGT HP T LRALGP     AYVQ
Sbjct: 1   MQKYDIKTFQGMILALQDYWAQQGCTIVQPLDMEVGAGTSHPMTCLRALGPEPIATAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQVIIKP+P N+Q LY+ SLK +G+DP +HD+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVIIKPSPDNIQELYLGSLKVLGVDPQVHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYG+ERLAMY+Q V+SV
Sbjct: 121 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGIERLAMYIQGVDSV 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V+       V YGDI+ Q+E E S YNFE+A+ + L   F   EKECL LL    P 
Sbjct: 181 YDLVWTDGPLGKVTYGDIYHQNEVEQSTYNFEHADVDFLFTFFDQCEKECLHLLALEKP- 239

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY++ +KA H FNLLDAR  IS TERQRYILRIR+L K+  EA+  +  
Sbjct: 240 -------LPLPAYERILKAGHAFNLLDARKAISVTERQRYILRIRNLTKSVAEAYYASRE 292

Query: 305 G 305
            
Sbjct: 293 A 293


>gi|304398081|ref|ZP_07379956.1| glycyl-tRNA synthetase, alpha subunit [Pantoea sp. aB]
 gi|308188777|ref|YP_003932908.1| glycine tRNA synthetase, alpha subunit [Pantoea vagans C9-1]
 gi|304354367|gb|EFM18739.1| glycyl-tRNA synthetase, alpha subunit [Pantoea sp. aB]
 gi|308059287|gb|ADO11459.1| glycine tRNA synthetase, alpha subunit [Pantoea vagans C9-1]
          Length = 303

 Score =  563 bits (1453), Expect = e-159,   Method: Composition-based stats.
 Identities = 187/301 (62%), Positives = 222/301 (73%), Gaps = 8/301 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +ILTL  YWA+QGCTI+QP DMEVGAGT HP T LRALGP    AAYVQ
Sbjct: 1   MQKFDTKTFQGLILTLQDYWARQGCTIVQPLDMEVGAGTSHPMTCLRALGPEPIAAAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQVIIKP+P N+Q LY+ SLK +G+DP +HD+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVIIKPSPDNIQELYLGSLKELGMDPTVHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLERLAMY+Q V+SV
Sbjct: 121 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGLERLAMYIQGVDSV 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V++        YGD+F Q+E E S YNFEYA+ + L   F   EKE   LL    P 
Sbjct: 181 YDLVWSDGPLGKTTYGDVFHQNEVEQSTYNFEYADVDFLFTCFEQYEKEAQHLLALEKP- 239

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY++ +KA+H FNLLDAR  IS TERQRYILRIR+L KA  EA+  +  
Sbjct: 240 -------LPLPAYERILKAAHSFNLLDARKAISVTERQRYILRIRTLTKAVAEAYYASRE 292

Query: 305 G 305
            
Sbjct: 293 A 293


>gi|312174285|emb|CBX82538.1| glycine tRNA synthetase, alpha subunit [Erwinia amylovora ATCC
           BAA-2158]
          Length = 317

 Score =  563 bits (1453), Expect = e-159,   Method: Composition-based stats.
 Identities = 187/301 (62%), Positives = 221/301 (73%), Gaps = 8/301 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +ILTL  YWA+QGCTI+QP DMEVGAGT HP T LRALGP     AYVQ
Sbjct: 15  MQKFDTKTFQGLILTLQDYWARQGCTIIQPLDMEVGAGTSHPMTCLRALGPEPTAVAYVQ 74

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQVIIKP+P N+Q LY+ SLK +G+DP IHD+RFVEDN
Sbjct: 75  PSRRPTDGRYGENPNRLQHYYQFQVIIKPSPDNIQELYLGSLKELGMDPTIHDIRFVEDN 134

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLERLAMY+Q V+SV
Sbjct: 135 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGLERLAMYIQGVDSV 194

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V++        YGD+F Q+E E S YNFEYA+ + L   F   EKE   LL    P 
Sbjct: 195 YDLVWSDGPLGKTTYGDVFHQNEVEQSTYNFEYADVDFLFTCFEQYEKEAQSLLALEKP- 253

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY++ +KA+H FNLLDAR  IS TERQRYILRIR+L KA  EA+  +  
Sbjct: 254 -------LPLPAYERILKAAHSFNLLDARKAISVTERQRYILRIRTLTKAVAEAYYASRE 306

Query: 305 G 305
            
Sbjct: 307 A 307


>gi|222085062|ref|YP_002543592.1| glycyl-tRNA synthetase [Agrobacterium radiobacter K84]
 gi|221722510|gb|ACM25666.1| glycyl-tRNA synthetase [Agrobacterium radiobacter K84]
          Length = 319

 Score =  563 bits (1453), Expect = e-159,   Method: Composition-based stats.
 Identities = 228/304 (75%), Positives = 260/304 (85%), Gaps = 3/304 (0%)

Query: 6   NKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQP 65
           +     SFQ +ILTL  YWA +GC +LQPYDMEVGAGTFHP+TTLRALGP  WKAAYVQP
Sbjct: 8   HMNPKRSFQALILTLHNYWADKGCAVLQPYDMEVGAGTFHPATTLRALGPKPWKAAYVQP 67

Query: 66  SRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNW 125
           SRRP DGRY ENPNR+QHYYQ+QVI+KPNP NLQ LY+ SL A+G+DPL+HD+RFVED+W
Sbjct: 68  SRRPSDGRYGENPNRMQHYYQYQVILKPNPPNLQELYLGSLAAIGLDPLVHDIRFVEDDW 127

Query: 126 ESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVY 185
           ESPTLGAWGLGWECWCDGME+SQFTYFQQVCGIECSP++GE+TYGLERLA YVQ V+SVY
Sbjct: 128 ESPTLGAWGLGWECWCDGMEVSQFTYFQQVCGIECSPVAGELTYGLERLATYVQGVDSVY 187

Query: 186 DIVFNAIEGQ-NVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           D+ FN +EG   + YGD+F Q+EQEYSR+NFEYAN E+LH HFID+EKECL LL  G P 
Sbjct: 188 DLNFNGLEGDEKITYGDVFLQAEQEYSRHNFEYANTEMLHRHFIDAEKECLALLAAGAPG 247

Query: 245 EHH--RHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMT 302
           +    R H CVFPAYDQCIKASH+FNLLDARGVIS TERQ YILR+R+LAKACGEAFL+T
Sbjct: 248 DSDNQRLHKCVFPAYDQCIKASHVFNLLDARGVISVTERQSYILRVRTLAKACGEAFLLT 307

Query: 303 PNGG 306
             GG
Sbjct: 308 DAGG 311


>gi|291615653|ref|YP_003518395.1| GlyQ [Pantoea ananatis LMG 20103]
 gi|291150683|gb|ADD75267.1| GlyQ [Pantoea ananatis LMG 20103]
 gi|327395919|dbj|BAK13341.1| glycyl-tRNA synthetase alpha chain GlyQ [Pantoea ananatis AJ13355]
          Length = 303

 Score =  563 bits (1453), Expect = e-159,   Method: Composition-based stats.
 Identities = 187/301 (62%), Positives = 222/301 (73%), Gaps = 8/301 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +ILTL  YWA+QGCTI+QP DMEVGAGT HP T LRALGP    AAYVQ
Sbjct: 1   MQKFDTKTFQGLILTLQDYWARQGCTIVQPLDMEVGAGTSHPMTCLRALGPEPIAAAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQVIIKP+P N+Q LY+ SLK +G+DP +HD+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVIIKPSPDNIQELYLGSLKELGMDPTVHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLERLAMY+Q V+SV
Sbjct: 121 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGLERLAMYIQGVDSV 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V++        YGD+F Q+E E S YNFEYA+ + L   F   EKE   LL    P 
Sbjct: 181 YDLVWSDGPLGKTTYGDVFHQNEVEQSTYNFEYADVDFLFTCFEQYEKEAQQLLALEKP- 239

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY++ +KA+H FNLLDAR  IS TERQRYILRIR+L KA  EA+  +  
Sbjct: 240 -------LPLPAYERILKAAHSFNLLDARKAISVTERQRYILRIRTLTKAVAEAYYASRE 292

Query: 305 G 305
            
Sbjct: 293 A 293


>gi|221638263|ref|YP_002524525.1| glycyl-tRNA synthetase subunit alpha [Rhodobacter sphaeroides
           KD131]
 gi|221159044|gb|ACM00024.1| Glycine--tRNA ligase precursor [Rhodobacter sphaeroides KD131]
          Length = 312

 Score =  563 bits (1453), Expect = e-159,   Method: Composition-based stats.
 Identities = 194/298 (65%), Positives = 234/298 (78%), Gaps = 1/298 (0%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
             SFQ IIL L  YW  +GC +LQPYDMEVGAGTFHP+TTLR+LG   W AAYVQPSRRP
Sbjct: 8   PRSFQEIILRLMTYWGAKGCAVLQPYDMEVGAGTFHPATTLRSLGARPWAAAYVQPSRRP 67

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNRLQHYYQ+QV+IKP+P +LQ LY+ SL+A+GID  +HD+RFVED+WESPT
Sbjct: 68  TDGRYGENPNRLQHYYQYQVLIKPSPPDLQKLYLGSLEAIGIDMDLHDIRFVEDDWESPT 127

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE WCDGME+SQFTYFQQV G +C P+SGE+TYGLERLAMYV  ++ V D+ F
Sbjct: 128 LGAWGLGWEVWCDGMEVSQFTYFQQVGGHDCRPVSGELTYGLERLAMYVLGIDHVMDMPF 187

Query: 190 NAIEGQN-VLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHR 248
           N  +G   + YGD+F Q+EQEYSR+NF+ A+ ++L  HF D+E EC  +L     ++  R
Sbjct: 188 NDPDGPTPLTYGDVFRQTEQEYSRWNFDQADTDMLLQHFRDAEAECERILAAPETDKAGR 247

Query: 249 HHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNGG 306
             +   PAYDQCIKASH+FNLLDARGVIS TERQ YI R+R+LAK C +AF+ T  GG
Sbjct: 248 RIVMAHPAYDQCIKASHLFNLLDARGVISVTERQAYIGRVRALAKKCADAFVSTEAGG 305


>gi|255319851|ref|ZP_05361056.1| glycyl-tRNA synthetase, alpha subunit [Acinetobacter radioresistens
           SK82]
 gi|262380382|ref|ZP_06073536.1| glycyl-tRNA synthetase, alpha subunit [Acinetobacter radioresistens
           SH164]
 gi|255303170|gb|EET82382.1| glycyl-tRNA synthetase, alpha subunit [Acinetobacter radioresistens
           SK82]
 gi|262297828|gb|EEY85743.1| glycyl-tRNA synthetase, alpha subunit [Acinetobacter radioresistens
           SH164]
          Length = 329

 Score =  563 bits (1453), Expect = e-158,   Method: Composition-based stats.
 Identities = 188/293 (64%), Positives = 226/293 (77%), Gaps = 10/293 (3%)

Query: 12  SFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPLD 71
           +FQ +IL L  YWA+QGC +LQPYDME+GAGTFH +T LRALGP +W AAYVQPSRRP D
Sbjct: 10  TFQGLILALQNYWAEQGCVVLQPYDMEMGAGTFHTATFLRALGPETWNAAYVQPSRRPKD 69

Query: 72  GRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTLG 131
           GRY ENPNRLQHYYQFQV++KPNP N+Q LY++SLKA+GID L HD+RFVEDNWESPTLG
Sbjct: 70  GRYGENPNRLQHYYQFQVVLKPNPDNIQQLYLDSLKAIGIDTLTHDIRFVEDNWESPTLG 129

Query: 132 AWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFNA 191
           AWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLERLAMY+Q V+SVYD+V+  
Sbjct: 130 AWGLGWEVWLNGMEVTQFTYFQQVGGVECYPVTGEITYGLERLAMYLQGVDSVYDLVWTK 189

Query: 192 IEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHHL 251
            +   V YGD+F Q+E E S YNFEYA  E L   F   E E   L++  +P        
Sbjct: 190 GQFGTVTYGDVFHQNEVEQSTYNFEYAPVEKLFELFDFYETEASRLMEAELP-------- 241

Query: 252 CVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
              PAY+Q IKASH FNLLDARG IS TERQRYILR+R+LA+A  ++++    
Sbjct: 242 --LPAYEQVIKASHSFNLLDARGAISVTERQRYILRVRTLARAIAQSYVQARA 292


>gi|239831278|ref|ZP_04679607.1| glycyl-tRNA synthetase, alpha subunit [Ochrobactrum intermedium LMG
           3301]
 gi|239823545|gb|EEQ95113.1| glycyl-tRNA synthetase, alpha subunit [Ochrobactrum intermedium LMG
           3301]
          Length = 319

 Score =  563 bits (1452), Expect = e-158,   Method: Composition-based stats.
 Identities = 222/298 (74%), Positives = 258/298 (86%), Gaps = 3/298 (1%)

Query: 12  SFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPLD 71
           SFQ +ILTL  YWA+ GC ILQPYDMEVGAGTFHP+TTLR+LGP  W+AAYVQPSRRP D
Sbjct: 14  SFQGLILTLHNYWAEHGCAILQPYDMEVGAGTFHPATTLRSLGPKPWRAAYVQPSRRPKD 73

Query: 72  GRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTLG 131
           GRY ENPNRLQHYYQ+QVIIKP+P NLQ+LY+ SL+A+G+DP +HDVRFVED+WESPTLG
Sbjct: 74  GRYGENPNRLQHYYQYQVIIKPSPPNLQDLYLGSLRAIGLDPTLHDVRFVEDDWESPTLG 133

Query: 132 AWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFNA 191
           AWGLGWECWCDGME+SQFTYFQQVCGIECSP+SGE+TYGLERLAMYVQ V++VYD+ FN 
Sbjct: 134 AWGLGWECWCDGMEVSQFTYFQQVCGIECSPVSGELTYGLERLAMYVQGVDNVYDLNFNG 193

Query: 192 IEGQ-NVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLK--KGIPNEHHR 248
           +EG   V YG++F Q+EQEYSRYNFE AN E LH HFID+E+EC  +LK     P+ +H+
Sbjct: 194 LEGDEKVTYGEVFLQAEQEYSRYNFEMANTEALHQHFIDAERECEAILKAGAPAPDANHK 253

Query: 249 HHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNGG 306
            H  VFPAYDQCIKASH+FNL+DARGVIS TERQ YILR+R+LA+ CGEAFL+T  GG
Sbjct: 254 MHKSVFPAYDQCIKASHVFNLMDARGVISVTERQSYILRVRNLARQCGEAFLLTDAGG 311


>gi|227115349|ref|ZP_03829005.1| glycyl-tRNA synthetase subunit alpha [Pectobacterium carotovorum
           subsp. brasiliensis PBR1692]
 gi|253690528|ref|YP_003019718.1| glycyl-tRNA synthetase, alpha subunit [Pectobacterium carotovorum
           subsp. carotovorum PC1]
 gi|259511911|sp|C6DII8|SYGA_PECCP RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|251757106|gb|ACT15182.1| glycyl-tRNA synthetase, alpha subunit [Pectobacterium carotovorum
           subsp. carotovorum PC1]
          Length = 304

 Score =  563 bits (1452), Expect = e-158,   Method: Composition-based stats.
 Identities = 186/301 (61%), Positives = 223/301 (74%), Gaps = 8/301 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +ILTL  YWA+QGCTI+QP DMEVGAGT HP T LRALGP    AAYVQ
Sbjct: 1   MQKFDTKTFQGLILTLQDYWARQGCTIVQPLDMEVGAGTSHPMTCLRALGPEPMAAAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQV+IKP+P N+Q LY+ SLK +G+DP IHD+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVVIKPSPDNIQELYLGSLKELGMDPTIHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLERLAMY+Q V+SV
Sbjct: 121 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGLERLAMYIQGVDSV 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V++        YGD+F Q+E E S YNFE+A+ + L + F   EKE   LL    P 
Sbjct: 181 YDLVWSDGPLGKTTYGDVFHQNEVEQSTYNFEHADVDFLFSCFEQYEKEAQHLLALEKP- 239

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY++ +KA+H FNLLDAR  IS TERQRYILRIR+L KA  EA+  +  
Sbjct: 240 -------LPLPAYERILKAAHSFNLLDARKAISVTERQRYILRIRTLTKAVAEAYYASRE 292

Query: 305 G 305
            
Sbjct: 293 A 293


>gi|317046301|ref|YP_004113949.1| glycyl-tRNA synthetase subunit alpha [Pantoea sp. At-9b]
 gi|316947918|gb|ADU67393.1| glycyl-tRNA synthetase, alpha subunit [Pantoea sp. At-9b]
          Length = 303

 Score =  563 bits (1452), Expect = e-158,   Method: Composition-based stats.
 Identities = 187/301 (62%), Positives = 222/301 (73%), Gaps = 8/301 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +ILTL  YWA+QGCTI+QP DMEVGAGT HP T LRALGP    AAYVQ
Sbjct: 1   MQKFDTKTFQGLILTLQDYWARQGCTIVQPLDMEVGAGTSHPMTCLRALGPEPIAAAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQVIIKP+P N+Q LY+ SLK +GIDP +HD+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVIIKPSPDNIQELYLGSLKELGIDPTVHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLERLAMY+Q+V+SV
Sbjct: 121 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGLERLAMYIQSVDSV 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+ ++        YGD+F Q+E E S YNFEYA+ + L   F   EKE   LL    P 
Sbjct: 181 YDLTWSDGPLGKTTYGDVFHQNEVEQSTYNFEYADVDFLFTCFEQYEKEAQHLLALEKP- 239

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY++ +KA+H FNLLDAR  IS TERQRYILRIR+L KA  EA+  +  
Sbjct: 240 -------LPLPAYERILKAAHSFNLLDARKAISVTERQRYILRIRTLTKAVAEAYYASRE 292

Query: 305 G 305
            
Sbjct: 293 A 293


>gi|157368318|ref|YP_001476307.1| glycyl-tRNA synthetase subunit alpha [Serratia proteamaculans 568]
 gi|166980035|sp|A8G7T9|SYGA_SERP5 RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|157320082|gb|ABV39179.1| glycyl-tRNA synthetase, alpha subunit [Serratia proteamaculans 568]
          Length = 304

 Score =  563 bits (1452), Expect = e-158,   Method: Composition-based stats.
 Identities = 186/301 (61%), Positives = 221/301 (73%), Gaps = 8/301 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +ILTL  YWA+QGCTI+QP DMEVGAGT HP T LRALGP     AYVQ
Sbjct: 1   MQKFDTKTFQGLILTLQDYWARQGCTIVQPLDMEVGAGTSHPMTCLRALGPEPMATAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQV+IKP+P N+Q LY+ SLK +G+DP IHD+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVVIKPSPDNIQELYLGSLKELGLDPTIHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLERLAMY+Q V+SV
Sbjct: 121 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGMECKPVTGEITYGLERLAMYIQGVDSV 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V++        YGD+F Q+E E S YNFEYA+ + L + F   EKE   LL    P 
Sbjct: 181 YDLVWSDGPLGVTTYGDVFHQNEVEQSTYNFEYADVDFLFSCFEQYEKEAQSLLALEKP- 239

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY++ +KA H FNLLDAR  IS TERQRYILRIR+L KA  EA+  +  
Sbjct: 240 -------LPLPAYERILKAGHTFNLLDARKAISVTERQRYILRIRTLTKAVAEAYYASRE 292

Query: 305 G 305
            
Sbjct: 293 A 293


>gi|315178616|gb|ADT85530.1| glycyl-tRNA synthetase subunit alpha [Vibrio furnissii NCTC 11218]
          Length = 322

 Score =  563 bits (1452), Expect = e-158,   Method: Composition-based stats.
 Identities = 186/302 (61%), Positives = 221/302 (73%), Gaps = 8/302 (2%)

Query: 4   IHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYV 63
              K +  +FQ +IL L  YWAQQGCTI+QP DMEVGAGT HP T LRALGP     AYV
Sbjct: 17  TMQKYDIKTFQGMILALQDYWAQQGCTIVQPLDMEVGAGTSHPMTCLRALGPEPIATAYV 76

Query: 64  QPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVED 123
           QPSRRP DGRY ENPNRLQHYYQFQVIIKP+P N+Q LY+ SLK +G+DP +HD+RFVED
Sbjct: 77  QPSRRPTDGRYGENPNRLQHYYQFQVIIKPSPDNIQELYLGSLKVLGVDPQVHDIRFVED 136

Query: 124 NWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNS 183
           NWE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYG+ERLAMY+Q V+S
Sbjct: 137 NWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGIERLAMYIQGVDS 196

Query: 184 VYDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIP 243
           VYD+V+       V YGDI+ Q+E E S YNFE+A+ + L   F   EKECL LL    P
Sbjct: 197 VYDLVWTDGPLGKVTYGDIYHQNEVEQSTYNFEHADVDFLFTFFDQCEKECLHLLALEKP 256

Query: 244 NEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTP 303
                      PAY++ +KA H FNLLDAR  IS TERQRYILRIR+L K+  EA+  + 
Sbjct: 257 --------LPLPAYERILKAGHAFNLLDARKAISVTERQRYILRIRNLTKSVAEAYYASR 308

Query: 304 NG 305
             
Sbjct: 309 EA 310


>gi|307822589|ref|ZP_07652820.1| glycyl-tRNA synthetase, alpha subunit [Methylobacter tundripaludum
           SV96]
 gi|307736193|gb|EFO07039.1| glycyl-tRNA synthetase, alpha subunit [Methylobacter tundripaludum
           SV96]
          Length = 304

 Score =  563 bits (1451), Expect = e-158,   Method: Composition-based stats.
 Identities = 179/298 (60%), Positives = 220/298 (73%), Gaps = 10/298 (3%)

Query: 7   KKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPS 66
             +  +FQ +IL L +YW+ QGC +LQP D EVGAGTFHP+T LRA+GP  W AAYVQPS
Sbjct: 5   NNDLSTFQGLILALQKYWSDQGCILLQPLDQEVGAGTFHPATFLRAIGPEPWNAAYVQPS 64

Query: 67  RRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWE 126
           RRP DGR+ ENPNRLQHYYQFQV++KP+P N+Q LY+ SL+ +G+D L HDVRFVEDNWE
Sbjct: 65  RRPTDGRFGENPNRLQHYYQFQVVLKPSPDNIQELYLGSLRHLGLDLLEHDVRFVEDNWE 124

Query: 127 SPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYD 186
           SPTLGAWGLGWE W +GME++QFTYFQQV G+EC PI+GEITYGLER+AMY+Q V SVYD
Sbjct: 125 SPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECRPITGEITYGLERIAMYLQGVKSVYD 184

Query: 187 IVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEH 246
           +V+       V YGD+F Q+E E S YNFE+AN E +   F   E+EC  L++  +P   
Sbjct: 185 LVWTKGPFGTVTYGDVFHQNEVEMSAYNFEHANVEFMFECFNTYEQECTKLIELNLP--- 241

Query: 247 HRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                   PAY+  +KASH FNLLDAR  IS TERQRY+LR+R+LAK+  E +     
Sbjct: 242 -------LPAYEMVLKASHAFNLLDARHAISVTERQRYLLRVRNLAKSVAEVYYQRRE 292


>gi|238783055|ref|ZP_04627082.1| Glycyl-tRNA synthetase alpha subunit [Yersinia bercovieri ATCC
           43970]
 gi|238716056|gb|EEQ08041.1| Glycyl-tRNA synthetase alpha subunit [Yersinia bercovieri ATCC
           43970]
          Length = 304

 Score =  563 bits (1451), Expect = e-158,   Method: Composition-based stats.
 Identities = 187/301 (62%), Positives = 221/301 (73%), Gaps = 8/301 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +ILTL  YWA+QGCTI+QP DMEVGAGT HP T LRALGP    AAYVQ
Sbjct: 1   MQKFDTKTFQGLILTLQDYWARQGCTIVQPLDMEVGAGTSHPMTCLRALGPEPIAAAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQVIIKP+P N+Q LY+ SLK +G+DP IHD+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVIIKPSPDNIQELYLGSLKELGLDPTIHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLERLAMY+Q V+SV
Sbjct: 121 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGLERLAMYIQGVDSV 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+++         YGDI+ Q+E E S YNFEYA+ + L + F   EKE   LL    P 
Sbjct: 181 YDLIWCDGPLGKTTYGDIYHQNEVEQSTYNFEYADVDFLFSCFEQYEKEAKSLLALETP- 239

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY++ +KA H FNLLDAR  IS TERQRYILRIR+L KA  EA+  +  
Sbjct: 240 -------LPLPAYERILKAGHTFNLLDARKAISVTERQRYILRIRTLTKAVAEAYYASRE 292

Query: 305 G 305
            
Sbjct: 293 A 293


>gi|261823643|ref|YP_003261749.1| glycyl-tRNA synthetase subunit alpha [Pectobacterium wasabiae
           WPP163]
 gi|261607656|gb|ACX90142.1| glycyl-tRNA synthetase, alpha subunit [Pectobacterium wasabiae
           WPP163]
          Length = 309

 Score =  563 bits (1451), Expect = e-158,   Method: Composition-based stats.
 Identities = 185/301 (61%), Positives = 222/301 (73%), Gaps = 8/301 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +ILTL  YWA+QGCTI+QP DMEVGAGT HP T LRALGP     AYVQ
Sbjct: 1   MQKFDTKTFQGLILTLQDYWARQGCTIVQPLDMEVGAGTSHPMTCLRALGPEPMATAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQV+IKP+P N+Q LY+ SLK +G+DP IHD+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVVIKPSPENIQELYLGSLKELGMDPTIHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLERLAMY+Q V+SV
Sbjct: 121 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGLERLAMYIQGVDSV 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V++        YGD+F Q+E E S YNFE+A+ + L + F   EKE   LL    P 
Sbjct: 181 YDLVWSDGPLGKTTYGDVFHQNEVEQSTYNFEHADVDFLFSCFEQYEKEAQHLLALEKP- 239

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY++ +KA+H FNLLDAR  IS TERQRYILRIR+L KA  EA+  +  
Sbjct: 240 -------LPLPAYERILKAAHSFNLLDARKAISVTERQRYILRIRTLTKAVAEAYYASRE 292

Query: 305 G 305
            
Sbjct: 293 A 293


>gi|50086258|ref|YP_047768.1| glycyl-tRNA synthetase subunit alpha [Acinetobacter sp. ADP1]
 gi|262280265|ref|ZP_06058049.1| glycyl-tRNA synthetase subunit alpha [Acinetobacter calcoaceticus
           RUH2202]
 gi|293610785|ref|ZP_06693085.1| predicted protein [Acinetobacter sp. SH024]
 gi|299768626|ref|YP_003730652.1| glycyl-tRNA synthetase subunit alpha [Acinetobacter sp. DR1]
 gi|49532234|emb|CAG69946.1| glycyl-tRNA synthetase, alpha chain [Acinetobacter sp. ADP1]
 gi|262258043|gb|EEY76777.1| glycyl-tRNA synthetase subunit alpha [Acinetobacter calcoaceticus
           RUH2202]
 gi|292827129|gb|EFF85494.1| predicted protein [Acinetobacter sp. SH024]
 gi|298698714|gb|ADI89279.1| glycyl-tRNA synthetase subunit alpha [Acinetobacter sp. DR1]
 gi|325123645|gb|ADY83168.1| glycyl-tRNA synthetase subunit alpha [Acinetobacter calcoaceticus
           PHEA-2]
          Length = 325

 Score =  563 bits (1451), Expect = e-158,   Method: Composition-based stats.
 Identities = 186/293 (63%), Positives = 225/293 (76%), Gaps = 10/293 (3%)

Query: 12  SFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPLD 71
           +FQ +IL L  YWA+QGC +LQPYDME+GAGTFH +T LRALGP +W AAYVQPSRRP D
Sbjct: 10  TFQGLILALQNYWAEQGCVVLQPYDMEMGAGTFHTATFLRALGPETWNAAYVQPSRRPKD 69

Query: 72  GRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTLG 131
           GRY ENPNRLQHYYQFQV++KPNP N+Q LY++SLKA+GID L HD+RFVEDNWESPTLG
Sbjct: 70  GRYGENPNRLQHYYQFQVVLKPNPDNIQQLYLDSLKAIGIDTLTHDIRFVEDNWESPTLG 129

Query: 132 AWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFNA 191
           AWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLERLAMY+Q V+SVYD+V+  
Sbjct: 130 AWGLGWEVWLNGMEVTQFTYFQQVGGVECYPVTGEITYGLERLAMYLQGVDSVYDLVWTK 189

Query: 192 IEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHHL 251
            +   V YGD+F Q+E E S YNFEYA  E L   F   E E   L++  +         
Sbjct: 190 GQFGTVTYGDVFHQNEVEQSTYNFEYAPVEKLFELFDFYESEANRLIEAKLS-------- 241

Query: 252 CVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
              PAY+Q +KASH FNLLDARG IS TERQRYILR+R+LA+A  ++++    
Sbjct: 242 --LPAYEQVVKASHTFNLLDARGAISVTERQRYILRVRTLARAIAQSYVQARA 292


>gi|227326602|ref|ZP_03830626.1| glycyl-tRNA synthetase subunit alpha [Pectobacterium carotovorum
           subsp. carotovorum WPP14]
          Length = 304

 Score =  563 bits (1451), Expect = e-158,   Method: Composition-based stats.
 Identities = 186/301 (61%), Positives = 223/301 (74%), Gaps = 8/301 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +ILTL  YWA+QGCTI+QP DMEVGAGT HP T LRALGP    AAYVQ
Sbjct: 1   MQKFDTKTFQGLILTLQDYWARQGCTIVQPLDMEVGAGTSHPMTCLRALGPEPMAAAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQV+IKP+P N+Q LY+ SLK +G+DP IHD+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVVIKPSPENIQELYLGSLKELGMDPTIHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLERLAMY+Q V+SV
Sbjct: 121 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGLERLAMYIQGVDSV 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V++        YGD+F Q+E E S YNFE+A+ + L + F   EKE   LL    P 
Sbjct: 181 YDLVWSDGPLGKTTYGDVFHQNEVEQSTYNFEHADVDFLFSCFEQYEKEAQHLLALEKP- 239

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY++ +KA+H FNLLDAR  IS TERQRYILRIR+L KA  EA+  +  
Sbjct: 240 -------LPLPAYERILKAAHSFNLLDARKAISVTERQRYILRIRTLTKAVAEAYYASRE 292

Query: 305 G 305
            
Sbjct: 293 A 293


>gi|238798357|ref|ZP_04641840.1| Glycyl-tRNA synthetase alpha subunit [Yersinia mollaretii ATCC
           43969]
 gi|238717815|gb|EEQ09648.1| Glycyl-tRNA synthetase alpha subunit [Yersinia mollaretii ATCC
           43969]
          Length = 304

 Score =  563 bits (1451), Expect = e-158,   Method: Composition-based stats.
 Identities = 188/301 (62%), Positives = 222/301 (73%), Gaps = 8/301 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +ILTL  YWA+QGCTI+QP DMEVGAGT HP T LRALGP    AAYVQ
Sbjct: 1   MQKFDTKTFQGLILTLQDYWARQGCTIVQPLDMEVGAGTSHPMTCLRALGPEPIAAAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQVIIKP+P N+Q LY+ SLK +G+DPLIHD+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVIIKPSPDNIQELYLGSLKELGLDPLIHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLERLAMY+Q V+SV
Sbjct: 121 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGLERLAMYIQGVDSV 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+++         YGDI+ Q+E E S YNFEYA+ + L + F   EKE   LL    P 
Sbjct: 181 YDLIWCDGPLGKTTYGDIYHQNEVEQSTYNFEYADVDFLFSCFEQYEKEAKSLLALETP- 239

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY++ +KA H FNLLDAR  IS TERQRYILRIR+L KA  EA+  +  
Sbjct: 240 -------LPLPAYERILKAGHTFNLLDARKAISVTERQRYILRIRTLTKAVAEAYYASRE 292

Query: 305 G 305
            
Sbjct: 293 A 293


>gi|300115243|ref|YP_003761818.1| glycyl-tRNA synthetase subunit alpha [Nitrosococcus watsonii C-113]
 gi|299541180|gb|ADJ29497.1| glycyl-tRNA synthetase, alpha subunit [Nitrosococcus watsonii
           C-113]
          Length = 314

 Score =  563 bits (1451), Expect = e-158,   Method: Composition-based stats.
 Identities = 180/296 (60%), Positives = 220/296 (74%), Gaps = 10/296 (3%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
             +FQ +IL L QYWA+QGC +LQPYDME+GAGTFHP+T LRALGP  W AAYVQPSRRP
Sbjct: 13  PATFQELILRLQQYWAEQGCVLLQPYDMEMGAGTFHPATFLRALGPEPWNAAYVQPSRRP 72

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY +NPNRLQHYYQ+QV++KP+PL +Q LY+ SL+ +GI PL+HD+RFVEDNWESPT
Sbjct: 73  TDGRYGDNPNRLQHYYQYQVVLKPSPLEIQELYLGSLRMLGISPLVHDIRFVEDNWESPT 132

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GMEI+QFTYFQQ  G+EC P++GEITYGLER+AMY+Q V SV+D+V+
Sbjct: 133 LGAWGLGWEVWLNGMEITQFTYFQQAGGLECRPVTGEITYGLERIAMYLQGVGSVFDLVW 192

Query: 190 NAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRH 249
                  V YGD+F Q+E E S YNFE A+ + L   F   E E   L++  +       
Sbjct: 193 TEGPFGRVTYGDVFHQNEVEMSIYNFEQADTKSLFAWFGSCEAESKRLVEAELS------ 246

Query: 250 HLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNG 305
                PAY+  +KASH FNLLDAR  IS TERQRYILR+R+LA+A  EA+L     
Sbjct: 247 ----LPAYEMMLKASHTFNLLDARHAISVTERQRYILRVRALARAVAEAYLARRQA 298


>gi|332163499|ref|YP_004300076.1| glycyl-tRNA synthetase subunit alpha [Yersinia enterocolitica
           subsp. palearctica 105.5R(r)]
 gi|318608000|emb|CBY29498.1| glycyl-tRNA synthetase alpha chain [Yersinia enterocolitica subsp.
           palearctica Y11]
 gi|325667729|gb|ADZ44373.1| glycyl-tRNA synthetase subunit alpha [Yersinia enterocolitica
           subsp. palearctica 105.5R(r)]
 gi|330861719|emb|CBX71893.1| glycyl-tRNA synthetase alpha subunit [Yersinia enterocolitica
           W22703]
          Length = 304

 Score =  562 bits (1450), Expect = e-158,   Method: Composition-based stats.
 Identities = 189/301 (62%), Positives = 223/301 (74%), Gaps = 8/301 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +ILTL  YWA+QGCTI+QP DMEVGAGT HP T LRALGP    AAYVQ
Sbjct: 1   MQKFDTKTFQGLILTLQDYWARQGCTIVQPLDMEVGAGTSHPMTCLRALGPEPIAAAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQVIIKP+P N+Q LY+ SLK +G+DPLIHD+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVIIKPSPDNIQELYLGSLKELGLDPLIHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLERLAMY+Q V+SV
Sbjct: 121 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGLERLAMYIQGVDSV 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V+         YGDI+ Q+E E S YNFEYA+ + L + F   EKE   LL   +P 
Sbjct: 181 YDLVWCDGPLGKTTYGDIYHQNEVEQSTYNFEYADVDFLFSCFEQYEKEAQSLLALEVP- 239

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY++ +KA H FNLLDAR  IS TERQRYILRIR+L KA  EA+  +  
Sbjct: 240 -------LPLPAYERILKAGHTFNLLDARKAISVTERQRYILRIRTLTKAVAEAYYASRE 292

Query: 305 G 305
            
Sbjct: 293 A 293


>gi|251787693|ref|YP_003002414.1| glycyl-tRNA synthetase subunit alpha [Dickeya zeae Ech1591]
 gi|247536314|gb|ACT04935.1| glycyl-tRNA synthetase, alpha subunit [Dickeya zeae Ech1591]
          Length = 304

 Score =  562 bits (1450), Expect = e-158,   Method: Composition-based stats.
 Identities = 188/301 (62%), Positives = 222/301 (73%), Gaps = 8/301 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +ILTL  YWA+QGCTI+QP DMEVGAGT HP T LRALGP    AAYVQ
Sbjct: 1   MQKFDTKTFQGLILTLQDYWARQGCTIVQPLDMEVGAGTSHPMTCLRALGPEPIAAAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQVIIKP+P N+Q LY+ SLK +G+DP IHD+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVIIKPSPDNIQELYLGSLKELGMDPTIHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLERLAMY+Q V+SV
Sbjct: 121 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGLERLAMYIQGVDSV 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V++        YGD+F Q+E E S YNFEYA+ + L   F   EKE   LL    P 
Sbjct: 181 YDLVWSDGPLGKTTYGDVFHQNEVEQSTYNFEYADVDFLFTCFEQYEKEAQQLLALEKP- 239

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY++ +KA+H FNLLDAR  IS TERQRYILRIR+L KA  EA+  +  
Sbjct: 240 -------LPLPAYERILKAAHSFNLLDARKAISVTERQRYILRIRTLTKAVAEAYYASRE 292

Query: 305 G 305
            
Sbjct: 293 A 293


>gi|261344461|ref|ZP_05972105.1| glycyl-tRNA synthetase, alpha subunit [Providencia rustigianii DSM
           4541]
 gi|282567369|gb|EFB72904.1| glycyl-tRNA synthetase, alpha subunit [Providencia rustigianii DSM
           4541]
          Length = 302

 Score =  562 bits (1450), Expect = e-158,   Method: Composition-based stats.
 Identities = 187/301 (62%), Positives = 221/301 (73%), Gaps = 8/301 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +ILTL  YWA+QGCTI+QP DMEVGAGT HP T LRALGP    AAYVQ
Sbjct: 1   MQKFDTKTFQGLILTLQDYWARQGCTIVQPLDMEVGAGTSHPMTCLRALGPEPIAAAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQVIIKP+P N+Q LY+ SLK +G+DP +HD+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVIIKPSPDNIQELYLGSLKELGVDPTVHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLERLAMY+Q V+SV
Sbjct: 121 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGLERLAMYIQGVDSV 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V+         YGDI+ Q+E E S YNFEYAN + L   F + EKE   LL    P 
Sbjct: 181 YDLVWCDGPLGKTTYGDIYHQNEVEQSTYNFEYANVDFLFKCFEEYEKEAQYLLSLETP- 239

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY++ +KA+H FNLLDAR  IS TERQRYILRIR+L K   EA+  +  
Sbjct: 240 -------LPLPAYERILKAAHTFNLLDARKAISVTERQRYILRIRTLTKGVAEAYYASRE 292

Query: 305 G 305
            
Sbjct: 293 A 293


>gi|91791378|ref|YP_561029.1| glycyl-tRNA synthetase subunit alpha [Shewanella denitrificans
           OS217]
 gi|123357288|sp|Q12TC0|SYGA_SHEDO RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|91713380|gb|ABE53306.1| Glycine--tRNA ligase [Shewanella denitrificans OS217]
          Length = 301

 Score =  562 bits (1450), Expect = e-158,   Method: Composition-based stats.
 Identities = 185/302 (61%), Positives = 223/302 (73%), Gaps = 8/302 (2%)

Query: 4   IHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYV 63
           +  K +  +FQ  ILTL +YWAQQGC I+QP DMEVGAGTFHP T LR+LGP    +AYV
Sbjct: 1   MTMKHDVKTFQGFILTLQEYWAQQGCAIVQPLDMEVGAGTFHPQTFLRSLGPEPMSSAYV 60

Query: 64  QPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVED 123
           QPSRRP DGRY ENPNRLQHYYQFQV++KP+P N+Q LY+ SL+A+GID  +HD+RFVED
Sbjct: 61  QPSRRPTDGRYGENPNRLQHYYQFQVVLKPSPDNIQELYLGSLQALGIDTQVHDIRFVED 120

Query: 124 NWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNS 183
           NWESPTLGAWGLGWE W +GME++QFTYFQQV GIECSP++GEITYGLERLAMY+Q V+S
Sbjct: 121 NWESPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGIECSPVTGEITYGLERLAMYIQEVDS 180

Query: 184 VYDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIP 243
           VYD+V+       V YGDIF Q+E E S YNFE+A+ + +   F   EK C  LL    P
Sbjct: 181 VYDLVWTDGPMGRVTYGDIFHQNEVEQSTYNFEHADVDFMFTLFDQCEKMCQHLLSLDKP 240

Query: 244 NEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTP 303
                      PAY+Q +KASH FNLLDAR  IS TERQRYILR+R+++K   E++    
Sbjct: 241 --------LPLPAYEQVMKASHAFNLLDARHAISVTERQRYILRVRAMSKGVAESYYQAR 292

Query: 304 NG 305
             
Sbjct: 293 EA 294


>gi|83594286|ref|YP_428038.1| glycyl-tRNA synthetase subunit alpha [Rhodospirillum rubrum ATCC
           11170]
 gi|123753089|sp|Q2RQ44|SYGA_RHORT RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|83577200|gb|ABC23751.1| Glycine--tRNA ligase [Rhodospirillum rubrum ATCC 11170]
          Length = 295

 Score =  562 bits (1450), Expect = e-158,   Method: Composition-based stats.
 Identities = 201/296 (67%), Positives = 234/296 (79%), Gaps = 15/296 (5%)

Query: 12  SFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPLD 71
           SFQ++IL L Q+WA QGC +LQPYDMEVGAGTFHP+TTLRALGP  WKAAYVQPSRRP D
Sbjct: 6   SFQSLILRLQQFWAAQGCVLLQPYDMEVGAGTFHPATTLRALGPEPWKAAYVQPSRRPTD 65

Query: 72  GRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTLG 131
           GRY ENPNRLQHYYQFQVI+KP+P + Q LY++SL+A+GIDPL HD+RFVED+WESPTLG
Sbjct: 66  GRYGENPNRLQHYYQFQVILKPSPADPQALYLDSLRALGIDPLKHDIRFVEDDWESPTLG 125

Query: 132 AWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFNA 191
           AWGLGWE WCDGME++QFTYFQQV G +C P+  E+TYGLERLAMY+Q V +VYD+ +N 
Sbjct: 126 AWGLGWEVWCDGMEVTQFTYFQQVGGFDCDPVPVEMTYGLERLAMYIQGVENVYDLDYNG 185

Query: 192 IEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHHL 251
                V YGDIF Q E+E+S +NFEYAN E L  HF D+E+EC+ LL KG+P        
Sbjct: 186 A---GVRYGDIFLQGEKEFSAHNFEYANTEALFRHFKDAEEECMALLAKGVP-------- 234

Query: 252 CVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNGGH 307
              PAYDQCIKASH FNLLDARGVIS TER  YI R+R+LAK C E +L     GH
Sbjct: 235 --LPAYDQCIKASHRFNLLDARGVISVTERAAYIGRVRALAKGCCEGWL--RARGH 286


>gi|242237520|ref|YP_002985701.1| glycyl-tRNA synthetase subunit alpha [Dickeya dadantii Ech703]
 gi|242129577|gb|ACS83879.1| glycyl-tRNA synthetase, alpha subunit [Dickeya dadantii Ech703]
          Length = 304

 Score =  562 bits (1450), Expect = e-158,   Method: Composition-based stats.
 Identities = 187/301 (62%), Positives = 222/301 (73%), Gaps = 8/301 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +ILTL  YW++QGCTI+QP DMEVGAGT HP T LRALGP    AAYVQ
Sbjct: 1   MQKFDTKTFQGLILTLQDYWSRQGCTIVQPLDMEVGAGTSHPMTCLRALGPEPIAAAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQVIIKP+P N+Q LY+ SLK +G+DP IHD+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVIIKPSPDNIQELYLGSLKELGMDPTIHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLERLAMY+Q V+SV
Sbjct: 121 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGLERLAMYIQGVDSV 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V++        YGD+F Q+E E S YNFEYA+ + L   F   EKE   LL    P 
Sbjct: 181 YDLVWSDGPLGTTTYGDVFHQNEVEQSTYNFEYADVDFLFTCFEQYEKEAQQLLALEKP- 239

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY++ +KA+H FNLLDAR  IS TERQRYILRIR+L KA  EA+  +  
Sbjct: 240 -------LPLPAYERILKAAHSFNLLDARKAISVTERQRYILRIRTLTKAVAEAYYASRE 292

Query: 305 G 305
            
Sbjct: 293 A 293


>gi|188535521|ref|YP_001909318.1| glycyl-tRNA synthetase subunit alpha [Erwinia tasmaniensis Et1/99]
 gi|238689719|sp|B2VCH0|SYGA_ERWT9 RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|188030563|emb|CAO98458.1| Glycyl-tRNA synthetase alpha chain [Erwinia tasmaniensis Et1/99]
          Length = 303

 Score =  562 bits (1450), Expect = e-158,   Method: Composition-based stats.
 Identities = 187/301 (62%), Positives = 221/301 (73%), Gaps = 8/301 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +ILTL  YWA+QGCTI+QP DMEVGAGT HP T LRALGP     AYVQ
Sbjct: 1   MQKFDTKTFQGLILTLQDYWARQGCTIIQPLDMEVGAGTSHPMTCLRALGPEPTAVAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQVIIKP+P N+Q LY+ SLK +G+DP IHD+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVIIKPSPDNIQELYLGSLKELGMDPTIHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLERLAMY+Q V+SV
Sbjct: 121 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGLERLAMYIQGVDSV 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V++        YGD+F Q+E E S YNFEYA+ + L   F   EKE   LL    P 
Sbjct: 181 YDLVWSDGPLGKTTYGDVFHQNEVEQSTYNFEYADVDFLFTCFEQYEKEAQSLLALEKP- 239

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY++ +KA+H FNLLDAR  IS TERQRYILRIR+L KA  EA+  +  
Sbjct: 240 -------LPLPAYERILKAAHSFNLLDARKAISVTERQRYILRIRTLTKAVAEAYYASRE 292

Query: 305 G 305
            
Sbjct: 293 A 293


>gi|148559667|ref|YP_001258427.1| glycyl-tRNA synthetase subunit alpha [Brucella ovis ATCC 25840]
 gi|225626912|ref|ZP_03784951.1| glycyl-tRNA synthetase, alpha subunit [Brucella ceti str. Cudo]
 gi|261751749|ref|ZP_05995458.1| glycyl-tRNA synthetase alpha subunit [Brucella suis bv. 5 str. 513]
 gi|294851783|ref|ZP_06792456.1| glycyl-tRNA synthetase [Brucella sp. NVSL 07-0026]
 gi|306839900|ref|ZP_07472698.1| glycyl-tRNA synthetase, alpha subunit [Brucella sp. NF 2653]
 gi|306845034|ref|ZP_07477615.1| glycyl-tRNA synthetase, alpha subunit [Brucella sp. BO1]
 gi|148370924|gb|ABQ60903.1| glycyl-tRNA synthetase, alpha subunit [Brucella ovis ATCC 25840]
 gi|225618569|gb|EEH15612.1| glycyl-tRNA synthetase, alpha subunit [Brucella ceti str. Cudo]
 gi|261741502|gb|EEY29428.1| glycyl-tRNA synthetase alpha subunit [Brucella suis bv. 5 str. 513]
 gi|294820372|gb|EFG37371.1| glycyl-tRNA synthetase [Brucella sp. NVSL 07-0026]
 gi|306274666|gb|EFM56455.1| glycyl-tRNA synthetase, alpha subunit [Brucella sp. BO1]
 gi|306405086|gb|EFM61367.1| glycyl-tRNA synthetase, alpha subunit [Brucella sp. NF 2653]
          Length = 316

 Score =  562 bits (1450), Expect = e-158,   Method: Composition-based stats.
 Identities = 224/296 (75%), Positives = 257/296 (86%), Gaps = 2/296 (0%)

Query: 12  SFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPLD 71
           SFQ +ILTL  YWA+ GC ILQPYDMEVGAGTFHP+TTLR+LGP  WKAAYVQPSRRP D
Sbjct: 14  SFQGLILTLHNYWAEHGCAILQPYDMEVGAGTFHPATTLRSLGPKPWKAAYVQPSRRPKD 73

Query: 72  GRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTLG 131
           GRY ENPNRLQHYYQ+QV+IKP+P NLQ+LY+ SLKA+G+DP +HDVRFVED+WESPTLG
Sbjct: 74  GRYGENPNRLQHYYQYQVLIKPSPPNLQDLYLGSLKAIGLDPTLHDVRFVEDDWESPTLG 133

Query: 132 AWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFNA 191
           AWGLGWECWCDGME+SQFTYFQQVCGIECSP++GE+TYGLERLAMYVQ V++VYD+ FN 
Sbjct: 134 AWGLGWECWCDGMEVSQFTYFQQVCGIECSPVAGELTYGLERLAMYVQGVDNVYDLNFNG 193

Query: 192 IEGQ-NVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHH 250
           +EG   V YGD+F Q+EQEYSRYNFE AN E LH HFID+E+EC  +LK G   E+   H
Sbjct: 194 LEGDEKVTYGDVFLQAEQEYSRYNFEMANTETLHQHFIDAERECEAILKAGSTGENSL-H 252

Query: 251 LCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNGG 306
            CVFPAYDQCIKASH+FNL+DARGVIS TERQ YILR+R+LA+ CGEAFL+T  GG
Sbjct: 253 KCVFPAYDQCIKASHVFNLMDARGVISVTERQSYILRVRNLARQCGEAFLLTDAGG 308


>gi|307133196|ref|YP_003885212.1| glycine tRNA synthetase, subunit alpha [Dickeya dadantii 3937]
 gi|306530725|gb|ADN00656.1| glycine tRNA synthetase, alpha subunit [Dickeya dadantii 3937]
          Length = 304

 Score =  562 bits (1450), Expect = e-158,   Method: Composition-based stats.
 Identities = 188/301 (62%), Positives = 222/301 (73%), Gaps = 8/301 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +ILTL  YWA+QGCTI+QP DMEVGAGT HP T LRALGP    AAYVQ
Sbjct: 1   MQKFDTKTFQGLILTLQDYWARQGCTIVQPLDMEVGAGTSHPMTCLRALGPEPIAAAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQVIIKP+P N+Q LY+ SLK +G+DP IHD+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVIIKPSPDNIQELYLGSLKELGMDPTIHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLERLAMY+Q V+SV
Sbjct: 121 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGLERLAMYIQGVDSV 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V++        YGD+F Q+E E S YNFEYA+ + L   F   EKE   LL    P 
Sbjct: 181 YDLVWSNGPLGKTTYGDVFHQNEVEQSTYNFEYADVDFLFTCFEQYEKEAQQLLALEKP- 239

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY++ +KA+H FNLLDAR  IS TERQRYILRIR+L KA  EA+  +  
Sbjct: 240 -------LPLPAYERILKAAHSFNLLDARKAISVTERQRYILRIRTLTKAVAEAYYASRE 292

Query: 305 G 305
            
Sbjct: 293 A 293


>gi|292490091|ref|YP_003532986.1| glycine tRNA synthetase subunit alpha [Erwinia amylovora CFBP1430]
 gi|291555533|emb|CBA24083.1| glycine tRNA synthetase, alpha subunit [Erwinia amylovora CFBP1430]
          Length = 317

 Score =  562 bits (1450), Expect = e-158,   Method: Composition-based stats.
 Identities = 187/301 (62%), Positives = 221/301 (73%), Gaps = 8/301 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +ILTL  YWA+QGCTI+QP DMEVGAGT HP T LRALGP     AYVQ
Sbjct: 15  MQKFDTKTFQGLILTLQDYWARQGCTIIQPLDMEVGAGTSHPMTCLRALGPEPTAVAYVQ 74

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQVIIKP+P N+Q LY+ SLK +G+DP IHD+RFVEDN
Sbjct: 75  PSRRPTDGRYGENPNRLQHYYQFQVIIKPSPDNIQELYLGSLKELGMDPTIHDIRFVEDN 134

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLERLAMY+Q V+SV
Sbjct: 135 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGLERLAMYIQGVDSV 194

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V++        YGD+F Q+E E S YNFEYA+ + L   F   EKE   LL    P 
Sbjct: 195 YDLVWSDGPLGKTTYGDVFHQNEVEQSTYNFEYADVDFLFPCFEQYEKEAQSLLALEKP- 253

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY++ +KA+H FNLLDAR  IS TERQRYILRIR+L KA  EA+  +  
Sbjct: 254 -------LPLPAYERILKAAHSFNLLDARKAISVTERQRYILRIRTLTKAVAEAYYASRE 306

Query: 305 G 305
            
Sbjct: 307 A 307


>gi|17987813|ref|NP_540447.1| glycyl-tRNA synthetase subunit alpha [Brucella melitensis bv. 1
           str. 16M]
 gi|189023641|ref|YP_001934409.1| glycyl-tRNA synthetase subunit alpha [Brucella abortus S19]
 gi|237814876|ref|ZP_04593874.1| glycyl-tRNA synthetase, alpha subunit [Brucella abortus str. 2308
           A]
 gi|297247803|ref|ZP_06931521.1| glycyl-tRNA synthetase, alpha subunit [Brucella abortus bv. 5 str.
           B3196]
 gi|17983539|gb|AAL52711.1| glycyl-tRNA synthetase alpha chain [Brucella melitensis bv. 1 str.
           16M]
 gi|189019213|gb|ACD71935.1| Glycyl-tRNA synthetase alpha subunit [Brucella abortus S19]
 gi|237789713|gb|EEP63923.1| glycyl-tRNA synthetase, alpha subunit [Brucella abortus str. 2308
           A]
 gi|297174972|gb|EFH34319.1| glycyl-tRNA synthetase, alpha subunit [Brucella abortus bv. 5 str.
           B3196]
          Length = 316

 Score =  562 bits (1450), Expect = e-158,   Method: Composition-based stats.
 Identities = 224/296 (75%), Positives = 257/296 (86%), Gaps = 2/296 (0%)

Query: 12  SFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPLD 71
           SFQ +ILTL  YWA+ GC ILQPYDMEVGAGTFHP+TTLR+LGP  WKAAYVQPSRRP D
Sbjct: 14  SFQGLILTLHNYWAEHGCAILQPYDMEVGAGTFHPATTLRSLGPKPWKAAYVQPSRRPKD 73

Query: 72  GRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTLG 131
           GRY ENPNRLQHYYQ+QV+IKP+P NLQ+LY+ SLKA+G+DP +HDVRFVED+WESPTLG
Sbjct: 74  GRYGENPNRLQHYYQYQVLIKPSPPNLQDLYLGSLKAIGLDPTLHDVRFVEDDWESPTLG 133

Query: 132 AWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFNA 191
           AWGLGWECWCDGME+SQFTYFQQVCGIECSP++GE+TYGLERLAMYVQ V++VYD+ FN 
Sbjct: 134 AWGLGWECWCDGMEVSQFTYFQQVCGIECSPVAGELTYGLERLAMYVQGVDNVYDLNFNG 193

Query: 192 IEGQ-NVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHH 250
           +EG   V YGD+F Q+EQEYSRYNFE AN E LH HFID+E+EC  +LK G   E+   H
Sbjct: 194 LEGDEKVTYGDVFLQAEQEYSRYNFEMANTETLHQHFIDAERECEAILKAGSTGENSL-H 252

Query: 251 LCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNGG 306
            CVFPAYDQCIKASH+FNL+DARGVIS TERQ YILR+R+LA+ CGEAFL+T  GG
Sbjct: 253 KCVFPAYDQCIKASHVFNLMDARGVISVTERQGYILRVRNLARQCGEAFLLTDAGG 308


>gi|153007866|ref|YP_001369081.1| glycyl-tRNA synthetase subunit alpha [Ochrobactrum anthropi ATCC
           49188]
 gi|166200190|sp|A6WW98|SYGA_OCHA4 RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|151559754|gb|ABS13252.1| glycyl-tRNA synthetase, alpha subunit [Ochrobactrum anthropi ATCC
           49188]
          Length = 311

 Score =  562 bits (1450), Expect = e-158,   Method: Composition-based stats.
 Identities = 223/298 (74%), Positives = 257/298 (86%), Gaps = 3/298 (1%)

Query: 12  SFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPLD 71
           SFQ +ILTL  YWA+ GC ILQPYDMEVGAGTFHP+TTLR+LGP  WKAAYVQPSRRP D
Sbjct: 6   SFQGLILTLHNYWAEHGCAILQPYDMEVGAGTFHPATTLRSLGPKPWKAAYVQPSRRPKD 65

Query: 72  GRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTLG 131
           GRY ENPNRLQHYYQ+QVIIKP+P NLQ+LY+ SL+A+G+DP +HDVRFVED+WESPTLG
Sbjct: 66  GRYGENPNRLQHYYQYQVIIKPSPPNLQDLYLGSLRAIGLDPTLHDVRFVEDDWESPTLG 125

Query: 132 AWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFNA 191
           AWGLGWECWCDGME+SQFTYFQQVCGIECSP+SGE+TYGLERLAMYVQ V++VYD+ FN 
Sbjct: 126 AWGLGWECWCDGMEVSQFTYFQQVCGIECSPVSGELTYGLERLAMYVQGVDNVYDLNFNG 185

Query: 192 IEGQ-NVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLK--KGIPNEHHR 248
           +EG   V YG++F Q+EQEYSRYNFE AN E L  HFID+E+EC  +LK     PN +H+
Sbjct: 186 LEGDEKVTYGEVFLQAEQEYSRYNFEMANTEALRQHFIDAERECEAILKAGAPGPNANHQ 245

Query: 249 HHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNGG 306
            H  VFPAYDQCIKASH+FNL+DARGVIS TERQ YILR+R+LA+ CGEAFL+T  GG
Sbjct: 246 MHKSVFPAYDQCIKASHVFNLMDARGVISVTERQSYILRVRNLARQCGEAFLLTDAGG 303


>gi|283480369|emb|CAY76285.1| glycine tRNA synthetase, alpha subunit [Erwinia pyrifoliae DSM
           12163]
 gi|310765833|gb|ADP10783.1| glycine tRNA synthetase, alpha subunit [Erwinia sp. Ejp617]
          Length = 317

 Score =  562 bits (1450), Expect = e-158,   Method: Composition-based stats.
 Identities = 187/301 (62%), Positives = 222/301 (73%), Gaps = 8/301 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +ILTL  YWA+QGCTI+QP DMEVGAGT HP T LRALGP     AYVQ
Sbjct: 15  MQKFDTKTFQGLILTLQDYWARQGCTIIQPLDMEVGAGTSHPMTCLRALGPEPTAVAYVQ 74

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQVIIKP+P N+Q LY+ SL+ +G+DP IHD+RFVEDN
Sbjct: 75  PSRRPTDGRYGENPNRLQHYYQFQVIIKPSPDNIQELYLGSLQELGMDPTIHDIRFVEDN 134

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLERLAMY+Q V+SV
Sbjct: 135 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGLERLAMYIQGVDSV 194

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V++        YGD+F Q+E E S YNFEYA+ + L   F   EKE L LL    P 
Sbjct: 195 YDLVWSDGPLGKTTYGDVFHQNEVEQSTYNFEYADVDFLFTCFEQYEKEALSLLALEKP- 253

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY++ +KA+H FNLLDAR  IS TERQRYILRIR+L KA  EA+  +  
Sbjct: 254 -------LPLPAYERILKAAHSFNLLDARKAISVTERQRYILRIRTLTKAVAEAYYASRE 306

Query: 305 G 305
            
Sbjct: 307 A 307


>gi|110832870|ref|YP_691729.1| glycyl-tRNA synthetase subunit alpha [Alcanivorax borkumensis SK2]
 gi|110645981|emb|CAL15457.1| glycyl-tRNA synthetase [Alcanivorax borkumensis SK2]
          Length = 334

 Score =  562 bits (1449), Expect = e-158,   Method: Composition-based stats.
 Identities = 182/299 (60%), Positives = 227/299 (75%), Gaps = 10/299 (3%)

Query: 7   KKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPS 66
           + + L+FQ +IL L QYWA+QGC ++QP DMEVGAGTFHPST LRA+GP +W +AYVQPS
Sbjct: 6   QTDILTFQGLILALQQYWAEQGCVVVQPLDMEVGAGTFHPSTFLRAIGPENWNSAYVQPS 65

Query: 67  RRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWE 126
           RRP DGRY ENPNRLQHYYQFQV++KP+P N+Q LY+ SL+ +G DPL+HD+RFVEDNWE
Sbjct: 66  RRPTDGRYGENPNRLQHYYQFQVVLKPSPDNIQELYLGSLRMLGFDPLVHDIRFVEDNWE 125

Query: 127 SPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYD 186
           SPTLGAWGLGWE W +GME++QFTYFQQV GI+C P++GEITYGLERLAMY+Q V+SVYD
Sbjct: 126 SPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGIDCYPVTGEITYGLERLAMYIQGVDSVYD 185

Query: 187 IVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEH 246
           +V++      V YGD+F Q+E E S +NFE+AN + L   F   E E   L+  G+P   
Sbjct: 186 LVWSDGPFGKVTYGDVFLQNEVEMSTFNFEHANVDELFKQFDLFEGESSKLIDAGLP--- 242

Query: 247 HRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNG 305
                   PAY+  +KASH FNLLDAR  IS TERQR+ILR+R+LA+A  +A+      
Sbjct: 243 -------LPAYEYVLKASHTFNLLDARKAISVTERQRFILRVRTLARAVAQAYFDKRRA 294


>gi|220924242|ref|YP_002499544.1| glycyl-tRNA synthetase subunit alpha [Methylobacterium nodulans ORS
           2060]
 gi|219948849|gb|ACL59241.1| glycyl-tRNA synthetase, alpha subunit [Methylobacterium nodulans
           ORS 2060]
          Length = 314

 Score =  562 bits (1449), Expect = e-158,   Method: Composition-based stats.
 Identities = 211/300 (70%), Positives = 243/300 (81%), Gaps = 2/300 (0%)

Query: 8   KNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSR 67
           K   SFQ +ILTL ++WA QGC ILQPYDMEVGAGTFHP+TTLRALGP  WKAAYVQPSR
Sbjct: 9   KPTRSFQGLILTLQRFWAAQGCVILQPYDMEVGAGTFHPATTLRALGPRPWKAAYVQPSR 68

Query: 68  RPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWES 127
           RP DGRY ENPNRLQHYYQFQV++KPNP NLQ LY+ SL+A+G+D  +HD+RFVED+WES
Sbjct: 69  RPKDGRYGENPNRLQHYYQFQVVLKPNPPNLQELYLASLQAIGVDLKLHDIRFVEDDWES 128

Query: 128 PTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDI 187
           PTLGAWGLGWECWCDGME+SQFTYFQQV G EC+P+SGE+TYGLERLAMYVQ V +VYD+
Sbjct: 129 PTLGAWGLGWECWCDGMEVSQFTYFQQVAGFECAPVSGELTYGLERLAMYVQGVENVYDL 188

Query: 188 VFNAIEG-QNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEH 246
            FN ++G   V YGD+F Q+EQEYSR+NFE A+ E+L   F D+E  C   L+ G     
Sbjct: 189 NFNGLDGPDRVTYGDVFLQAEQEYSRHNFETADTEMLFRQFRDAEAACRQYLEAGDAGPE 248

Query: 247 HRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNGG 306
            + H    PAYDQCIKASH+FNLLDARGVIS TERQ YILR+R LAKACG A+L T  GG
Sbjct: 249 AQ-HRMAQPAYDQCIKASHVFNLLDARGVISVTERQSYILRVRDLAKACGAAWLRTEAGG 307


>gi|93006880|ref|YP_581317.1| glycyl-tRNA synthetase subunit alpha [Psychrobacter cryohalolentis
           K5]
 gi|92394558|gb|ABE75833.1| Glycine--tRNA ligase [Psychrobacter cryohalolentis K5]
          Length = 350

 Score =  562 bits (1449), Expect = e-158,   Method: Composition-based stats.
 Identities = 185/302 (61%), Positives = 228/302 (75%), Gaps = 10/302 (3%)

Query: 3   PIHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAY 62
                   ++FQ++I+TL  YWA +GC ILQPYDMEVGAGTFH +T LR+LGP  W AAY
Sbjct: 19  TQEKDSQPMTFQDLIMTLQNYWADKGCVILQPYDMEVGAGTFHTATFLRSLGPERWNAAY 78

Query: 63  VQPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVE 122
           VQPSRRP DGRY +NPNRLQHYYQFQV++KPNPLN+Q LY+ SL+A+GIDPL+HDVRFVE
Sbjct: 79  VQPSRRPTDGRYGDNPNRLQHYYQFQVVLKPNPLNIQELYLGSLEAIGIDPLVHDVRFVE 138

Query: 123 DNWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVN 182
           DNWESPTLGAWGLGWE W +GME++QFTYFQQV GIEC P++GEITYGLERLAMYVQ V+
Sbjct: 139 DNWESPTLGAWGLGWEIWLNGMEVTQFTYFQQVGGIECFPVTGEITYGLERLAMYVQGVD 198

Query: 183 SVYDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGI 242
           SVYD+V+   E   V YGD+F Q+E E S YNFE+A+  ++   F   E++   L+ +G+
Sbjct: 199 SVYDLVWADGEFGRVTYGDVFHQNEVEQSTYNFEHADVPMMGQMFDFYEQQADKLVAEGL 258

Query: 243 PNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMT 302
           P           PAY+  +KASH FNLLDARG IS TERQR+ILR+R+LA+     ++  
Sbjct: 259 P----------LPAYEMVLKASHAFNLLDARGAISVTERQRFILRVRTLARKVAIGYVEA 308

Query: 303 PN 304
             
Sbjct: 309 RA 310


>gi|271498622|ref|YP_003331647.1| glycyl-tRNA synthetase subunit alpha [Dickeya dadantii Ech586]
 gi|270342177|gb|ACZ74942.1| glycyl-tRNA synthetase, alpha subunit [Dickeya dadantii Ech586]
          Length = 304

 Score =  562 bits (1449), Expect = e-158,   Method: Composition-based stats.
 Identities = 187/301 (62%), Positives = 222/301 (73%), Gaps = 8/301 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +ILTL  YW++QGCTI+QP DMEVGAGT HP T LRALGP    AAYVQ
Sbjct: 1   MQKFDTKTFQGLILTLQDYWSRQGCTIVQPLDMEVGAGTSHPMTCLRALGPEPIAAAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQVIIKP+P N+Q LY+ SLK +G+DP IHD+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVIIKPSPDNIQELYLGSLKELGMDPTIHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLERLAMY+Q V+SV
Sbjct: 121 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGLERLAMYIQGVDSV 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V++        YGD+F Q+E E S YNFEYA+ + L   F   EKE   LL    P 
Sbjct: 181 YDLVWSDGPLGKTTYGDVFHQNEVEQSTYNFEYADVDFLFTCFEQYEKEAQQLLALEKP- 239

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY++ +KA+H FNLLDAR  IS TERQRYILRIR+L KA  EA+  +  
Sbjct: 240 -------LPLPAYERILKAAHSFNLLDARKAISVTERQRYILRIRTLTKAVAEAYYASRE 292

Query: 305 G 305
            
Sbjct: 293 A 293


>gi|115526404|ref|YP_783315.1| glycyl-tRNA synthetase subunit alpha [Rhodopseudomonas palustris
           BisA53]
 gi|115520351|gb|ABJ08335.1| Glycine--tRNA ligase [Rhodopseudomonas palustris BisA53]
          Length = 320

 Score =  562 bits (1449), Expect = e-158,   Method: Composition-based stats.
 Identities = 204/302 (67%), Positives = 243/302 (80%), Gaps = 1/302 (0%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
            + + + SFQ +IL L +YWA  GC ILQPYDMEVGAGTFHP+TTLRALGP  W AAYVQ
Sbjct: 6   PHMRPERSFQGLILALQRYWADHGCVILQPYDMEVGAGTFHPATTLRALGPKHWNAAYVQ 65

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQVI+KP+P ++Q+LY++SL A+G+D  +HD+RFVED+
Sbjct: 66  PSRRPKDGRYGENPNRLQHYYQFQVILKPSPPDIQDLYLKSLAAIGVDAHLHDIRFVEDD 125

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WESPTLGAWGLGWECWCDGME+SQFTYFQQV G+EC+P++GE+TYGLERLAMYVQ V+ V
Sbjct: 126 WESPTLGAWGLGWECWCDGMEVSQFTYFQQVAGVECAPVAGELTYGLERLAMYVQGVDRV 185

Query: 185 YDIVFNAIEG-QNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIP 243
           YD+ FN  +G   V YGD+F Q+EQEYSR+NFE+++ E+L   F  +E  C   L  G  
Sbjct: 186 YDLNFNGRDGADKVTYGDVFLQAEQEYSRHNFEHSDAEMLFEQFKMAEAACQKYLAAGWK 245

Query: 244 NEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTP 303
           +E    HL   PAYDQCIKASH FNLLDARGVIS TERQ YILR+R LAKACGEA++ T 
Sbjct: 246 DEKREAHLMALPAYDQCIKASHAFNLLDARGVISVTERQSYILRVRELAKACGEAWVHTE 305

Query: 304 NG 305
            G
Sbjct: 306 AG 307


>gi|293393756|ref|ZP_06638063.1| glycyl-tRNA synthetase [Serratia odorifera DSM 4582]
 gi|291423583|gb|EFE96805.1| glycyl-tRNA synthetase [Serratia odorifera DSM 4582]
          Length = 304

 Score =  562 bits (1449), Expect = e-158,   Method: Composition-based stats.
 Identities = 186/301 (61%), Positives = 221/301 (73%), Gaps = 8/301 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +ILTL  YWA+QGCTI+QP DMEVGAGT HP T LRALGP     AYVQ
Sbjct: 1   MQKFDTKTFQGLILTLQDYWARQGCTIVQPLDMEVGAGTSHPMTCLRALGPEPMATAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQV+IKP+P N+Q LY+ SLK +G+DP IHD+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVVIKPSPENIQELYLGSLKELGLDPTIHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLERLAMY+Q V+SV
Sbjct: 121 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGLERLAMYIQGVDSV 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V++        YGD+F Q+E E S YNFEYA+ + L   F   EKE   LL    P 
Sbjct: 181 YDLVWSNGPLGITTYGDVFHQNEVEQSTYNFEYADVDFLFTCFEHYEKEAQQLLALEKP- 239

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY++ +KA+H FNLLDAR  IS TERQRYILRIR+L KA  EA+  +  
Sbjct: 240 -------LPLPAYERILKAAHTFNLLDARKAISVTERQRYILRIRTLTKAVAEAYYASRE 292

Query: 305 G 305
            
Sbjct: 293 A 293


>gi|156936269|ref|YP_001440185.1| glycyl-tRNA synthetase subunit alpha [Cronobacter sakazakii ATCC
           BAA-894]
 gi|260599859|ref|YP_003212430.1| glycyl-tRNA synthetase subunit alpha [Cronobacter turicensis z3032]
 gi|166200189|sp|A7MKR9|SYGA_ENTS8 RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|156534523|gb|ABU79349.1| hypothetical protein ESA_04168 [Cronobacter sakazakii ATCC BAA-894]
 gi|260219036|emb|CBA34391.1| Glycyl-tRNA synthetase alpha subunit [Cronobacter turicensis z3032]
          Length = 303

 Score =  562 bits (1449), Expect = e-158,   Method: Composition-based stats.
 Identities = 188/301 (62%), Positives = 222/301 (73%), Gaps = 8/301 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +ILTL  YWA+QGCTI+QP DMEVGAGT HP T LRALGP    AAYVQ
Sbjct: 1   MQKFDTRTFQGLILTLQDYWARQGCTIVQPLDMEVGAGTSHPMTCLRALGPEPIAAAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQVIIKP+P N+Q LY+ SLK +G+DP IHD+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVIIKPSPDNIQELYLGSLKELGMDPTIHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLERLAMY+Q V+SV
Sbjct: 121 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGLERLAMYIQGVDSV 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V++        YGD+F Q+E E S YNFEYA+ + L   F   EKE   LL    P 
Sbjct: 181 YDLVWSDGPLGKTTYGDVFHQNEVEQSTYNFEYADVDFLFTCFEQYEKEAQQLLALENP- 239

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY++ +KA+H FNLLDAR  IS TERQRYILRIR+L KA  EA+  +  
Sbjct: 240 -------LPLPAYERILKAAHSFNLLDARKAISVTERQRYILRIRTLTKAVAEAYYASRE 292

Query: 305 G 305
            
Sbjct: 293 A 293


>gi|238765094|ref|ZP_04626029.1| Glycyl-tRNA synthetase alpha subunit [Yersinia kristensenii ATCC
           33638]
 gi|238696711|gb|EEP89493.1| Glycyl-tRNA synthetase alpha subunit [Yersinia kristensenii ATCC
           33638]
          Length = 304

 Score =  562 bits (1449), Expect = e-158,   Method: Composition-based stats.
 Identities = 188/301 (62%), Positives = 223/301 (74%), Gaps = 8/301 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +ILTL  YWA+QGCTI+QP DMEVGAGT HP T LRALGP    AAYVQ
Sbjct: 1   MQKFDTKTFQGLILTLQDYWARQGCTIVQPLDMEVGAGTSHPMTCLRALGPEPIAAAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQVIIKP+P N+Q LY+ SLK +G+DPLIHD+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVIIKPSPDNIQELYLGSLKELGLDPLIHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLERLAMY+Q V+SV
Sbjct: 121 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGLERLAMYIQGVDSV 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+++         YGDI+ Q+E E S YNFEYA+ + L + F   EKE   LL   +P 
Sbjct: 181 YDLIWCDGPLGKTTYGDIYHQNEVEQSTYNFEYADVDFLFSCFEQYEKEAQSLLALEVP- 239

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY++ +KA H FNLLDAR  IS TERQRYILRIR+L KA  EA+  +  
Sbjct: 240 -------LPLPAYERILKAGHTFNLLDARKAISVTERQRYILRIRTLTKAVAEAYYASRE 292

Query: 305 G 305
            
Sbjct: 293 A 293


>gi|253987710|ref|YP_003039066.1| glycyl-tRNA synthetase subunit alpha [Photorhabdus asymbiotica
           subsp. asymbiotica ATCC 43949]
 gi|253779160|emb|CAQ82320.1| glycyl-tRNA synthetase alpha chain [Photorhabdus asymbiotica]
          Length = 304

 Score =  562 bits (1449), Expect = e-158,   Method: Composition-based stats.
 Identities = 187/301 (62%), Positives = 221/301 (73%), Gaps = 8/301 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +ILTL  YWA+QGCTI+QP DMEVGAGT HP T LRALGP    AAYVQ
Sbjct: 1   MQKFDTKTFQGLILTLQDYWARQGCTIVQPLDMEVGAGTSHPITCLRALGPEPIAAAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQVIIKP+P N+Q LY+ SLK +G+DP +HD+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVIIKPSPDNIQELYLGSLKELGLDPTVHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLERLAMY+Q V+SV
Sbjct: 121 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGLERLAMYIQGVDSV 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V+         YGDI+ Q+E E S YNFE+A+ + L   F   EKE  DLL    P 
Sbjct: 181 YDLVWCDGLLGKTTYGDIYHQNEVEQSTYNFEHADVDFLFTCFEQYEKEAQDLLALETP- 239

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY++ +KA H FNLLDAR  IS TERQRYILRIR+L KA  EA+  +  
Sbjct: 240 -------LPLPAYERILKAGHTFNLLDARKAISVTERQRYILRIRTLTKAVAEAYYASRE 292

Query: 305 G 305
            
Sbjct: 293 A 293


>gi|71066329|ref|YP_265056.1| glycyl-tRNA synthetase subunit alpha [Psychrobacter arcticus 273-4]
 gi|71039314|gb|AAZ19622.1| glycyl-tRNA synthetase, alpha subunit [Psychrobacter arcticus
           273-4]
          Length = 329

 Score =  562 bits (1449), Expect = e-158,   Method: Composition-based stats.
 Identities = 184/294 (62%), Positives = 227/294 (77%), Gaps = 10/294 (3%)

Query: 11  LSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPL 70
           ++FQ++I+TL  YWA +GC ILQPYDMEVGAGTFH +T LR+LGP  W AAYVQPSRRP 
Sbjct: 1   MTFQDLIITLQNYWADKGCVILQPYDMEVGAGTFHTATFLRSLGPERWNAAYVQPSRRPT 60

Query: 71  DGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTL 130
           DGRY +NPNRLQHYYQFQV++KPNP N+Q LY+ SL+A+GIDPL+HDVRFVEDNWESPTL
Sbjct: 61  DGRYGDNPNRLQHYYQFQVVLKPNPPNIQELYLGSLEAIGIDPLVHDVRFVEDNWESPTL 120

Query: 131 GAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFN 190
           GAWGLGWE W +GME++QFTYFQQV GIEC P++GEITYGLERLAMYVQ V+SVYD+V+ 
Sbjct: 121 GAWGLGWEIWLNGMEVTQFTYFQQVGGIECFPVTGEITYGLERLAMYVQGVDSVYDLVWA 180

Query: 191 AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHH 250
             E   V YGD+F Q+E E S YNFE+A+  ++   F   E++   L++ G+P       
Sbjct: 181 DGEFGRVTYGDVFHQNEVEQSTYNFEHADVPMMGQMFDFYEQQADKLVEAGLP------- 233

Query: 251 LCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
               PAY+  +KASH FNLLDARG IS TERQR+ILR+R+LA+     ++    
Sbjct: 234 ---LPAYEMVLKASHAFNLLDARGAISVTERQRFILRVRTLARKVAFGYVEARA 284


>gi|209964966|ref|YP_002297881.1| glycyl-tRNA synthetase subunit alpha [Rhodospirillum centenum SW]
 gi|209958432|gb|ACI99068.1| glycyl-tRNA synthetase, alpha subunit GlyQ [Rhodospirillum centenum
           SW]
          Length = 299

 Score =  561 bits (1448), Expect = e-158,   Method: Composition-based stats.
 Identities = 199/301 (66%), Positives = 239/301 (79%), Gaps = 13/301 (4%)

Query: 1   MAPIHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKA 60
           MA   + +  LSFQ +ILTL Q+W++QGC ILQPYDMEVGAGTFHP+TTLRALGP  W A
Sbjct: 1   MAATGDGRKPLSFQGLILTLQQFWSRQGCLILQPYDMEVGAGTFHPATTLRALGPDPWNA 60

Query: 61  AYVQPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRF 120
           AYVQPSRRP DGRY ENPNRLQHYYQFQV++KP+P ++Q+LY+ESL+ +GIDP +HD+RF
Sbjct: 61  AYVQPSRRPKDGRYGENPNRLQHYYQFQVMMKPSPADIQDLYLESLRTIGIDPDLHDIRF 120

Query: 121 VEDNWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQN 180
           VED+WESPTLGAWGLGWE WCDGME++QFTYFQQV GIEC P++ E+TYGLERL MY+Q 
Sbjct: 121 VEDDWESPTLGAWGLGWEVWCDGMEVTQFTYFQQVGGIECDPVAAELTYGLERLCMYLQG 180

Query: 181 VNSVYDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKK 240
           V +VYD+ FN      V YGD+F ++E EYS +NFEYA+ E+L  HF D+E EC  LL+K
Sbjct: 181 VENVYDLAFNDH---GVKYGDVFKRAEIEYSAHNFEYADTEMLFRHFQDAETECRALLEK 237

Query: 241 GIPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFL 300
           G+            PAYDQCIKASH FNLLDARGVIS  ERQ YILR+R +A+ C EA+L
Sbjct: 238 GL----------ALPAYDQCIKASHRFNLLDARGVISVVERQSYILRVREMARRCCEAWL 287

Query: 301 M 301
            
Sbjct: 288 A 288


>gi|238754023|ref|ZP_04615382.1| Glycyl-tRNA synthetase alpha subunit [Yersinia ruckeri ATCC 29473]
 gi|238707775|gb|EEQ00134.1| Glycyl-tRNA synthetase alpha subunit [Yersinia ruckeri ATCC 29473]
          Length = 304

 Score =  561 bits (1448), Expect = e-158,   Method: Composition-based stats.
 Identities = 188/301 (62%), Positives = 221/301 (73%), Gaps = 8/301 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +ILTL  YWA+QGCTI+QP DMEVGAGT HP T LRALGP    AAYVQ
Sbjct: 1   MQKFDTKTFQGLILTLQDYWARQGCTIVQPLDMEVGAGTSHPMTCLRALGPEPIAAAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQVIIKP+P N+Q LY+ SLK +G+DP IHD+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVIIKPSPDNIQELYLGSLKELGLDPTIHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLERLAMY+Q V+SV
Sbjct: 121 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGLERLAMYIQGVDSV 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V+         YGDI+ Q+E E S YNFEYA+ + L + F   EKE   LL    P 
Sbjct: 181 YDLVWCDGPLGKTTYGDIYHQNEVEQSTYNFEYADVDFLFSCFEQYEKEAQSLLALENP- 239

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY++ +KA H FNLLDAR  IS TERQRYILRIR+L KA  EA+  +  
Sbjct: 240 -------LPLPAYERILKAGHTFNLLDARKAISVTERQRYILRIRTLTKAVAEAYYASRE 292

Query: 305 G 305
            
Sbjct: 293 A 293


>gi|123444320|ref|YP_001008286.1| glycyl-tRNA synthetase subunit alpha [Yersinia enterocolitica
           subsp. enterocolitica 8081]
 gi|166227906|sp|A1JT51|SYGA_YERE8 RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|122091281|emb|CAL14167.1| glycyl-tRNA synthetase alpha subunit [Yersinia enterocolitica
           subsp. enterocolitica 8081]
          Length = 304

 Score =  561 bits (1448), Expect = e-158,   Method: Composition-based stats.
 Identities = 188/301 (62%), Positives = 223/301 (74%), Gaps = 8/301 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +ILTL  YWA+QGCTI+QP DMEVGAGT HP T LRALGP    AAYVQ
Sbjct: 1   MQKFDTKTFQGLILTLQDYWARQGCTIVQPLDMEVGAGTSHPMTCLRALGPEPIAAAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQVIIKP+P N+Q LY+ SLK +G+DPLIHD+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVIIKPSPDNIQELYLGSLKELGLDPLIHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLERLAMY+Q V+SV
Sbjct: 121 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGLERLAMYIQGVDSV 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+++         YGDI+ Q+E E S YNFEYA+ + L + F   EKE   LL   +P 
Sbjct: 181 YDLIWCDGPLGTTTYGDIYHQNEVEQSTYNFEYADVDFLFSCFEQYEKEAQSLLALEVP- 239

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY++ +KA H FNLLDAR  IS TERQRYILRIR+L KA  EA+  +  
Sbjct: 240 -------LPLPAYERILKAGHTFNLLDARKAISVTERQRYILRIRTLTKAVAEAYYASRE 292

Query: 305 G 305
            
Sbjct: 293 A 293


>gi|260427772|ref|ZP_05781751.1| glycyl-tRNA synthetase, alpha subunit [Citreicella sp. SE45]
 gi|260422264|gb|EEX15515.1| glycyl-tRNA synthetase, alpha subunit [Citreicella sp. SE45]
          Length = 309

 Score =  561 bits (1448), Expect = e-158,   Method: Composition-based stats.
 Identities = 198/301 (65%), Positives = 237/301 (78%), Gaps = 2/301 (0%)

Query: 9   NDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRR 68
              SFQ IIL L  YWA +GC +LQPYDMEVGAGTFHP+TTLRALG   W AAYVQPSRR
Sbjct: 7   KPRSFQEIILRLQTYWASKGCAVLQPYDMEVGAGTFHPATTLRALGSRPWAAAYVQPSRR 66

Query: 69  PLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESP 128
           P DGRY ENPNRLQHYYQFQV+IKP+P +LQ+LY+ SL+A+GID  +HDVRFVED+WESP
Sbjct: 67  PTDGRYGENPNRLQHYYQFQVLIKPSPPDLQDLYLGSLEAIGIDMSVHDVRFVEDDWESP 126

Query: 129 TLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIV 188
           TLGAWGLGWE WCDGME+SQFTYFQQV G +C+P+SGE+TYGLERLAMYV  ++ V D+ 
Sbjct: 127 TLGAWGLGWEVWCDGMEVSQFTYFQQVGGHDCTPVSGELTYGLERLAMYVLGIDHVMDMP 186

Query: 189 FNAIEGQN-VLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN-EH 246
           FN  +    + YGDIF Q+EQEYSR+NF+ A+ E+L  HF D+E EC  +L     + + 
Sbjct: 187 FNDPQTPIALSYGDIFRQTEQEYSRWNFDVADTEMLLKHFEDAEAECQRILDTPAEDAKT 246

Query: 247 HRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNGG 306
            +  +   PAYDQCIKASH+FNLLDARGVIS TERQ YI R+R+LAK C +AF+ T  GG
Sbjct: 247 GKRIVMAHPAYDQCIKASHLFNLLDARGVISVTERQAYIGRVRALAKRCADAFVTTEAGG 306

Query: 307 H 307
           +
Sbjct: 307 Y 307


>gi|77163903|ref|YP_342428.1| glycyl-tRNA synthetase subunit alpha [Nitrosococcus oceani ATCC
           19707]
 gi|254435436|ref|ZP_05048943.1| glycyl-tRNA synthetase, alpha subunit [Nitrosococcus oceani AFC27]
 gi|76882217|gb|ABA56898.1| glycyl-tRNA synthetase alpha chain [Nitrosococcus oceani ATCC
           19707]
 gi|207088547|gb|EDZ65819.1| glycyl-tRNA synthetase, alpha subunit [Nitrosococcus oceani AFC27]
          Length = 314

 Score =  561 bits (1448), Expect = e-158,   Method: Composition-based stats.
 Identities = 182/296 (61%), Positives = 221/296 (74%), Gaps = 10/296 (3%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
             +FQ +IL L QYWA+QGC +LQPYDME+GAGTFHP+T LRALGP  W AAYVQPSRRP
Sbjct: 13  PATFQELILRLQQYWAEQGCVLLQPYDMEMGAGTFHPATFLRALGPEPWNAAYVQPSRRP 72

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY +NPNRLQHYYQ+QV++KP+PL +Q+LY+ SL  +GI PL+HD+RFVEDNWESPT
Sbjct: 73  TDGRYGDNPNRLQHYYQYQVVLKPSPLEIQDLYLGSLHMLGISPLVHDIRFVEDNWESPT 132

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GMEI+QFTYFQQ  G+EC P++GEITYGLER+AMY+Q V SV+D+V+
Sbjct: 133 LGAWGLGWEVWLNGMEITQFTYFQQAGGLECRPVTGEITYGLERIAMYLQGVGSVFDLVW 192

Query: 190 NAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRH 249
                  V YGD+F Q+E E S YNFE A+ E L   F   E E   L++ G+       
Sbjct: 193 AEGPLGRVTYGDVFHQNEVEMSIYNFEQADTESLFAWFNSCETESKRLVEAGLS------ 246

Query: 250 HLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNG 305
                PAY+  +KASH FNLLDAR  IS TERQRYILR+R+LA+A  EA+L     
Sbjct: 247 ----LPAYEMMLKASHTFNLLDARHAISVTERQRYILRVRALARAVAEAYLARRQA 298


>gi|238793178|ref|ZP_04636806.1| Glycyl-tRNA synthetase alpha subunit [Yersinia intermedia ATCC
           29909]
 gi|238727551|gb|EEQ19077.1| Glycyl-tRNA synthetase alpha subunit [Yersinia intermedia ATCC
           29909]
          Length = 304

 Score =  561 bits (1447), Expect = e-158,   Method: Composition-based stats.
 Identities = 186/301 (61%), Positives = 221/301 (73%), Gaps = 8/301 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +ILTL  YWA+QGCTI+QP DMEVGAGT HP T LRALGP    AAYVQ
Sbjct: 1   MQKFDTKTFQGLILTLQDYWARQGCTIVQPLDMEVGAGTSHPMTCLRALGPEPIAAAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQVIIKP+P N+Q LY+ SL+ +G+DP IHD+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVIIKPSPDNIQELYLGSLRELGLDPTIHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLERLAMY+Q V+SV
Sbjct: 121 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGLERLAMYIQGVDSV 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+++         YGDI+ Q+E E S YNFEYA+ + L + F   EKE   LL    P 
Sbjct: 181 YDLIWCDGPLGKTTYGDIYHQNEVEQSTYNFEYADVDFLFSCFEQYEKEAQSLLALENP- 239

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY++ +KA H FNLLDAR  IS TERQRYILRIR+L KA  EA+  +  
Sbjct: 240 -------LPLPAYERILKAGHTFNLLDARKAISVTERQRYILRIRTLTKAVAEAYYASRE 292

Query: 305 G 305
            
Sbjct: 293 A 293


>gi|114705270|ref|ZP_01438178.1| glycyl-tRNA synthetase, alpha subunit protein [Fulvimarina pelagi
           HTCC2506]
 gi|114540055|gb|EAU43175.1| glycyl-tRNA synthetase, alpha subunit protein [Fulvimarina pelagi
           HTCC2506]
          Length = 327

 Score =  561 bits (1447), Expect = e-158,   Method: Composition-based stats.
 Identities = 224/316 (70%), Positives = 257/316 (81%), Gaps = 12/316 (3%)

Query: 1   MAPIHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKA 60
           M P  + +   SFQ +ILTL +YWA  GC +LQPYDMEVGAGTFHP+TTLRALGP +W A
Sbjct: 4   MTPHMDPRR--SFQALILTLHRYWADYGCVVLQPYDMEVGAGTFHPATTLRALGPKAWNA 61

Query: 61  AYVQPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRF 120
           AYVQPSRRP DGRY ENPNRLQHYYQ+QVI+KPNP NLQ LY+ SLKA+GIDPL+HD+RF
Sbjct: 62  AYVQPSRRPKDGRYGENPNRLQHYYQYQVILKPNPSNLQELYLGSLKAIGIDPLLHDIRF 121

Query: 121 VEDNWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQN 180
           VED+WESPTLGAWGLGWECWCDGME+SQFTYFQQVCGIEC+P+SGE+TYGLERLAMYVQN
Sbjct: 122 VEDDWESPTLGAWGLGWECWCDGMEVSQFTYFQQVCGIECAPVSGELTYGLERLAMYVQN 181

Query: 181 VNSVYDIVFNAIEGQ-NVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLK 239
           V++VYD+ FN  EG   V YGD+F Q+EQEYSRYNFE A+ EILH HF ++E++C  +L 
Sbjct: 182 VDNVYDLNFNGREGDEKVTYGDVFLQAEQEYSRYNFEMADTEILHRHFDEAERQCAAILT 241

Query: 240 KGIPNEHHRH---------HLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRS 290
            G P +             H CV PAYDQCIKASH FNLLDARGV S TERQ YILR+R+
Sbjct: 242 AGTPAKAGNDNAPGTAASLHKCVLPAYDQCIKASHAFNLLDARGVTSVTERQSYILRVRN 301

Query: 291 LAKACGEAFLMTPNGG 306
           LA+ CGEAFLMT  GG
Sbjct: 302 LARQCGEAFLMTDAGG 317


>gi|254483316|ref|ZP_05096547.1| glycyl-tRNA synthetase, alpha subunit [marine gamma proteobacterium
           HTCC2148]
 gi|214036411|gb|EEB77087.1| glycyl-tRNA synthetase, alpha subunit [marine gamma proteobacterium
           HTCC2148]
          Length = 317

 Score =  561 bits (1447), Expect = e-158,   Method: Composition-based stats.
 Identities = 184/301 (61%), Positives = 224/301 (74%), Gaps = 10/301 (3%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
            N+   L+FQ +IL L Q+WA QGC +LQP DMEVGAGTFHP+T LRA+GP +W AAYVQ
Sbjct: 3   ENQNKLLTFQELILKLQQFWADQGCVVLQPLDMEVGAGTFHPATFLRAIGPENWNAAYVQ 62

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQV +KP+P N Q LY++SL A+G+D  +HDVRFVEDN
Sbjct: 63  PSRRPTDGRYGENPNRLQHYYQFQVAMKPSPANFQELYLQSLTALGVDTNVHDVRFVEDN 122

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WESPTLGAWGLGWE W +GME++QFTYFQQ  G+EC P++GEITYGLER+AMY+Q V+S+
Sbjct: 123 WESPTLGAWGLGWEVWLNGMEVTQFTYFQQAGGLECYPVTGEITYGLERIAMYLQGVDSI 182

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V+       V YGD+F Q+E E SRYNFE A+ E L   F   EKE L L+ K +P 
Sbjct: 183 YDLVWADGPAGRVTYGDVFHQNEVEMSRYNFEEADVEQLFGFFDHCEKEALRLVDKNLP- 241

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY+  +KASH FNLLDAR  IS TERQR+ILR+R+LA+A  +A+     
Sbjct: 242 ---------LPAYEMVMKASHAFNLLDARHAISVTERQRFILRVRTLARAVAQAYFNARA 292

Query: 305 G 305
            
Sbjct: 293 A 293


>gi|254515957|ref|ZP_05128017.1| glycyl-tRNA synthetase, alpha subunit [gamma proteobacterium
           NOR5-3]
 gi|219675679|gb|EED32045.1| glycyl-tRNA synthetase, alpha subunit [gamma proteobacterium
           NOR5-3]
          Length = 344

 Score =  561 bits (1447), Expect = e-158,   Method: Composition-based stats.
 Identities = 183/303 (60%), Positives = 223/303 (73%), Gaps = 10/303 (3%)

Query: 3   PIHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAY 62
            +    + +SFQ++IL L Q+W  +GC ILQP DMEVGAGTFHP+T LR+LGP SW AAY
Sbjct: 29  NLEQASDTISFQDLILRLQQFWGDKGCLILQPLDMEVGAGTFHPATFLRSLGPESWNAAY 88

Query: 63  VQPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVE 122
           VQPSRRP DGRY +NPNRLQHYYQFQV +KP+P   Q LY++SL+A+GID L HDVRFVE
Sbjct: 89  VQPSRRPTDGRYGKNPNRLQHYYQFQVAMKPSPPEFQELYLQSLQALGIDTLTHDVRFVE 148

Query: 123 DNWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVN 182
           DNWESPTLGAWGLGWE W +GME+SQFTYFQQ  GIEC P++GEITYGLER+AMY+Q V+
Sbjct: 149 DNWESPTLGAWGLGWEVWLNGMEVSQFTYFQQAGGIECYPVTGEITYGLERIAMYLQGVD 208

Query: 183 SVYDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGI 242
           SVYD+++       VLYGD+F Q+E E SRYNFE A+ + L + F   EKE   L +  +
Sbjct: 209 SVYDLLWTHSPQGPVLYGDVFHQNEVEMSRYNFEEADVDFLFSQFDHCEKEAARLTELAL 268

Query: 243 PNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMT 302
           P           PAY+  +KASH FNLLDAR  IS TERQRYILR+R+LA+   +A+   
Sbjct: 269 P----------LPAYEMVMKASHTFNLLDARHAISVTERQRYILRVRTLARGVAQAYFDA 318

Query: 303 PNG 305
              
Sbjct: 319 RAA 321


>gi|23501307|ref|NP_697434.1| glycyl-tRNA synthetase subunit alpha [Brucella suis 1330]
 gi|161618377|ref|YP_001592264.1| glycyl-tRNA synthetase subunit alpha [Brucella canis ATCC 23365]
 gi|163842685|ref|YP_001627089.1| glycyl-tRNA synthetase subunit alpha [Brucella suis ATCC 23445]
 gi|254701210|ref|ZP_05163038.1| glycyl-tRNA synthetase subunit alpha [Brucella suis bv. 5 str. 513]
 gi|254703756|ref|ZP_05165584.1| glycyl-tRNA synthetase subunit alpha [Brucella suis bv. 3 str. 686]
 gi|254707864|ref|ZP_05169692.1| glycyl-tRNA synthetase subunit alpha [Brucella pinnipedialis
           M163/99/10]
 gi|254709551|ref|ZP_05171362.1| glycyl-tRNA synthetase subunit alpha [Brucella pinnipedialis B2/94]
 gi|254713031|ref|ZP_05174842.1| glycyl-tRNA synthetase subunit alpha [Brucella ceti M644/93/1]
 gi|254716615|ref|ZP_05178426.1| glycyl-tRNA synthetase subunit alpha [Brucella ceti M13/05/1]
 gi|254718583|ref|ZP_05180394.1| glycyl-tRNA synthetase subunit alpha [Brucella sp. 83/13]
 gi|256031045|ref|ZP_05444659.1| glycyl-tRNA synthetase subunit alpha [Brucella pinnipedialis
           M292/94/1]
 gi|256060539|ref|ZP_05450707.1| glycyl-tRNA synthetase subunit alpha [Brucella neotomae 5K33]
 gi|256159109|ref|ZP_05456930.1| glycyl-tRNA synthetase subunit alpha [Brucella ceti M490/95/1]
 gi|256254448|ref|ZP_05459984.1| glycyl-tRNA synthetase subunit alpha [Brucella ceti B1/94]
 gi|256368859|ref|YP_003106365.1| glycyl-tRNA synthetase alpha subunit [Brucella microti CCM 4915]
 gi|260168177|ref|ZP_05754988.1| glycyl-tRNA synthetase subunit alpha [Brucella sp. F5/99]
 gi|260566989|ref|ZP_05837459.1| glycyl-tRNA synthetase alpha subunit [Brucella suis bv. 4 str. 40]
 gi|261218416|ref|ZP_05932697.1| glycyl-tRNA synthetase alpha subunit [Brucella ceti M13/05/1]
 gi|261221619|ref|ZP_05935900.1| glycyl-tRNA synthetase alpha subunit [Brucella ceti B1/94]
 gi|261315354|ref|ZP_05954551.1| glycyl-tRNA synthetase alpha subunit [Brucella pinnipedialis
           M163/99/10]
 gi|261317079|ref|ZP_05956276.1| glycyl-tRNA synthetase alpha subunit [Brucella pinnipedialis B2/94]
 gi|261320735|ref|ZP_05959932.1| glycyl-tRNA synthetase alpha subunit [Brucella ceti M644/93/1]
 gi|261324534|ref|ZP_05963731.1| glycyl-tRNA synthetase alpha subunit [Brucella neotomae 5K33]
 gi|261754403|ref|ZP_05998112.1| glycyl-tRNA synthetase alpha subunit [Brucella suis bv. 3 str. 686]
 gi|261757636|ref|ZP_06001345.1| glycyl-tRNA synthetase alpha subunit [Brucella sp. F5/99]
 gi|265983559|ref|ZP_06096294.1| glycyl-tRNA synthetase alpha subunit [Brucella sp. 83/13]
 gi|265988117|ref|ZP_06100674.1| glycyl-tRNA synthetase alpha subunit [Brucella pinnipedialis
           M292/94/1]
 gi|265997582|ref|ZP_06110139.1| glycyl-tRNA synthetase alpha subunit [Brucella ceti M490/95/1]
 gi|30316235|sp|Q8G2C1|SYGA_BRUSU RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|189082248|sp|A9M8H7|SYGA_BRUC2 RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|189082249|sp|B0CK89|SYGA_BRUSI RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|23347196|gb|AAN29349.1| glycyl-tRNA synthetase, alpha subunit [Brucella suis 1330]
 gi|161335188|gb|ABX61493.1| Glycyl-tRNA synthetase alpha chain [Brucella canis ATCC 23365]
 gi|163673408|gb|ABY37519.1| glycyl-tRNA synthetase, alpha subunit [Brucella suis ATCC 23445]
 gi|255999017|gb|ACU47416.1| glycyl-tRNA synthetase alpha subunit [Brucella microti CCM 4915]
 gi|260156507|gb|EEW91587.1| glycyl-tRNA synthetase alpha subunit [Brucella suis bv. 4 str. 40]
 gi|260920203|gb|EEX86856.1| glycyl-tRNA synthetase alpha subunit [Brucella ceti B1/94]
 gi|260923505|gb|EEX90073.1| glycyl-tRNA synthetase alpha subunit [Brucella ceti M13/05/1]
 gi|261293425|gb|EEX96921.1| glycyl-tRNA synthetase alpha subunit [Brucella ceti M644/93/1]
 gi|261296302|gb|EEX99798.1| glycyl-tRNA synthetase alpha subunit [Brucella pinnipedialis B2/94]
 gi|261300514|gb|EEY04011.1| glycyl-tRNA synthetase alpha subunit [Brucella neotomae 5K33]
 gi|261304380|gb|EEY07877.1| glycyl-tRNA synthetase alpha subunit [Brucella pinnipedialis
           M163/99/10]
 gi|261737620|gb|EEY25616.1| glycyl-tRNA synthetase alpha subunit [Brucella sp. F5/99]
 gi|261744156|gb|EEY32082.1| glycyl-tRNA synthetase alpha subunit [Brucella suis bv. 3 str. 686]
 gi|262552050|gb|EEZ08040.1| glycyl-tRNA synthetase alpha subunit [Brucella ceti M490/95/1]
 gi|264660314|gb|EEZ30575.1| glycyl-tRNA synthetase alpha subunit [Brucella pinnipedialis
           M292/94/1]
 gi|264662151|gb|EEZ32412.1| glycyl-tRNA synthetase alpha subunit [Brucella sp. 83/13]
          Length = 308

 Score =  561 bits (1447), Expect = e-158,   Method: Composition-based stats.
 Identities = 224/296 (75%), Positives = 257/296 (86%), Gaps = 2/296 (0%)

Query: 12  SFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPLD 71
           SFQ +ILTL  YWA+ GC ILQPYDMEVGAGTFHP+TTLR+LGP  WKAAYVQPSRRP D
Sbjct: 6   SFQGLILTLHNYWAEHGCAILQPYDMEVGAGTFHPATTLRSLGPKPWKAAYVQPSRRPKD 65

Query: 72  GRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTLG 131
           GRY ENPNRLQHYYQ+QV+IKP+P NLQ+LY+ SLKA+G+DP +HDVRFVED+WESPTLG
Sbjct: 66  GRYGENPNRLQHYYQYQVLIKPSPPNLQDLYLGSLKAIGLDPTLHDVRFVEDDWESPTLG 125

Query: 132 AWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFNA 191
           AWGLGWECWCDGME+SQFTYFQQVCGIECSP++GE+TYGLERLAMYVQ V++VYD+ FN 
Sbjct: 126 AWGLGWECWCDGMEVSQFTYFQQVCGIECSPVAGELTYGLERLAMYVQGVDNVYDLNFNG 185

Query: 192 IEGQ-NVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHH 250
           +EG   V YGD+F Q+EQEYSRYNFE AN E LH HFID+E+EC  +LK G   E+   H
Sbjct: 186 LEGDEKVTYGDVFLQAEQEYSRYNFEMANTETLHQHFIDAERECEAILKAGSTGENSL-H 244

Query: 251 LCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNGG 306
            CVFPAYDQCIKASH+FNL+DARGVIS TERQ YILR+R+LA+ CGEAFL+T  GG
Sbjct: 245 KCVFPAYDQCIKASHVFNLMDARGVISVTERQSYILRVRNLARQCGEAFLLTDAGG 300


>gi|62289390|ref|YP_221183.1| glycyl-tRNA synthetase subunit alpha [Brucella abortus bv. 1 str.
           9-941]
 gi|82699317|ref|YP_413891.1| glycyl-tRNA synthetase subunit alpha [Brucella melitensis biovar
           Abortus 2308]
 gi|225851939|ref|YP_002732172.1| glycyl-tRNA synthetase subunit alpha [Brucella melitensis ATCC
           23457]
 gi|254688703|ref|ZP_05151957.1| glycyl-tRNA synthetase subunit alpha [Brucella abortus bv. 6 str.
           870]
 gi|254693186|ref|ZP_05155014.1| glycyl-tRNA synthetase subunit alpha [Brucella abortus bv. 3 str.
           Tulya]
 gi|254696830|ref|ZP_05158658.1| glycyl-tRNA synthetase subunit alpha [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254729736|ref|ZP_05188314.1| glycyl-tRNA synthetase subunit alpha [Brucella abortus bv. 4 str.
           292]
 gi|256044123|ref|ZP_05447030.1| glycyl-tRNA synthetase subunit alpha [Brucella melitensis bv. 1
           str. Rev.1]
 gi|256112921|ref|ZP_05453834.1| glycyl-tRNA synthetase subunit alpha [Brucella melitensis bv. 3
           str. Ether]
 gi|256256950|ref|ZP_05462486.1| glycyl-tRNA synthetase subunit alpha [Brucella abortus bv. 9 str.
           C68]
 gi|256264550|ref|ZP_05467082.1| glycyl-tRNA synthetase alpha subunit [Brucella melitensis bv. 2
           str. 63/9]
 gi|260545858|ref|ZP_05821599.1| glycyl-tRNA synthetase alpha subunit [Brucella abortus NCTC 8038]
 gi|260563480|ref|ZP_05833966.1| glycyl-tRNA synthetase alpha subunit [Brucella melitensis bv. 1
           str. 16M]
 gi|260754181|ref|ZP_05866529.1| glycyl-tRNA synthetase alpha subunit [Brucella abortus bv. 6 str.
           870]
 gi|260757401|ref|ZP_05869749.1| glycyl-tRNA synthetase alpha subunit [Brucella abortus bv. 4 str.
           292]
 gi|260761225|ref|ZP_05873568.1| glycyl-tRNA synthetase alpha subunit [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260883206|ref|ZP_05894820.1| glycyl-tRNA synthetase alpha subunit [Brucella abortus bv. 9 str.
           C68]
 gi|261213428|ref|ZP_05927709.1| glycyl-tRNA synthetase alpha subunit [Brucella abortus bv. 3 str.
           Tulya]
 gi|265990533|ref|ZP_06103090.1| glycyl-tRNA synthetase alpha subunit [Brucella melitensis bv. 1
           str. Rev.1]
 gi|265994361|ref|ZP_06106918.1| glycyl-tRNA synthetase alpha subunit [Brucella melitensis bv. 3
           str. Ether]
 gi|30316383|sp|Q8YFJ0|SYGA_BRUME RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|75497274|sp|Q57EW2|SYGA_BRUAB RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|123546364|sp|Q2YME4|SYGA_BRUA2 RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|254781814|sp|C0RHB0|SYGA_BRUMB RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|62195522|gb|AAX73822.1| GlyQ, glycyl-tRNA synthetase, alpha subunit [Brucella abortus bv. 1
           str. 9-941]
 gi|82615418|emb|CAJ10387.1| Glycyl-tRNA synthetase, alpha subunit:Heterodimeric glycyl-transfer
           RNA synthetase [Brucella melitensis biovar Abortus 2308]
 gi|225640304|gb|ACO00218.1| glycyl-tRNA synthetase, alpha subunit [Brucella melitensis ATCC
           23457]
 gi|260097265|gb|EEW81140.1| glycyl-tRNA synthetase alpha subunit [Brucella abortus NCTC 8038]
 gi|260153496|gb|EEW88588.1| glycyl-tRNA synthetase alpha subunit [Brucella melitensis bv. 1
           str. 16M]
 gi|260667719|gb|EEX54659.1| glycyl-tRNA synthetase alpha subunit [Brucella abortus bv. 4 str.
           292]
 gi|260671657|gb|EEX58478.1| glycyl-tRNA synthetase alpha subunit [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260674289|gb|EEX61110.1| glycyl-tRNA synthetase alpha subunit [Brucella abortus bv. 6 str.
           870]
 gi|260872734|gb|EEX79803.1| glycyl-tRNA synthetase alpha subunit [Brucella abortus bv. 9 str.
           C68]
 gi|260915035|gb|EEX81896.1| glycyl-tRNA synthetase alpha subunit [Brucella abortus bv. 3 str.
           Tulya]
 gi|262765474|gb|EEZ11263.1| glycyl-tRNA synthetase alpha subunit [Brucella melitensis bv. 3
           str. Ether]
 gi|263001317|gb|EEZ13892.1| glycyl-tRNA synthetase alpha subunit [Brucella melitensis bv. 1
           str. Rev.1]
 gi|263094884|gb|EEZ18622.1| glycyl-tRNA synthetase alpha subunit [Brucella melitensis bv. 2
           str. 63/9]
 gi|326408437|gb|ADZ65502.1| Glycyl-tRNA synthetase alpha subunit [Brucella melitensis M28]
 gi|326538153|gb|ADZ86368.1| glycyl-tRNA synthetase, alpha subunit [Brucella melitensis M5-90]
          Length = 308

 Score =  561 bits (1447), Expect = e-158,   Method: Composition-based stats.
 Identities = 224/296 (75%), Positives = 257/296 (86%), Gaps = 2/296 (0%)

Query: 12  SFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPLD 71
           SFQ +ILTL  YWA+ GC ILQPYDMEVGAGTFHP+TTLR+LGP  WKAAYVQPSRRP D
Sbjct: 6   SFQGLILTLHNYWAEHGCAILQPYDMEVGAGTFHPATTLRSLGPKPWKAAYVQPSRRPKD 65

Query: 72  GRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTLG 131
           GRY ENPNRLQHYYQ+QV+IKP+P NLQ+LY+ SLKA+G+DP +HDVRFVED+WESPTLG
Sbjct: 66  GRYGENPNRLQHYYQYQVLIKPSPPNLQDLYLGSLKAIGLDPTLHDVRFVEDDWESPTLG 125

Query: 132 AWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFNA 191
           AWGLGWECWCDGME+SQFTYFQQVCGIECSP++GE+TYGLERLAMYVQ V++VYD+ FN 
Sbjct: 126 AWGLGWECWCDGMEVSQFTYFQQVCGIECSPVAGELTYGLERLAMYVQGVDNVYDLNFNG 185

Query: 192 IEGQ-NVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHH 250
           +EG   V YGD+F Q+EQEYSRYNFE AN E LH HFID+E+EC  +LK G   E+   H
Sbjct: 186 LEGDEKVTYGDVFLQAEQEYSRYNFEMANTETLHQHFIDAERECEAILKAGSTGENSL-H 244

Query: 251 LCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNGG 306
            CVFPAYDQCIKASH+FNL+DARGVIS TERQ YILR+R+LA+ CGEAFL+T  GG
Sbjct: 245 KCVFPAYDQCIKASHVFNLMDARGVISVTERQGYILRVRNLARQCGEAFLLTDAGG 300


>gi|292901098|ref|YP_003540467.1| glycine-tRNA synthetase subunit alpha [Erwinia amylovora ATCC
           49946]
 gi|291200946|emb|CBJ48085.1| glycine-tRNA synthetase, alpha subunit [Erwinia amylovora ATCC
           49946]
          Length = 303

 Score =  561 bits (1447), Expect = e-158,   Method: Composition-based stats.
 Identities = 187/301 (62%), Positives = 221/301 (73%), Gaps = 8/301 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +ILTL  YWA+QGCTI+QP DMEVGAGT HP T LRALGP     AYVQ
Sbjct: 1   MQKFDTKTFQGLILTLQDYWARQGCTIIQPLDMEVGAGTSHPMTCLRALGPEPTAVAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQVIIKP+P N+Q LY+ SLK +G+DP IHD+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVIIKPSPDNIQELYLGSLKELGMDPTIHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLERLAMY+Q V+SV
Sbjct: 121 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGLERLAMYIQGVDSV 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V++        YGD+F Q+E E S YNFEYA+ + L   F   EKE   LL    P 
Sbjct: 181 YDLVWSDGPLGKTTYGDVFHQNEVEQSTYNFEYADVDFLFPCFEQYEKEAQSLLALEKP- 239

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY++ +KA+H FNLLDAR  IS TERQRYILRIR+L KA  EA+  +  
Sbjct: 240 -------LPLPAYERILKAAHSFNLLDARKAISVTERQRYILRIRTLTKAVAEAYYASRE 292

Query: 305 G 305
            
Sbjct: 293 A 293


>gi|50119045|ref|YP_048212.1| glycyl-tRNA synthetase subunit alpha [Pectobacterium atrosepticum
           SCRI1043]
 gi|81646650|sp|Q6DB18|SYGA_ERWCT RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|49609571|emb|CAG73004.1| glycine-tRNA synthetase, alpha subunit [Pectobacterium atrosepticum
           SCRI1043]
          Length = 304

 Score =  561 bits (1446), Expect = e-158,   Method: Composition-based stats.
 Identities = 185/301 (61%), Positives = 222/301 (73%), Gaps = 8/301 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +ILTL  YWA+QGCTI+QP DMEVGAGT HP T LRALGP     AYVQ
Sbjct: 1   MQKFDTKTFQGLILTLQDYWARQGCTIVQPLDMEVGAGTSHPMTCLRALGPEPMATAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQV+IKP+P N+Q LY+ SLK +G+DP IHD+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVVIKPSPENIQELYLGSLKELGMDPTIHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLERLAMY+Q V+SV
Sbjct: 121 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGLERLAMYIQGVDSV 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V++        YGD+F Q+E E S YNFE+A+ + L + F   EKE   LL    P 
Sbjct: 181 YDLVWSDGLLGKTTYGDVFHQNEVEQSTYNFEHADVDFLFSCFEQYEKEAQHLLALEKP- 239

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY++ +KA+H FNLLDAR  IS TERQRYILRIR+L KA  EA+  +  
Sbjct: 240 -------LPLPAYERILKAAHSFNLLDARKAISVTERQRYILRIRTLTKAVAEAYYASRE 292

Query: 305 G 305
            
Sbjct: 293 A 293


>gi|259910252|ref|YP_002650608.1| glycyl-tRNA synthetase subunit alpha [Erwinia pyrifoliae Ep1/96]
 gi|224965874|emb|CAX57407.1| Glycyl-tRNA synthetase alpha chain [Erwinia pyrifoliae Ep1/96]
          Length = 303

 Score =  561 bits (1446), Expect = e-158,   Method: Composition-based stats.
 Identities = 187/301 (62%), Positives = 222/301 (73%), Gaps = 8/301 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +ILTL  YWA+QGCTI+QP DMEVGAGT HP T LRALGP     AYVQ
Sbjct: 1   MQKFDTKTFQGLILTLQDYWARQGCTIIQPLDMEVGAGTSHPMTCLRALGPEPTAVAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQVIIKP+P N+Q LY+ SL+ +G+DP IHD+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVIIKPSPDNIQELYLGSLQELGMDPTIHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLERLAMY+Q V+SV
Sbjct: 121 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGLERLAMYIQGVDSV 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V++        YGD+F Q+E E S YNFEYA+ + L   F   EKE L LL    P 
Sbjct: 181 YDLVWSDGPLGKTTYGDVFHQNEVEQSTYNFEYADVDFLFTCFEQYEKEALSLLALEKP- 239

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY++ +KA+H FNLLDAR  IS TERQRYILRIR+L KA  EA+  +  
Sbjct: 240 -------LPLPAYERILKAAHSFNLLDARKAISVTERQRYILRIRTLTKAVAEAYYASRE 292

Query: 305 G 305
            
Sbjct: 293 A 293


>gi|89070596|ref|ZP_01157880.1| glycyl-tRNA synthetase alpha subunit [Oceanicola granulosus
           HTCC2516]
 gi|89043813|gb|EAR50014.1| glycyl-tRNA synthetase alpha subunit [Oceanicola granulosus
           HTCC2516]
          Length = 306

 Score =  561 bits (1446), Expect = e-158,   Method: Composition-based stats.
 Identities = 198/301 (65%), Positives = 237/301 (78%), Gaps = 2/301 (0%)

Query: 8   KNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSR 67
               SFQ IIL L  YWA +GC +LQPYDMEVGAGTFHP+TTLRALGP +W AAYVQPSR
Sbjct: 3   DKPRSFQEIILRLQTYWAGKGCAVLQPYDMEVGAGTFHPATTLRALGPNAWAAAYVQPSR 62

Query: 68  RPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWES 127
           RP DGRY ENPNRLQHYYQFQV+IKP+P +LQ LY+ SL+A+GID  +HD+RFVED+WES
Sbjct: 63  RPTDGRYGENPNRLQHYYQFQVLIKPSPPDLQELYLGSLEAIGIDMALHDIRFVEDDWES 122

Query: 128 PTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDI 187
           PTLGAWGLGWE WCDGME+SQFTYFQQV G +C P+SGE+TYGLERLAMYV  ++ V D+
Sbjct: 123 PTLGAWGLGWEVWCDGMEVSQFTYFQQVGGHDCHPVSGELTYGLERLAMYVLGIDHVMDM 182

Query: 188 VFNAIEGQ-NVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGI-PNE 245
            FNA +    + YGD+F Q+E+EYSR+NF+ A+ ++L  HF ++E EC  +L       +
Sbjct: 183 PFNAPDAPIPLAYGDVFRQTEREYSRWNFDIADTDLLLRHFEEAEAECRRILDAPDTDPK 242

Query: 246 HHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNG 305
             R  +   PAYDQCIKASHIFNLLDARGVIS TERQ YI R+R+LAKAC +AF+ T  G
Sbjct: 243 TGREIVMAHPAYDQCIKASHIFNLLDARGVISVTERQAYIGRVRTLAKACADAFVRTEAG 302

Query: 306 G 306
           G
Sbjct: 303 G 303


>gi|146309829|ref|YP_001174903.1| glycyl-tRNA synthetase subunit alpha [Enterobacter sp. 638]
 gi|166980031|sp|A4W572|SYGA_ENT38 RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|145316705|gb|ABP58852.1| glycyl-tRNA synthetase alpha chain [Enterobacter sp. 638]
          Length = 303

 Score =  561 bits (1446), Expect = e-158,   Method: Composition-based stats.
 Identities = 187/301 (62%), Positives = 222/301 (73%), Gaps = 8/301 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +ILTL  YWA+QGCTI+QP DMEVGAGT HP T+LRALGP     AYVQ
Sbjct: 1   MQKFDTKTFQGLILTLQDYWARQGCTIVQPLDMEVGAGTSHPMTSLRALGPEPMATAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQV+IKP+P N+Q LY+ SLK +G+DP IHD+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVVIKPSPDNIQELYLGSLKELGVDPTIHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC PI+GEITYGLERLAMY+Q V+SV
Sbjct: 121 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPITGEITYGLERLAMYIQGVDSV 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V++        YGD+F Q+E E S YNFEYA+ + L   F   EKE   LL    P 
Sbjct: 181 YDLVWSDGPLGKTTYGDVFHQNEVEQSTYNFEYADVDFLFTCFEQYEKEAQQLLALETP- 239

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY++ +KA+H FNLLDAR  IS TERQRYILRIR+L KA  EA+  +  
Sbjct: 240 -------LPLPAYERILKAAHSFNLLDARKAISVTERQRYILRIRTLTKAVAEAYYASRE 292

Query: 305 G 305
            
Sbjct: 293 A 293


>gi|121534208|ref|ZP_01666033.1| Glycine--tRNA ligase [Thermosinus carboxydivorans Nor1]
 gi|121307311|gb|EAX48228.1| Glycine--tRNA ligase [Thermosinus carboxydivorans Nor1]
          Length = 294

 Score =  560 bits (1445), Expect = e-158,   Method: Composition-based stats.
 Identities = 166/294 (56%), Positives = 212/294 (72%), Gaps = 14/294 (4%)

Query: 11  LSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPL 70
           ++FQ+IILTL  +WA+Q C I QPYD+E GAGT +P+T LRALGP  W  AYV+PSRRP 
Sbjct: 1   MTFQDIILTLQNFWAEQKCIIQQPYDVEKGAGTMNPATFLRALGPEPWNVAYVEPSRRPT 60

Query: 71  DGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTL 130
           DGRY +NPNRL  ++Q+QVI+KP+P N+Q LY+ESL  +GIDP  HD+RFVEDNWESPTL
Sbjct: 61  DGRYGDNPNRLFQHHQYQVIMKPSPANIQELYLESLARLGIDPDKHDIRFVEDNWESPTL 120

Query: 131 GAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFN 190
           GAWGLGWE W DGMEI+QFTYFQQV  I+  P+S EITYGLERLAMY+Q   +V+DI + 
Sbjct: 121 GAWGLGWEVWLDGMEITQFTYFQQVGSIDVKPVSVEITYGLERLAMYIQGKENVFDIEWV 180

Query: 191 AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHH 250
                 + YGD+F ++E E+S YNFE A+  +L   F   EKE + +++KG         
Sbjct: 181 ----DGITYGDVFHRNEVEHSHYNFELADTSMLFQLFEMYEKEAIRIIEKGF-------- 228

Query: 251 LCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
             V PAYD  +K SH FNLLDARG IS +ER  +I R+R++A+ C +A+L    
Sbjct: 229 --VLPAYDYVLKCSHTFNLLDARGAISVSERTSFIGRVRNMARLCAQAYLEQRE 280


>gi|22127959|ref|NP_671382.1| glycyl-tRNA synthetase subunit alpha [Yersinia pestis KIM 10]
 gi|45443706|ref|NP_995245.1| glycyl-tRNA synthetase subunit alpha [Yersinia pestis biovar
           Microtus str. 91001]
 gi|51598200|ref|YP_072391.1| glycyl-tRNA synthetase subunit alpha [Yersinia pseudotuberculosis
           IP 32953]
 gi|108809002|ref|YP_652918.1| glycyl-tRNA synthetase subunit alpha [Yersinia pestis Antiqua]
 gi|108813878|ref|YP_649645.1| glycyl-tRNA synthetase subunit alpha [Yersinia pestis Nepal516]
 gi|145597346|ref|YP_001161421.1| glycyl-tRNA synthetase subunit alpha [Yersinia pestis Pestoides F]
 gi|150260989|ref|ZP_01917717.1| glycyl-tRNA synthetase alpha subunit [Yersinia pestis CA88-4125]
 gi|153949369|ref|YP_001403074.1| glycyl-tRNA synthetase subunit alpha [Yersinia pseudotuberculosis
           IP 31758]
 gi|162420538|ref|YP_001608093.1| glycyl-tRNA synthetase subunit alpha [Yersinia pestis Angola]
 gi|165926100|ref|ZP_02221932.1| glycyl-tRNA synthetase, alpha subunit [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165936967|ref|ZP_02225533.1| glycyl-tRNA synthetase, alpha subunit [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|166009574|ref|ZP_02230472.1| glycyl-tRNA synthetase, alpha subunit [Yersinia pestis biovar
           Antiqua str. E1979001]
 gi|166213238|ref|ZP_02239273.1| glycyl-tRNA synthetase, alpha subunit [Yersinia pestis biovar
           Antiqua str. B42003004]
 gi|167398761|ref|ZP_02304285.1| glycyl-tRNA synthetase, alpha subunit [Yersinia pestis biovar
           Antiqua str. UG05-0454]
 gi|167421058|ref|ZP_02312811.1| glycyl-tRNA synthetase, alpha subunit [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167425532|ref|ZP_02317285.1| glycyl-tRNA synthetase, alpha subunit [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|167467916|ref|ZP_02332620.1| glycyl-tRNA synthetase, alpha subunit [Yersinia pestis FV-1]
 gi|170022284|ref|YP_001718789.1| glycyl-tRNA synthetase subunit alpha [Yersinia pseudotuberculosis
           YPIII]
 gi|186897424|ref|YP_001874536.1| glycyl-tRNA synthetase subunit alpha [Yersinia pseudotuberculosis
           PB1/+]
 gi|218931053|ref|YP_002348928.1| glycyl-tRNA synthetase subunit alpha [Yersinia pestis CO92]
 gi|229839780|ref|ZP_04459939.1| glycine tRNA synthetase, alpha subunit [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229841864|ref|ZP_04462020.1| glycine tRNA synthetase, alpha subunit [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229896742|ref|ZP_04511906.1| glycine tRNA synthetase, alpha subunit [Yersinia pestis Pestoides
           A]
 gi|229904401|ref|ZP_04519512.1| glycine tRNA synthetase, alpha subunit [Yersinia pestis Nepal516]
 gi|294505602|ref|YP_003569664.1| glycyl-tRNA synthetase alpha subunit [Yersinia pestis Z176003]
 gi|25009309|sp|Q8Z9W6|SYGA_YERPE RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|81638103|sp|Q663V9|SYGA_YERPS RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|122382817|sp|Q1C3J9|SYGA_YERPA RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|122384053|sp|Q1CD85|SYGA_YERPN RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|166227907|sp|A4TGN6|SYGA_YERPP RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|166980036|sp|A7FP96|SYGA_YERP3 RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|238687302|sp|A9R4G0|SYGA_YERPG RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|238688394|sp|B1JH06|SYGA_YERPY RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|238691424|sp|B2K7F7|SYGA_YERPB RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|21961102|gb|AAM87633.1|AE014010_9 glycine tRNA synthetase, alpha subunit [Yersinia pestis KIM 10]
 gi|45438576|gb|AAS64122.1| glycyl-tRNA synthetase alpha subunit [Yersinia pestis biovar
           Microtus str. 91001]
 gi|51591482|emb|CAH23153.1| glycyl-tRNA synthetase alpha subunit [Yersinia pseudotuberculosis
           IP 32953]
 gi|108777526|gb|ABG20045.1| glycyl-tRNA synthetase alpha subunit [Yersinia pestis Nepal516]
 gi|108780915|gb|ABG14973.1| glycyl-tRNA synthetase alpha subunit [Yersinia pestis Antiqua]
 gi|115349664|emb|CAL22644.1| glycyl-tRNA synthetase alpha subunit [Yersinia pestis CO92]
 gi|145209042|gb|ABP38449.1| glycyl-tRNA synthetase alpha subunit [Yersinia pestis Pestoides F]
 gi|149290397|gb|EDM40474.1| glycyl-tRNA synthetase alpha subunit [Yersinia pestis CA88-4125]
 gi|152960864|gb|ABS48325.1| glycyl-tRNA synthetase, alpha subunit [Yersinia pseudotuberculosis
           IP 31758]
 gi|162353353|gb|ABX87301.1| glycyl-tRNA synthetase, alpha subunit [Yersinia pestis Angola]
 gi|165915209|gb|EDR33820.1| glycyl-tRNA synthetase, alpha subunit [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|165921960|gb|EDR39137.1| glycyl-tRNA synthetase, alpha subunit [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165991496|gb|EDR43797.1| glycyl-tRNA synthetase, alpha subunit [Yersinia pestis biovar
           Antiqua str. E1979001]
 gi|166205536|gb|EDR50016.1| glycyl-tRNA synthetase, alpha subunit [Yersinia pestis biovar
           Antiqua str. B42003004]
 gi|166961187|gb|EDR57208.1| glycyl-tRNA synthetase, alpha subunit [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167051265|gb|EDR62673.1| glycyl-tRNA synthetase, alpha subunit [Yersinia pestis biovar
           Antiqua str. UG05-0454]
 gi|167055546|gb|EDR65339.1| glycyl-tRNA synthetase, alpha subunit [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|169748818|gb|ACA66336.1| glycyl-tRNA synthetase, alpha subunit [Yersinia pseudotuberculosis
           YPIII]
 gi|186700450|gb|ACC91079.1| glycyl-tRNA synthetase, alpha subunit [Yersinia pseudotuberculosis
           PB1/+]
 gi|229678519|gb|EEO74624.1| glycine tRNA synthetase, alpha subunit [Yersinia pestis Nepal516]
 gi|229691203|gb|EEO83256.1| glycine tRNA synthetase, alpha subunit [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229696146|gb|EEO86193.1| glycine tRNA synthetase, alpha subunit [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229700281|gb|EEO88316.1| glycine tRNA synthetase, alpha subunit [Yersinia pestis Pestoides
           A]
 gi|262363766|gb|ACY60487.1| glycyl-tRNA synthetase alpha subunit [Yersinia pestis D106004]
 gi|262367702|gb|ACY64259.1| glycyl-tRNA synthetase alpha subunit [Yersinia pestis D182038]
 gi|294356061|gb|ADE66402.1| glycyl-tRNA synthetase alpha subunit [Yersinia pestis Z176003]
 gi|320017402|gb|ADW00974.1| glycine tRNA synthetase, alpha subunit [Yersinia pestis biovar
           Medievalis str. Harbin 35]
          Length = 304

 Score =  560 bits (1445), Expect = e-158,   Method: Composition-based stats.
 Identities = 186/301 (61%), Positives = 221/301 (73%), Gaps = 8/301 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +ILTL  YWA+QGCTI+QP DMEVGAGT HP T LRA+GP    AAYVQ
Sbjct: 1   MQKFDTKTFQGLILTLQDYWARQGCTIVQPLDMEVGAGTSHPMTCLRAIGPEPIAAAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQVIIKP+P N+Q LY+ SLK +G+DP IHD+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVIIKPSPDNIQELYLGSLKELGLDPTIHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLERLAMY+Q V+SV
Sbjct: 121 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGLERLAMYIQGVDSV 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+++         YGDI+ Q+E E S YNFEYA+ + L + F   EKE   LL    P 
Sbjct: 181 YDLIWCDGPLGTTTYGDIYHQNEVEQSTYNFEYADVDFLFSCFEQYEKEAQSLLALETP- 239

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY++ +KA H FNLLDAR  IS TERQRYILRIR+L KA  EA+  +  
Sbjct: 240 -------LPLPAYERILKAGHTFNLLDARKAISVTERQRYILRIRTLTKAVAEAYYASRE 292

Query: 305 G 305
            
Sbjct: 293 A 293


>gi|306842308|ref|ZP_07474968.1| glycyl-tRNA synthetase, alpha subunit [Brucella sp. BO2]
 gi|306287565|gb|EFM59021.1| glycyl-tRNA synthetase, alpha subunit [Brucella sp. BO2]
          Length = 308

 Score =  560 bits (1445), Expect = e-158,   Method: Composition-based stats.
 Identities = 224/296 (75%), Positives = 257/296 (86%), Gaps = 2/296 (0%)

Query: 12  SFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPLD 71
           SFQ +ILTL  YWA+ GC ILQPYDMEVGAGTFHP+TTLR+LGP  WKAAYVQPSRRP D
Sbjct: 6   SFQGLILTLHNYWAEHGCAILQPYDMEVGAGTFHPATTLRSLGPKPWKAAYVQPSRRPKD 65

Query: 72  GRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTLG 131
           GRY ENPNRLQHYYQ+QV+IKP+P NLQ+LY+ SLKA+G+DP +HDVRFVED+WESPTLG
Sbjct: 66  GRYGENPNRLQHYYQYQVLIKPSPPNLQDLYLGSLKAIGLDPTLHDVRFVEDDWESPTLG 125

Query: 132 AWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFNA 191
           AWGLGWECWCDGME+SQFTYFQQVCGIECSP++GE+TYGLERLAMYVQ V++VYD+ FN 
Sbjct: 126 AWGLGWECWCDGMEVSQFTYFQQVCGIECSPVAGELTYGLERLAMYVQGVDNVYDLNFNG 185

Query: 192 IEGQ-NVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHH 250
           +EG   V YGD+F Q+EQEYSRYNFE AN E LH HFID+E+EC  +LK G   E+   H
Sbjct: 186 LEGDEKVTYGDVFLQAEQEYSRYNFEMANTETLHQHFIDAERECEAILKAGSTGENSL-H 244

Query: 251 LCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNGG 306
            CVFPAYDQCIKASH+FNL+DARGVIS TERQ YILR+R+LA+ CGEAFL+T  GG
Sbjct: 245 KCVFPAYDQCIKASHVFNLMDARGVISVTERQSYILRVRNLARQCGEAFLLTDAGG 300


>gi|144897874|emb|CAM74738.1| Glycyl-tRNA synthetase alpha chain [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 293

 Score =  560 bits (1445), Expect = e-158,   Method: Composition-based stats.
 Identities = 202/300 (67%), Positives = 240/300 (80%), Gaps = 13/300 (4%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
           H      SFQ +ILTL  +WA+QGC ILQPYDMEVGAGTFHP+TTLRALGP  WK AYVQ
Sbjct: 3   HTGAKKPSFQQLILTLQNFWAEQGCVILQPYDMEVGAGTFHPATTLRALGPDPWKCAYVQ 62

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQV++KP+P N Q LY+ESL+ +G+DP+ HD+RFVED+
Sbjct: 63  PSRRPKDGRYGENPNRLQHYYQFQVLLKPSPANSQELYLESLRRLGVDPMAHDIRFVEDD 122

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WESPTLGAWGLGWE WCDGME++QFTYFQQV GIEC P++ E+TYGLERLAMY+Q V +V
Sbjct: 123 WESPTLGAWGLGWEVWCDGMEVTQFTYFQQVGGIECDPVAVELTYGLERLAMYIQGVENV 182

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+ FN   G+ V YGD+F Q+EQEYS +NFE+A+ E+L+ HF+D+EKEC +LL  G+  
Sbjct: 183 YDLDFN---GEGVKYGDVFLQAEQEYSAHNFEHADTEMLYRHFVDAEKECQNLLAAGLS- 238

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAYDQCIKASH FNLLDARGVIS TERQ YI R+R+LAKAC E +L +  
Sbjct: 239 ---------LPAYDQCIKASHRFNLLDARGVISVTERQSYIGRVRALAKACCEGWLASSA 289


>gi|238750268|ref|ZP_04611770.1| Glycyl-tRNA synthetase alpha subunit [Yersinia rohdei ATCC 43380]
 gi|238711501|gb|EEQ03717.1| Glycyl-tRNA synthetase alpha subunit [Yersinia rohdei ATCC 43380]
          Length = 304

 Score =  560 bits (1445), Expect = e-158,   Method: Composition-based stats.
 Identities = 187/301 (62%), Positives = 220/301 (73%), Gaps = 8/301 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +ILTL  YWA+QGCTI+QP DMEVGAGT HP T LRALGP    AAYVQ
Sbjct: 1   MQKFDTKTFQGLILTLQDYWARQGCTIVQPLDMEVGAGTSHPMTCLRALGPEPIAAAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQVIIKP+P N+Q LY+ SL  +G+DP IHD+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVIIKPSPDNIQELYLGSLTELGLDPTIHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLERLAMY+Q V+SV
Sbjct: 121 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGLERLAMYIQGVDSV 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V+         YGDI+ Q+E E S YNFEYA+ + L   F   EKE   LL   +P 
Sbjct: 181 YDLVWCDGPLGKTTYGDIYHQNEVEQSTYNFEYADVDFLFYCFEQYEKEAQSLLALEVP- 239

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY++ +KA H FNLLDAR  IS TERQRYILRIR+L KA  EA+  +  
Sbjct: 240 -------LPLPAYERILKAGHTFNLLDARKAISVTERQRYILRIRTLTKAVAEAYYASRE 292

Query: 305 G 305
            
Sbjct: 293 A 293


>gi|332560286|ref|ZP_08414608.1| glycyl-tRNA synthetase subunit alpha [Rhodobacter sphaeroides WS8N]
 gi|332277998|gb|EGJ23313.1| glycyl-tRNA synthetase subunit alpha [Rhodobacter sphaeroides WS8N]
          Length = 307

 Score =  560 bits (1445), Expect = e-158,   Method: Composition-based stats.
 Identities = 193/297 (64%), Positives = 233/297 (78%), Gaps = 1/297 (0%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
             SFQ IIL L  YW  +GC +LQPYDMEVGAGTFHP+TTLR+LG   W AAYVQPSRRP
Sbjct: 8   PRSFQEIILRLMTYWGAKGCAVLQPYDMEVGAGTFHPATTLRSLGARPWAAAYVQPSRRP 67

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNRLQHYYQ+QV+IKP+P +LQ LY+ SL+A+GID  +HD+RFVED+WESPT
Sbjct: 68  TDGRYGENPNRLQHYYQYQVLIKPSPPDLQKLYLGSLEAIGIDMDLHDIRFVEDDWESPT 127

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE WCDGME+SQFTYFQQV G +C P+SGE+TYGLERLAMYV  ++ V D+ F
Sbjct: 128 LGAWGLGWEVWCDGMEVSQFTYFQQVGGHDCRPVSGELTYGLERLAMYVLGIDHVMDMPF 187

Query: 190 NAIEGQN-VLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHR 248
           N  +G   + YGD+F Q+EQEYSR+NF+ A+ ++L  HF D+E EC  +L     ++  R
Sbjct: 188 NDPDGPTPLTYGDVFRQTEQEYSRWNFDQADTDMLLQHFKDAEAECERILDAPETDKAGR 247

Query: 249 HHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNG 305
             +   PAYDQCIKASH+FNLLDARGVIS TERQ YI R+R+LAK C +AF+ T  G
Sbjct: 248 RIVMAHPAYDQCIKASHLFNLLDARGVISVTERQAYIGRVRALAKKCADAFVTTEAG 304


>gi|145301091|ref|YP_001143932.1| glycyl-tRNA synthetase subunit alpha [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|166200188|sp|A4STG2|SYGA_AERS4 RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|142853863|gb|ABO92184.1| glycine-tRNA synthetase, alpha subunit [Aeromonas salmonicida
           subsp. salmonicida A449]
          Length = 307

 Score =  560 bits (1445), Expect = e-158,   Method: Composition-based stats.
 Identities = 184/301 (61%), Positives = 221/301 (73%), Gaps = 8/301 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +IL L  YW++QGCTI+QP DMEVGAGT HP T LRALGP     AYVQ
Sbjct: 1   MQKFDVKTFQGLILQLQDYWSRQGCTIIQPLDMEVGAGTSHPMTCLRALGPEPIACAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQVIIKP+P N+Q LY+ SLK +G+DP IHD+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVIIKPSPDNIQELYLGSLKELGMDPEIHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLERLAMY+Q V+SV
Sbjct: 121 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGLERLAMYIQGVDSV 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V++        YGD+F Q+E E S YNFE+A+ + L + F   EKE   LL    P 
Sbjct: 181 YDLVWSDGPLGKTTYGDVFHQNEVEQSTYNFEHADVDFLFHCFEQYEKEAQHLLALETP- 239

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY++ +KA+H FNLLDAR  IS TERQRYILRIR+L KA  EA+  +  
Sbjct: 240 -------LPLPAYERILKAAHSFNLLDARKAISVTERQRYILRIRTLTKAVAEAYYASRE 292

Query: 305 G 305
            
Sbjct: 293 A 293


>gi|15804105|ref|NP_290144.1| glycyl-tRNA synthetase subunit alpha [Escherichia coli O157:H7
           EDL933]
 gi|15833697|ref|NP_312470.1| glycyl-tRNA synthetase subunit alpha [Escherichia coli O157:H7 str.
           Sakai]
 gi|24114836|ref|NP_709346.1| glycyl-tRNA synthetase subunit alpha [Shigella flexneri 2a str.
           301]
 gi|26250201|ref|NP_756241.1| glycyl-tRNA synthetase subunit alpha [Escherichia coli CFT073]
 gi|30065153|ref|NP_839324.1| glycyl-tRNA synthetase subunit alpha [Shigella flexneri 2a str.
           2457T]
 gi|74314187|ref|YP_312606.1| glycyl-tRNA synthetase subunit alpha [Shigella sonnei Ss046]
 gi|82545928|ref|YP_409875.1| glycyl-tRNA synthetase subunit alpha [Shigella boydii Sb227]
 gi|82779377|ref|YP_405726.1| glycyl-tRNA synthetase subunit alpha [Shigella dysenteriae Sd197]
 gi|91213073|ref|YP_543059.1| glycyl-tRNA synthetase subunit alpha [Escherichia coli UTI89]
 gi|110643807|ref|YP_671537.1| glycyl-tRNA synthetase subunit alpha [Escherichia coli 536]
 gi|110807771|ref|YP_691291.1| glycyl-tRNA synthetase subunit alpha [Shigella flexneri 5 str.
           8401]
 gi|117625842|ref|YP_859165.1| glycyl-tRNA synthetase subunit alpha [Escherichia coli APEC O1]
 gi|157149176|ref|YP_001456495.1| glycyl-tRNA synthetase subunit alpha [Citrobacter koseri ATCC
           BAA-895]
 gi|157159336|ref|YP_001465035.1| glycyl-tRNA synthetase subunit alpha [Escherichia coli E24377A]
 gi|157163036|ref|YP_001460354.1| glycyl-tRNA synthetase subunit alpha [Escherichia coli HS]
 gi|167549107|ref|ZP_02342866.1| glycyl-tRNA synthetase, alpha subunit [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
 gi|168746895|ref|ZP_02771917.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli O157:H7
           str. EC4113]
 gi|168753379|ref|ZP_02778386.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli O157:H7
           str. EC4401]
 gi|168759651|ref|ZP_02784658.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli O157:H7
           str. EC4501]
 gi|168765974|ref|ZP_02790981.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli O157:H7
           str. EC4486]
 gi|168772479|ref|ZP_02797486.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli O157:H7
           str. EC4196]
 gi|168779710|ref|ZP_02804717.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli O157:H7
           str. EC4076]
 gi|168785431|ref|ZP_02810438.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli O157:H7
           str. EC869]
 gi|168797397|ref|ZP_02822404.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli O157:H7
           str. EC508]
 gi|170018210|ref|YP_001723164.1| glycyl-tRNA synthetase subunit alpha [Escherichia coli ATCC 8739]
 gi|170683810|ref|YP_001745847.1| glycyl-tRNA synthetase subunit alpha [Escherichia coli SMS-3-5]
 gi|170767045|ref|ZP_02901498.1| glycyl-tRNA synthetase, alpha subunit [Escherichia albertii
           TW07627]
 gi|187731073|ref|YP_001882246.1| glycyl-tRNA synthetase subunit alpha [Shigella boydii CDC 3083-94]
 gi|188494909|ref|ZP_03002179.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli 53638]
 gi|191165304|ref|ZP_03027147.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli B7A]
 gi|191170541|ref|ZP_03032094.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli F11]
 gi|193061756|ref|ZP_03042853.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli E22]
 gi|193068528|ref|ZP_03049490.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli E110019]
 gi|194427420|ref|ZP_03059969.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli B171]
 gi|194431329|ref|ZP_03063622.1| glycyl-tRNA synthetase, alpha subunit [Shigella dysenteriae 1012]
 gi|194435819|ref|ZP_03067922.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli 101-1]
 gi|195935090|ref|ZP_03080472.1| glycyl-tRNA synthetase subunit alpha [Escherichia coli O157:H7 str.
           EC4024]
 gi|208809461|ref|ZP_03251798.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli O157:H7
           str. EC4206]
 gi|208812043|ref|ZP_03253372.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli O157:H7
           str. EC4045]
 gi|208819463|ref|ZP_03259783.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli O157:H7
           str. EC4042]
 gi|209396370|ref|YP_002273045.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli O157:H7
           str. EC4115]
 gi|209921024|ref|YP_002295108.1| glycyl-tRNA synthetase subunit alpha [Escherichia coli SE11]
 gi|215488844|ref|YP_002331275.1| glycyl-tRNA synthetase subunit alpha [Escherichia coli O127:H6 str.
           E2348/69]
 gi|217324718|ref|ZP_03440802.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli O157:H7
           str. TW14588]
 gi|218550845|ref|YP_002384636.1| glycyl-tRNA synthetase subunit alpha [Escherichia fergusonii ATCC
           35469]
 gi|218556119|ref|YP_002389032.1| glycyl-tRNA synthetase subunit alpha [Escherichia coli IAI1]
 gi|218560635|ref|YP_002393548.1| glycyl-tRNA synthetase subunit alpha [Escherichia coli S88]
 gi|218691849|ref|YP_002400061.1| glycyl-tRNA synthetase subunit alpha [Escherichia coli ED1a]
 gi|218697275|ref|YP_002404942.1| glycyl-tRNA synthetase subunit alpha [Escherichia coli 55989]
 gi|218702325|ref|YP_002409954.1| glycyl-tRNA synthetase subunit alpha [Escherichia coli IAI39]
 gi|218707193|ref|YP_002414712.1| glycyl-tRNA synthetase subunit alpha [Escherichia coli UMN026]
 gi|227883726|ref|ZP_04001531.1| glycyl-tRNA synthetase subunit alpha [Escherichia coli 83972]
 gi|237703330|ref|ZP_04533811.1| glycyl-tRNA synthetase subunit alpha [Escherichia sp. 3_2_53FAA]
 gi|238902649|ref|YP_002928445.1| glycine tRNA synthetase, alpha subunit [Escherichia coli BW2952]
 gi|253771605|ref|YP_003034436.1| glycyl-tRNA synthetase subunit alpha [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254038745|ref|ZP_04872801.1| glycyl-tRNA synthetase subunit alpha [Escherichia sp. 1_1_43]
 gi|254163484|ref|YP_003046592.1| glycyl-tRNA synthetase subunit alpha [Escherichia coli B str.
           REL606]
 gi|254795516|ref|YP_003080353.1| glycyl-tRNA synthetase subunit alpha [Escherichia coli O157:H7 str.
           TW14359]
 gi|256020907|ref|ZP_05434772.1| glycyl-tRNA synthetase subunit alpha [Shigella sp. D9]
 gi|256025712|ref|ZP_05439577.1| glycyl-tRNA synthetase subunit alpha [Escherichia sp. 4_1_40B]
 gi|260846726|ref|YP_003224504.1| glycine tRNA synthetase, alpha subunit [Escherichia coli O103:H2
           str. 12009]
 gi|260858045|ref|YP_003231936.1| glycine tRNA synthetase, alpha subunit [Escherichia coli O26:H11
           str. 11368]
 gi|260870290|ref|YP_003236692.1| glycine tRNA synthetase, alpha subunit [Escherichia coli O111:H-
           str. 11128]
 gi|261224878|ref|ZP_05939159.1| glycine tRNA synthetase, alpha subunit [Escherichia coli O157:H7
           str. FRIK2000]
 gi|261254223|ref|ZP_05946756.1| glycine tRNA synthetase, alpha subunit [Escherichia coli O157:H7
           str. FRIK966]
 gi|291284936|ref|YP_003501754.1| Glycyl-tRNA synthetase alpha subunit [Escherichia coli O55:H7 str.
           CB9615]
 gi|293407182|ref|ZP_06651106.1| glycyl-tRNA synthetase alpha subunit [Escherichia coli FVEC1412]
 gi|293412994|ref|ZP_06655662.1| glycyl-tRNA synthetase [Escherichia coli B354]
 gi|293417007|ref|ZP_06659644.1| glycyl-tRNA synthetase [Escherichia coli B185]
 gi|293453869|ref|ZP_06664288.1| glycyl-tRNA synthetase [Escherichia coli B088]
 gi|297519888|ref|ZP_06938274.1| glycyl-tRNA synthetase subunit alpha [Escherichia coli OP50]
 gi|298382931|ref|ZP_06992526.1| glycyl-tRNA synthetase alpha subunit [Escherichia coli FVEC1302]
 gi|300815212|ref|ZP_07095437.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli MS 107-1]
 gi|300822038|ref|ZP_07102181.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli MS 119-7]
 gi|300898728|ref|ZP_07117040.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli MS 198-1]
 gi|300920444|ref|ZP_07136878.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli MS 115-1]
 gi|300925636|ref|ZP_07141501.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli MS 182-1]
 gi|300930912|ref|ZP_07146277.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli MS 187-1]
 gi|300937167|ref|ZP_07152020.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli MS 21-1]
 gi|300950350|ref|ZP_07164280.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli MS 116-1]
 gi|300957595|ref|ZP_07169797.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli MS 175-1]
 gi|300971419|ref|ZP_07171454.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli MS 45-1]
 gi|300976959|ref|ZP_07173694.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli MS 200-1]
 gi|301020272|ref|ZP_07184390.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli MS 69-1]
 gi|301028171|ref|ZP_07191442.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli MS 196-1]
 gi|301047086|ref|ZP_07194187.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli MS 185-1]
 gi|301328325|ref|ZP_07221429.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli MS 78-1]
 gi|301646006|ref|ZP_07245912.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli MS 146-1]
 gi|306816087|ref|ZP_07450225.1| glycyl-tRNA synthetase subunit alpha [Escherichia coli NC101]
 gi|307140251|ref|ZP_07499607.1| glycyl-tRNA synthetase subunit alpha [Escherichia coli H736]
 gi|307314646|ref|ZP_07594246.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli W]
 gi|309787764|ref|ZP_07682375.1| glycyl-tRNA synthetase alpha subunit [Shigella dysenteriae 1617]
 gi|309797583|ref|ZP_07691972.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli MS 145-7]
 gi|312968098|ref|ZP_07782309.1| glycyl-tRNA synthetase alpha subunit [Escherichia coli 2362-75]
 gi|312972164|ref|ZP_07786338.1| glycyl-tRNA synthetase alpha subunit [Escherichia coli 1827-70]
 gi|331644272|ref|ZP_08345401.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli H736]
 gi|331649390|ref|ZP_08350476.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli M605]
 gi|331655195|ref|ZP_08356194.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli M718]
 gi|331659875|ref|ZP_08360813.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli TA206]
 gi|331665184|ref|ZP_08366085.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli TA143]
 gi|331670393|ref|ZP_08371232.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli TA271]
 gi|331675049|ref|ZP_08375806.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli TA280]
 gi|331679640|ref|ZP_08380310.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli H591]
 gi|331685222|ref|ZP_08385808.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli H299]
 gi|332282127|ref|ZP_08394540.1| glycine tRNA synthetase alpha subunit [Shigella sp. D9]
 gi|54039659|sp|P67026|SYGA_ECO57 RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|54039660|sp|P67027|SYGA_SHIFL RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|54042275|sp|P67025|SYGA_ECOL6 RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|122421950|sp|Q1R536|SYGA_ECOUT RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|123146480|sp|Q0SY79|SYGA_SHIF8 RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|123343487|sp|Q0TBP3|SYGA_ECOL5 RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|123558351|sp|Q31V61|SYGA_SHIBS RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|123560983|sp|Q328M0|SYGA_SHIDS RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|123615796|sp|Q3YVU1|SYGA_SHISS RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|166200221|sp|A8ARE6|SYGA_CITK8 RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|166200223|sp|A1AHA1|SYGA_ECOK1 RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|166980029|sp|A7ZTA6|SYGA_ECO24 RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|166980030|sp|A8A617|SYGA_ECOHS RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|189082252|sp|B1IZN3|SYGA_ECOLC RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|226737036|sp|B7MER5|SYGA_ECO45 RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|226737037|sp|B7NP56|SYGA_ECO7I RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|226737038|sp|B7M3I2|SYGA_ECO8A RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|226737039|sp|B7NEL1|SYGA_ECOLU RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|226737040|sp|B1LJC1|SYGA_ECOSM RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|226737041|sp|B7LTH4|SYGA_ESCF3 RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|238064839|sp|B5YVL2|SYGA_ECO5E RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|238064840|sp|B6I3D0|SYGA_ECOSE RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|238689522|sp|B2U565|SYGA_SHIB3 RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|254781823|sp|B7ULC0|SYGA_ECO27 RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|254781824|sp|B7L6X1|SYGA_ECO55 RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|254781825|sp|B7N203|SYGA_ECO81 RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|259511907|sp|C4ZXF0|SYGA_ECOBW RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|12518294|gb|AAG58708.1|AE005582_11 glycine tRNA synthetase, alpha subunit [Escherichia coli O157:H7
           str. EDL933]
 gi|26110630|gb|AAN82815.1|AE016768_233 Glycyl-tRNA synthetase alpha chain [Escherichia coli CFT073]
 gi|13363917|dbj|BAB37866.1| glycine tRNA synthetase alpha subunit [Escherichia coli O157:H7
           str. Sakai]
 gi|24054069|gb|AAN45053.1| glycine tRNA synthetase, alpha subunit [Shigella flexneri 2a str.
           301]
 gi|30043414|gb|AAP19135.1| glycine tRNA synthetase, alpha subunit [Shigella flexneri 2a str.
           2457T]
 gi|73857664|gb|AAZ90371.1| glycine tRNA synthetase, alpha subunit [Shigella sonnei Ss046]
 gi|81243525|gb|ABB64235.1| glycine tRNA synthetase, alpha subunit [Shigella dysenteriae Sd197]
 gi|81247339|gb|ABB68047.1| glycine tRNA synthetase, alpha subunit [Shigella boydii Sb227]
 gi|91074647|gb|ABE09528.1| glycine tRNA synthetase, alpha subunit [Escherichia coli UTI89]
 gi|110345399|gb|ABG71636.1| glycine tRNA synthetase, alpha subunit [Escherichia coli 536]
 gi|110617319|gb|ABF05986.1| glycine tRNA synthetase, alpha subunit [Shigella flexneri 5 str.
           8401]
 gi|115514966|gb|ABJ03041.1| glycyl-tRNA synthetase subunit alpha [Escherichia coli APEC O1]
 gi|157068716|gb|ABV07971.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli HS]
 gi|157081366|gb|ABV21074.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli E24377A]
 gi|157086381|gb|ABV16059.1| hypothetical protein CKO_05016 [Citrobacter koseri ATCC BAA-895]
 gi|169753138|gb|ACA75837.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli ATCC 8739]
 gi|170124483|gb|EDS93414.1| glycyl-tRNA synthetase, alpha subunit [Escherichia albertii
           TW07627]
 gi|170521528|gb|ACB19706.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli SMS-3-5]
 gi|187428065|gb|ACD07339.1| glycyl-tRNA synthetase, alpha subunit [Shigella boydii CDC 3083-94]
 gi|187771688|gb|EDU35532.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli O157:H7
           str. EC4196]
 gi|188018372|gb|EDU56494.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli O157:H7
           str. EC4113]
 gi|188490108|gb|EDU65211.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli 53638]
 gi|189002567|gb|EDU71553.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli O157:H7
           str. EC4076]
 gi|189359380|gb|EDU77799.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli O157:H7
           str. EC4401]
 gi|189364678|gb|EDU83097.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli O157:H7
           str. EC4486]
 gi|189369512|gb|EDU87928.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli O157:H7
           str. EC4501]
 gi|189374294|gb|EDU92710.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli O157:H7
           str. EC869]
 gi|189379985|gb|EDU98401.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli O157:H7
           str. EC508]
 gi|190904706|gb|EDV64412.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli B7A]
 gi|190909349|gb|EDV68935.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli F11]
 gi|192932546|gb|EDV85143.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli E22]
 gi|192958179|gb|EDV88620.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli E110019]
 gi|194414460|gb|EDX30733.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli B171]
 gi|194420784|gb|EDX36860.1| glycyl-tRNA synthetase, alpha subunit [Shigella dysenteriae 1012]
 gi|194425362|gb|EDX41346.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli 101-1]
 gi|205325508|gb|EDZ13347.1| glycyl-tRNA synthetase, alpha subunit [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
 gi|208729262|gb|EDZ78863.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli O157:H7
           str. EC4206]
 gi|208733320|gb|EDZ82007.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli O157:H7
           str. EC4045]
 gi|208739586|gb|EDZ87268.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli O157:H7
           str. EC4042]
 gi|209157770|gb|ACI35203.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli O157:H7
           str. EC4115]
 gi|209755188|gb|ACI75906.1| glycine tRNA synthetase alpha subunit [Escherichia coli]
 gi|209755190|gb|ACI75907.1| glycine tRNA synthetase alpha subunit [Escherichia coli]
 gi|209755192|gb|ACI75908.1| glycine tRNA synthetase alpha subunit [Escherichia coli]
 gi|209755194|gb|ACI75909.1| glycine tRNA synthetase alpha subunit [Escherichia coli]
 gi|209755196|gb|ACI75910.1| glycine tRNA synthetase alpha subunit [Escherichia coli]
 gi|209914283|dbj|BAG79357.1| glycyl-tRNA synthase alpha subunit [Escherichia coli SE11]
 gi|215266916|emb|CAS11359.1| glycine tRNA synthetase, alpha subunit [Escherichia coli O127:H6
           str. E2348/69]
 gi|217320939|gb|EEC29363.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli O157:H7
           str. TW14588]
 gi|218354007|emb|CAV00499.1| glycine tRNA synthetase, alpha subunit [Escherichia coli 55989]
 gi|218358386|emb|CAQ91033.1| glycine tRNA synthetase, alpha subunit [Escherichia fergusonii ATCC
           35469]
 gi|218362887|emb|CAR00521.1| glycine tRNA synthetase, alpha subunit [Escherichia coli IAI1]
 gi|218367404|emb|CAR05186.1| glycine tRNA synthetase, alpha subunit [Escherichia coli S88]
 gi|218372311|emb|CAR20176.1| glycine tRNA synthetase, alpha subunit [Escherichia coli IAI39]
 gi|218429413|emb|CAR10374.2| glycine tRNA synthetase, alpha subunit [Escherichia coli ED1a]
 gi|218434290|emb|CAR15212.1| glycine tRNA synthetase, alpha subunit [Escherichia coli UMN026]
 gi|222035274|emb|CAP78019.1| glycyl-tRNA synthetase alpha chain [Escherichia coli LF82]
 gi|226839251|gb|EEH71274.1| glycyl-tRNA synthetase subunit alpha [Escherichia sp. 1_1_43]
 gi|226902594|gb|EEH88853.1| glycyl-tRNA synthetase subunit alpha [Escherichia sp. 3_2_53FAA]
 gi|227839306|gb|EEJ49772.1| glycyl-tRNA synthetase subunit alpha [Escherichia coli 83972]
 gi|238861372|gb|ACR63370.1| glycine tRNA synthetase, alpha subunit [Escherichia coli BW2952]
 gi|242379078|emb|CAQ33879.1| glycyl-tRNA synthetase, alpha subunit, subunit of glycyl-tRNA
           synthetase [Escherichia coli BL21(DE3)]
 gi|253322649|gb|ACT27251.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|253975385|gb|ACT41056.1| glycyl-tRNA synthetase subunit alpha [Escherichia coli B str.
           REL606]
 gi|253979541|gb|ACT45211.1| glycyl-tRNA synthetase subunit alpha [Escherichia coli BL21(DE3)]
 gi|254594916|gb|ACT74277.1| glycine tRNA synthetase, alpha subunit [Escherichia coli O157:H7
           str. TW14359]
 gi|257756694|dbj|BAI28196.1| glycine tRNA synthetase, alpha subunit [Escherichia coli O26:H11
           str. 11368]
 gi|257761873|dbj|BAI33370.1| glycine tRNA synthetase, alpha subunit [Escherichia coli O103:H2
           str. 12009]
 gi|257766646|dbj|BAI38141.1| glycine tRNA synthetase, alpha subunit [Escherichia coli O111:H-
           str. 11128]
 gi|260447423|gb|ACX37845.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli DH1]
 gi|281180604|dbj|BAI56934.1| glycyl-tRNA synthetase alpha subunit [Escherichia coli SE15]
 gi|281602928|gb|ADA75912.1| Glycyl-tRNA synthetase alpha subunit [Shigella flexneri 2002017]
 gi|284923592|emb|CBG36688.1| glycine-tRNA synthetase, alpha subunit [Escherichia coli 042]
 gi|290764809|gb|ADD58770.1| Glycyl-tRNA synthetase alpha subunit [Escherichia coli O55:H7 str.
           CB9615]
 gi|291321995|gb|EFE61426.1| glycyl-tRNA synthetase [Escherichia coli B088]
 gi|291425993|gb|EFE99027.1| glycyl-tRNA synthetase alpha subunit [Escherichia coli FVEC1412]
 gi|291431583|gb|EFF04568.1| glycyl-tRNA synthetase [Escherichia coli B185]
 gi|291468641|gb|EFF11134.1| glycyl-tRNA synthetase [Escherichia coli B354]
 gi|294490018|gb|ADE88774.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli IHE3034]
 gi|298276767|gb|EFI18285.1| glycyl-tRNA synthetase alpha subunit [Escherichia coli FVEC1302]
 gi|299878748|gb|EFI86959.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli MS 196-1]
 gi|300301003|gb|EFJ57388.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli MS 185-1]
 gi|300308429|gb|EFJ62949.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli MS 200-1]
 gi|300315663|gb|EFJ65447.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli MS 175-1]
 gi|300357646|gb|EFJ73516.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli MS 198-1]
 gi|300398849|gb|EFJ82387.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli MS 69-1]
 gi|300411253|gb|EFJ94791.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli MS 45-1]
 gi|300412577|gb|EFJ95887.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli MS 115-1]
 gi|300418254|gb|EFK01565.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli MS 182-1]
 gi|300450316|gb|EFK13936.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli MS 116-1]
 gi|300457753|gb|EFK21246.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli MS 21-1]
 gi|300461231|gb|EFK24724.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli MS 187-1]
 gi|300525401|gb|EFK46470.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli MS 119-7]
 gi|300532104|gb|EFK53166.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli MS 107-1]
 gi|300845220|gb|EFK72980.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli MS 78-1]
 gi|301075758|gb|EFK90564.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli MS 146-1]
 gi|305850483|gb|EFM50940.1| glycyl-tRNA synthetase subunit alpha [Escherichia coli NC101]
 gi|306905859|gb|EFN36383.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli W]
 gi|307555664|gb|ADN48439.1| glycine tRNA synthetase, alpha subunit [Escherichia coli ABU 83972]
 gi|307628641|gb|ADN72945.1| glycyl-tRNA synthetase subunit alpha [Escherichia coli UM146]
 gi|308118853|gb|EFO56115.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli MS 145-7]
 gi|308924514|gb|EFP70010.1| glycyl-tRNA synthetase alpha subunit [Shigella dysenteriae 1617]
 gi|309703963|emb|CBJ03306.1| glycine-tRNA synthetase, alpha subunit [Escherichia coli ETEC
           H10407]
 gi|310334541|gb|EFQ00746.1| glycyl-tRNA synthetase alpha subunit [Escherichia coli 1827-70]
 gi|312287357|gb|EFR15266.1| glycyl-tRNA synthetase alpha subunit [Escherichia coli 2362-75]
 gi|312948125|gb|ADR28952.1| glycyl-tRNA synthetase subunit alpha [Escherichia coli O83:H1 str.
           NRG 857C]
 gi|313647571|gb|EFS12021.1| glycyl-tRNA synthetase alpha subunit [Shigella flexneri 2a str.
           2457T]
 gi|315062846|gb|ADT77173.1| glycyl-tRNA synthetase subunit alpha [Escherichia coli W]
 gi|315138137|dbj|BAJ45296.1| glycyl-tRNA synthetase alpha subunit [Escherichia coli DH1]
 gi|315285315|gb|EFU44760.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli MS 110-3]
 gi|315294115|gb|EFU53467.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli MS 153-1]
 gi|315300120|gb|EFU59358.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli MS 16-3]
 gi|315618401|gb|EFU98988.1| glycyl-tRNA synthetase alpha subunit [Escherichia coli 3431]
 gi|320175984|gb|EFW51057.1| Glycyl-tRNA synthetase alpha chain [Shigella dysenteriae CDC
           74-1112]
 gi|320182076|gb|EFW56981.1| Glycyl-tRNA synthetase alpha chain [Shigella boydii ATCC 9905]
 gi|320187713|gb|EFW62388.1| Glycyl-tRNA synthetase alpha chain [Shigella flexneri CDC 796-83]
 gi|320193928|gb|EFW68561.1| Glycyl-tRNA synthetase alpha chain [Escherichia coli WV_060327]
 gi|320201419|gb|EFW76000.1| Glycyl-tRNA synthetase alpha chain [Escherichia coli EC4100B]
 gi|320639880|gb|EFX09474.1| glycyl-tRNA synthetase subunit alpha [Escherichia coli O157:H7 str.
           G5101]
 gi|320645043|gb|EFX14067.1| glycyl-tRNA synthetase subunit alpha [Escherichia coli O157:H- str.
           493-89]
 gi|320650310|gb|EFX18793.1| glycyl-tRNA synthetase subunit alpha [Escherichia coli O157:H- str.
           H 2687]
 gi|320655885|gb|EFX23808.1| glycyl-tRNA synthetase subunit alpha [Escherichia coli O55:H7 str.
           3256-97 TW 07815]
 gi|320661665|gb|EFX29080.1| glycyl-tRNA synthetase subunit alpha [Escherichia coli O55:H7 str.
           USDA 5905]
 gi|320666689|gb|EFX33672.1| glycyl-tRNA synthetase subunit alpha [Escherichia coli O157:H7 str.
           LSU-61]
 gi|323160672|gb|EFZ46611.1| glycyl-tRNA synthetase alpha subunit [Escherichia coli E128010]
 gi|323166948|gb|EFZ52687.1| glycyl-tRNA synthetase alpha subunit [Shigella sonnei 53G]
 gi|323179477|gb|EFZ65044.1| glycyl-tRNA synthetase alpha subunit [Escherichia coli 1180]
 gi|323182715|gb|EFZ68117.1| glycyl-tRNA synthetase alpha subunit [Escherichia coli 1357]
 gi|323189398|gb|EFZ74680.1| glycyl-tRNA synthetase alpha subunit [Escherichia coli RN587/1]
 gi|323376563|gb|ADX48831.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli KO11]
 gi|323934886|gb|EGB31268.1| glycyl-tRNA synthetase alpha [Escherichia coli E1520]
 gi|323939540|gb|EGB35748.1| glycyl-tRNA synthetase alpha subunit [Escherichia coli E482]
 gi|323944543|gb|EGB40614.1| glycyl-tRNA synthetase alpha [Escherichia coli H120]
 gi|323949803|gb|EGB45687.1| glycyl-tRNA synthetase alpha subunit [Escherichia coli H252]
 gi|323954896|gb|EGB50676.1| glycyl-tRNA synthetase alpha subunit [Escherichia coli H263]
 gi|323959376|gb|EGB55036.1| glycyl-tRNA synthetase alpha subunit [Escherichia coli H489]
 gi|323966029|gb|EGB61470.1| glycyl-tRNA synthetase alpha subunit [Escherichia coli M863]
 gi|323971319|gb|EGB66561.1| glycyl-tRNA synthetase alpha subunit [Escherichia coli TA007]
 gi|323975028|gb|EGB70137.1| glycyl-tRNA synthetase alpha subunit [Escherichia coli TW10509]
 gi|324007364|gb|EGB76583.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli MS 57-2]
 gi|324014232|gb|EGB83451.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli MS 60-1]
 gi|324017915|gb|EGB87134.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli MS 117-3]
 gi|324111898|gb|EGC05878.1| glycyl-tRNA synthetase alpha subunit [Escherichia fergusonii B253]
 gi|324116561|gb|EGC10478.1| glycyl-tRNA synthetase alpha subunit [Escherichia coli E1167]
 gi|325499118|gb|EGC96977.1| glycyl-tRNA synthetase subunit alpha [Escherichia fergusonii
           ECD227]
 gi|326337436|gb|EGD61271.1| Glycyl-tRNA synthetase alpha chain [Escherichia coli O157:H7 str.
           1044]
 gi|326339961|gb|EGD63768.1| Glycyl-tRNA synthetase alpha chain [Escherichia coli O157:H7 str.
           1125]
 gi|327251211|gb|EGE62904.1| glycyl-tRNA synthetase alpha subunit [Escherichia coli STEC_7v]
 gi|330909622|gb|EGH38136.1| glycyl-tRNA synthetase alpha chain [Escherichia coli AA86]
 gi|331036566|gb|EGI08792.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli H736]
 gi|331041888|gb|EGI14032.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli M605]
 gi|331047210|gb|EGI19288.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli M718]
 gi|331053090|gb|EGI25123.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli TA206]
 gi|331057694|gb|EGI29680.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli TA143]
 gi|331062455|gb|EGI34375.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli TA271]
 gi|331067958|gb|EGI39356.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli TA280]
 gi|331072812|gb|EGI44137.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli H591]
 gi|331077593|gb|EGI48805.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli H299]
 gi|332085077|gb|EGI90257.1| glycyl-tRNA synthetase alpha subunit [Shigella boydii 5216-82]
 gi|332085921|gb|EGI91085.1| glycyl-tRNA synthetase alpha subunit [Shigella dysenteriae 155-74]
 gi|332089574|gb|EGI94678.1| glycyl-tRNA synthetase alpha subunit [Shigella boydii 3594-74]
 gi|332104479|gb|EGJ07825.1| glycine tRNA synthetase alpha subunit [Shigella sp. D9]
 gi|332345528|gb|AEE58862.1| glycyl-tRNA synthetase alpha subunit GlyQ [Escherichia coli UMNK88]
 gi|332749992|gb|EGJ80404.1| glycyl-tRNA synthetase alpha subunit [Shigella flexneri K-671]
 gi|332764239|gb|EGJ94476.1| glycyl-tRNA synthetase alpha subunit [Shigella flexneri 2930-71]
 gi|332996372|gb|EGK15999.1| glycyl-tRNA synthetase alpha subunit [Shigella flexneri VA-6]
          Length = 303

 Score =  560 bits (1445), Expect = e-158,   Method: Composition-based stats.
 Identities = 187/301 (62%), Positives = 222/301 (73%), Gaps = 8/301 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +ILTL  YWA+QGCTI+QP DMEVGAGT HP T LRALGP    AAYVQ
Sbjct: 1   MQKFDTRTFQGLILTLQDYWARQGCTIVQPLDMEVGAGTSHPMTCLRALGPEPMAAAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQV+IKP+P N+Q LY+ SLK +G+DP IHD+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVVIKPSPDNIQELYLGSLKELGMDPTIHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLERLAMY+Q V+SV
Sbjct: 121 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGLERLAMYIQGVDSV 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V++        YGD+F Q+E E S YNFEYA+ + L   F   EKE   LL    P 
Sbjct: 181 YDLVWSDGPLGKTTYGDVFHQNEVEQSTYNFEYADVDFLFTCFEQYEKEAQQLLALENP- 239

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY++ +KA+H FNLLDAR  IS TERQRYILRIR+L KA  EA+  +  
Sbjct: 240 -------LPLPAYERILKAAHSFNLLDARKAISVTERQRYILRIRTLTKAVAEAYYASRE 292

Query: 305 G 305
            
Sbjct: 293 A 293


>gi|146305056|ref|YP_001185521.1| glycyl-tRNA synthetase subunit alpha [Pseudomonas mendocina ymp]
 gi|166200563|sp|A4XN73|SYGA_PSEMY RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|145573257|gb|ABP82789.1| glycyl-tRNA synthetase alpha chain [Pseudomonas mendocina ymp]
          Length = 315

 Score =  560 bits (1445), Expect = e-158,   Method: Composition-based stats.
 Identities = 184/300 (61%), Positives = 224/300 (74%), Gaps = 10/300 (3%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
            NK    +FQ++IL L  YWA+QGC +LQPYDMEVGAGTFH +T LRA+GP +W AAYVQ
Sbjct: 3   QNKPAVRTFQDLILALQNYWAEQGCVVLQPYDMEVGAGTFHTATFLRAVGPETWNAAYVQ 62

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQV++KPNP N Q LY+ SLKA+G+DP +HD+RFVEDN
Sbjct: 63  PSRRPTDGRYGENPNRLQHYYQFQVVLKPNPENFQELYLGSLKAIGLDPEVHDIRFVEDN 122

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WESPTLGAWGLGWE W +GME++QFTYFQQV GIEC P++GEITYGLERLAMY+Q V+SV
Sbjct: 123 WESPTLGAWGLGWEIWLNGMEVTQFTYFQQVGGIECYPVTGEITYGLERLAMYLQGVDSV 182

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+++       V YGD+F Q+E E S YNFE+AN E L   F   E E   L++  +P 
Sbjct: 183 YDLIWTDGPFGTVTYGDVFHQNEVEQSTYNFEHANVEKLFELFDFYESEANRLIELELP- 241

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     P Y+  +KASH FNLLDAR  IS T RQ+YILR+R+LA+A  +++L    
Sbjct: 242 ---------LPTYEMVLKASHTFNLLDARRAISVTARQQYILRVRTLARAVAQSYLQARA 292


>gi|54307293|ref|YP_128313.1| glycyl-tRNA synthetase subunit alpha [Photobacterium profundum SS9]
 gi|46911713|emb|CAG18511.1| Putative glycyl-tRNA synthetase, alpha chain [Photobacterium
           profundum SS9]
          Length = 321

 Score =  560 bits (1445), Expect = e-158,   Method: Composition-based stats.
 Identities = 182/302 (60%), Positives = 219/302 (72%), Gaps = 8/302 (2%)

Query: 4   IHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYV 63
                +  +FQ +IL L  YW +QGCTI+QP DMEVGAGT HP T LRALGP    AAYV
Sbjct: 18  TMQNYDIKTFQGMILALQDYWGKQGCTIVQPLDMEVGAGTSHPMTCLRALGPEPIAAAYV 77

Query: 64  QPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVED 123
           QPSRRP DGRY ENPNRLQHYYQFQV++KP+P N+Q LY+ SL+ +G+D  +HD+RFVED
Sbjct: 78  QPSRRPTDGRYGENPNRLQHYYQFQVMLKPSPDNIQELYLGSLEVLGVDTQVHDIRFVED 137

Query: 124 NWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNS 183
           NWE+PTLGAWGLGWE W +GME++QFTYFQQV GIEC P++GEITYG+ERLAMY+QNV+S
Sbjct: 138 NWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGIECKPVTGEITYGIERLAMYIQNVDS 197

Query: 184 VYDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIP 243
           VYD+V+       V YGDIF Q+E E S YNFE+A+ + L   F   EKEC +LL    P
Sbjct: 198 VYDLVWTDGPLGKVTYGDIFHQNEVEQSTYNFEHADVDFLFTFFDQCEKECKELLALETP 257

Query: 244 NEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTP 303
                      PAY++ +KA H FNLLDAR  IS TERQRYILRIR+L K   EA+  + 
Sbjct: 258 --------LSLPAYERILKAGHAFNLLDARKAISVTERQRYILRIRNLTKQVAEAYYASR 309

Query: 304 NG 305
             
Sbjct: 310 EA 311


>gi|90413725|ref|ZP_01221713.1| glycyl-tRNA synthetase alpha subunit [Photobacterium profundum
           3TCK]
 gi|90325194|gb|EAS41691.1| glycyl-tRNA synthetase alpha subunit [Photobacterium profundum
           3TCK]
          Length = 303

 Score =  560 bits (1445), Expect = e-158,   Method: Composition-based stats.
 Identities = 182/301 (60%), Positives = 219/301 (72%), Gaps = 8/301 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
               +  +FQ +IL L  YW +QGCTI+QP DMEVGAGT HP T LRALGP    AAYVQ
Sbjct: 1   MQNYDIKTFQGMILALQDYWGKQGCTIVQPLDMEVGAGTSHPMTCLRALGPEPIAAAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQV++KP+P N+Q LY+ SL+ +G+D  +HD+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVMLKPSPDNIQELYLGSLEVLGVDTQVHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV GIEC P++GEITYG+ERLAMY+QNV+SV
Sbjct: 121 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGIECKPVTGEITYGIERLAMYIQNVDSV 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V+       V YGDIF Q+E E S YNFE+A+ + L   F   EKEC +LL    P 
Sbjct: 181 YDLVWTDGPLGKVTYGDIFHQNEVEQSTYNFEHADVDFLFTFFDQCEKECKELLALETP- 239

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY++ +KA H FNLLDAR  IS TERQRYILRIR+L K   EA+  +  
Sbjct: 240 -------LSLPAYERILKAGHAFNLLDARKAISVTERQRYILRIRNLTKQVAEAYYASRE 292

Query: 305 G 305
            
Sbjct: 293 A 293


>gi|77456238|ref|YP_345743.1| glycyl-tRNA synthetase subunit alpha [Pseudomonas fluorescens
           Pf0-1]
 gi|229587589|ref|YP_002869708.1| glycyl-tRNA synthetase subunit alpha [Pseudomonas fluorescens
           SBW25]
 gi|123606502|sp|Q3KKF2|SYGA_PSEPF RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|259511912|sp|C3KE41|SYGA_PSEFS RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|77380241|gb|ABA71754.1| glycyl-tRNA synthetase alpha chain [Pseudomonas fluorescens Pf0-1]
 gi|229359455|emb|CAY46296.1| glycyl-tRNA synthetase alpha chain [Pseudomonas fluorescens SBW25]
          Length = 317

 Score =  560 bits (1445), Expect = e-158,   Method: Composition-based stats.
 Identities = 183/293 (62%), Positives = 223/293 (76%), Gaps = 8/293 (2%)

Query: 12  SFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPLD 71
           +FQ++IL L QYWA+QGC +LQPYDMEVGAGTFH +T LRA+GP +W AAYVQPSRRP D
Sbjct: 10  TFQDLILALQQYWAEQGCVVLQPYDMEVGAGTFHTATFLRAIGPETWNAAYVQPSRRPTD 69

Query: 72  GRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTLG 131
           GRY ENPNRLQHYYQFQV++KPNP N Q LY+ SLK VG+DPL+HD+RFVEDNWESPTLG
Sbjct: 70  GRYGENPNRLQHYYQFQVVLKPNPDNFQELYLGSLKHVGLDPLVHDIRFVEDNWESPTLG 129

Query: 132 AWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFNA 191
           AWGLGWE W +GME++QFTYFQQ  GIEC P++GEITYGLERLAMY+Q V+SVYD+V+  
Sbjct: 130 AWGLGWEVWLNGMEVTQFTYFQQAGGIECYPVTGEITYGLERLAMYLQGVDSVYDLVWAD 189

Query: 192 IEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHHL 251
                V YGD+F Q+E E S YNFE+AN + L   F   E E   L++   P        
Sbjct: 190 GPFGKVTYGDVFHQNEVEQSTYNFEHANVDKLFELFDFYESEAKRLIELDQP-------- 241

Query: 252 CVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
              P+Y+  +KASH FNLLDAR  IS T RQ+YILR+R+LA++  +A+L+   
Sbjct: 242 LPLPSYEMVLKASHTFNLLDARRAISVTARQQYILRVRTLARSVAQAYLLARA 294


>gi|91975699|ref|YP_568358.1| glycyl-tRNA synthetase subunit alpha [Rhodopseudomonas palustris
           BisB5]
 gi|91682155|gb|ABE38457.1| Glycine--tRNA ligase [Rhodopseudomonas palustris BisB5]
          Length = 320

 Score =  560 bits (1445), Expect = e-158,   Method: Composition-based stats.
 Identities = 202/301 (67%), Positives = 241/301 (80%), Gaps = 1/301 (0%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
            + + + SFQ +ILTL ++WA  GC ILQPYDMEVGAGTFHP+TTLRALGP  W AAYVQ
Sbjct: 6   PHMRPERSFQGLILTLQRFWADYGCVILQPYDMEVGAGTFHPATTLRALGPKRWNAAYVQ 65

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQVI+KP+P +LQ+LY++SL A+G+D  +HDVRFVED+
Sbjct: 66  PSRRPKDGRYGENPNRLQHYYQFQVILKPSPPDLQDLYLKSLAAIGVDTALHDVRFVEDD 125

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WESPTLGAWGLGWECWCDGME+SQFTYFQQV G+EC+P++GE+TYGLERLAMYVQ ++ V
Sbjct: 126 WESPTLGAWGLGWECWCDGMEVSQFTYFQQVAGVECAPVAGELTYGLERLAMYVQGIDRV 185

Query: 185 YDIVFNAIEG-QNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIP 243
           YD+ FN  +G   V YGD+F Q+E+EYS++NFE A+ E+L   F  +E  C   L  G  
Sbjct: 186 YDLNFNGRDGADKVTYGDVFLQAEKEYSKHNFEVADTEMLFEQFKMAEAACKKYLDAGWQ 245

Query: 244 NEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTP 303
           +     H    PAYDQCIKASH+FNLLDARGVIS TERQ YILR+R LAKACGEA+L T 
Sbjct: 246 DGKREAHAMALPAYDQCIKASHVFNLLDARGVISVTERQSYILRVRELAKACGEAWLHTE 305

Query: 304 N 304
            
Sbjct: 306 A 306


>gi|152972430|ref|YP_001337576.1| glycyl-tRNA synthetase subunit alpha [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|262040631|ref|ZP_06013869.1| glycyl-tRNA synthetase [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|330002314|ref|ZP_08304294.1| glycine--tRNA ligase, alpha subunit [Klebsiella sp. MS 92-3]
 gi|166200228|sp|A6TFH5|SYGA_KLEP7 RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|150957279|gb|ABR79309.1| glycyl-tRNA synthetase alpha subunit [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|259041995|gb|EEW43028.1| glycyl-tRNA synthetase [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|328537335|gb|EGF63586.1| glycine--tRNA ligase, alpha subunit [Klebsiella sp. MS 92-3]
          Length = 303

 Score =  560 bits (1445), Expect = e-158,   Method: Composition-based stats.
 Identities = 186/301 (61%), Positives = 221/301 (73%), Gaps = 8/301 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +ILTL  YWA+QGCTI+QP DMEVGAGT HP T LRALGP     AYVQ
Sbjct: 1   MQKFDTRTFQGLILTLQDYWARQGCTIVQPLDMEVGAGTSHPMTCLRALGPEPMATAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQV+IKP+P N+Q LY+ SLK +G+DP IHD+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVVIKPSPDNIQELYLGSLKELGMDPTIHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLERLAMY+Q V+SV
Sbjct: 121 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGLERLAMYIQGVDSV 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V++        YGD+F Q+E E S YNFEYA+ + L   F   EKE   LL    P 
Sbjct: 181 YDLVWSDGPLGKTTYGDVFHQNEVEQSTYNFEYADVDFLFTCFEQYEKEAQQLLALETP- 239

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY++ +KA+H FNLLDAR  IS TERQRYILRIR+L KA  EA+  +  
Sbjct: 240 -------LPLPAYERILKAAHSFNLLDARKAISVTERQRYILRIRTLTKAVAEAYYASRE 292

Query: 305 G 305
            
Sbjct: 293 A 293


>gi|84499659|ref|ZP_00997947.1| glycyl-tRNA synthetase alpha subunit [Oceanicola batsensis
           HTCC2597]
 gi|84392803|gb|EAQ05014.1| glycyl-tRNA synthetase alpha subunit [Oceanicola batsensis
           HTCC2597]
          Length = 314

 Score =  560 bits (1445), Expect = e-158,   Method: Composition-based stats.
 Identities = 191/304 (62%), Positives = 238/304 (78%), Gaps = 2/304 (0%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
              +   SFQ IIL L  YWA +GC I+QPYDMEVGAGTFHP+TTLR+LG   W AAYVQ
Sbjct: 3   RTAETPRSFQEIILRLQTYWASRGCAIMQPYDMEVGAGTFHPATTLRSLGSRPWAAAYVQ 62

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQ+QV+IKP+P +LQ+LY+ SL+A+GID  +HD+RFVED+
Sbjct: 63  PSRRPTDGRYGENPNRLQHYYQYQVLIKPSPPDLQDLYLGSLEAIGIDMEMHDIRFVEDD 122

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WESPTLGAWGLGWE WCDGME+SQFTYFQQV G +C P+SGE+TYGLERLAMYV  ++ V
Sbjct: 123 WESPTLGAWGLGWEVWCDGMEVSQFTYFQQVGGHDCHPVSGELTYGLERLAMYVLGIDHV 182

Query: 185 YDIVFNAIEGQN-VLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLL-KKGI 242
            D+ FN  +    + YGD+F Q+EQEYSR+NF+ A+ ++L  HF ++E EC  +L ++ +
Sbjct: 183 MDMPFNDPQAPIALSYGDVFRQTEQEYSRWNFDVADTDMLLKHFEEAEAECNAILSQEAV 242

Query: 243 PNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMT 302
             +  +  +   PAYDQCIKASH+FNLLDARGVIS TERQ YI R+R+LA+ C +AF+ T
Sbjct: 243 DPKTGKRIVMAHPAYDQCIKASHLFNLLDARGVISVTERQAYIGRVRALARKCADAFVQT 302

Query: 303 PNGG 306
             GG
Sbjct: 303 EAGG 306


>gi|119475259|ref|ZP_01615612.1| Glycyl-tRNA synthetase, alpha subunit [marine gamma proteobacterium
           HTCC2143]
 gi|119451462|gb|EAW32695.1| Glycyl-tRNA synthetase, alpha subunit [marine gamma proteobacterium
           HTCC2143]
          Length = 335

 Score =  560 bits (1445), Expect = e-158,   Method: Composition-based stats.
 Identities = 184/303 (60%), Positives = 224/303 (73%), Gaps = 10/303 (3%)

Query: 1   MAPIHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKA 60
           +          +FQ++ILTL QYWA+QGC ILQP DMEVGAGTFHP T LRA+GP +W A
Sbjct: 19  IVTSQKISEAKTFQDLILTLQQYWAEQGCIILQPLDMEVGAGTFHPGTFLRAIGPETWNA 78

Query: 61  AYVQPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRF 120
           AYVQP RRP DGRY ENPNRLQHY+Q+QV++KPNP NLQ LY+ESLKA+GID LIHDVRF
Sbjct: 79  AYVQPCRRPTDGRYGENPNRLQHYFQYQVVMKPNPPNLQELYLESLKALGIDTLIHDVRF 138

Query: 121 VEDNWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQN 180
           VEDNWESPTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLER+AMY+Q 
Sbjct: 139 VEDNWESPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECYPVTGEITYGLERIAMYLQG 198

Query: 181 VNSVYDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKK 240
           V+S+YD+V+       V YGD+F Q+E E S +NFE A+ E L   F   E E   L +K
Sbjct: 199 VDSIYDLVWTHGPEGKVTYGDVFHQNEVEMSTFNFEEADVEQLFKTFDHCEAESRRLTEK 258

Query: 241 GIPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFL 300
           G+P           PAY+  +KASH FNLLDAR  IS TERQR+ILR+R+L++   + + 
Sbjct: 259 GLP----------LPAYEMVMKASHAFNLLDARHAISVTERQRFILRVRALSRGVAQGYY 308

Query: 301 MTP 303
              
Sbjct: 309 DKR 311


>gi|206579635|ref|YP_002236066.1| glycyl-tRNA synthetase, alpha subunit [Klebsiella pneumoniae 342]
 gi|288933064|ref|YP_003437123.1| glycyl-tRNA synthetase, subunit alpha [Klebsiella variicola At-22]
 gi|290511858|ref|ZP_06551226.1| glycyl-tRNA synthetase, alpha subunit [Klebsiella sp. 1_1_55]
 gi|238064843|sp|B5XMY6|SYGA_KLEP3 RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|206568693|gb|ACI10469.1| glycyl-tRNA synthetase, alpha subunit [Klebsiella pneumoniae 342]
 gi|288887793|gb|ADC56111.1| glycyl-tRNA synthetase, alpha subunit [Klebsiella variicola At-22]
 gi|289775648|gb|EFD83648.1| glycyl-tRNA synthetase, alpha subunit [Klebsiella sp. 1_1_55]
          Length = 303

 Score =  560 bits (1445), Expect = e-158,   Method: Composition-based stats.
 Identities = 186/301 (61%), Positives = 222/301 (73%), Gaps = 8/301 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +ILTL  YWA+QGCTI+QP DMEVGAGT HP T LRALGP     AYVQ
Sbjct: 1   MQKFDTRTFQGLILTLQDYWARQGCTIVQPLDMEVGAGTSHPMTCLRALGPEPMATAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQV+IKP+P N+Q LY+ SLK +G+DP IHD+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVVIKPSPDNIQELYLGSLKELGMDPTIHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLERLAMY+Q V+SV
Sbjct: 121 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGLERLAMYIQGVDSV 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V++        YGD+F Q+E E S YNFEYA+ + L + F   EKE   LL    P 
Sbjct: 181 YDLVWSDGPLGKTTYGDVFHQNEVEQSTYNFEYADVDFLFSCFEQYEKEAQQLLALETP- 239

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY++ +KA+H FNLLDAR  IS TERQRYILRIR+L KA  EA+  +  
Sbjct: 240 -------LPLPAYERILKAAHSFNLLDARKAISVTERQRYILRIRTLTKAVAEAYYASRE 292

Query: 305 G 305
            
Sbjct: 293 A 293


>gi|170740975|ref|YP_001769630.1| glycyl-tRNA synthetase subunit alpha [Methylobacterium sp. 4-46]
 gi|168195249|gb|ACA17196.1| glycyl-tRNA synthetase, alpha subunit [Methylobacterium sp. 4-46]
          Length = 313

 Score =  560 bits (1444), Expect = e-158,   Method: Composition-based stats.
 Identities = 209/298 (70%), Positives = 244/298 (81%), Gaps = 3/298 (1%)

Query: 12  SFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPLD 71
           SFQ +ILTL ++WA QGC ILQPYDMEVGAGTFHP+TTLRALGP  WKAAYVQPSRRP D
Sbjct: 13  SFQGLILTLQRFWAAQGCVILQPYDMEVGAGTFHPATTLRALGPRPWKAAYVQPSRRPKD 72

Query: 72  GRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTLG 131
           GRY ENPNRLQHYYQFQVI+KPNP +LQ+LY+ SL+ +G+D  +HD+RFVED+WESPTLG
Sbjct: 73  GRYGENPNRLQHYYQFQVILKPNPPDLQDLYLASLRVIGVDLALHDIRFVEDDWESPTLG 132

Query: 132 AWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFNA 191
           AWGLGWECWCDGME+SQFTYFQQV G EC+P++GE+TYGLERLAMYVQ V +VYD+ FN 
Sbjct: 133 AWGLGWECWCDGMEVSQFTYFQQVAGFECAPVAGELTYGLERLAMYVQGVENVYDLNFNG 192

Query: 192 IEG-QNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLK--KGIPNEHHR 248
           ++G + V YGD+F Q+EQEYSR+NFE A+ E+L  HF D+E  C   L   +  P  +  
Sbjct: 193 LDGPERVSYGDVFLQAEQEYSRHNFEAADTEMLFRHFRDAEAACRRYLDFGEPGPAANDA 252

Query: 249 HHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNGG 306
            H    PAYDQCIKASH+FNLLDARGVIS TERQ YILR+R LAKACG A+L T  GG
Sbjct: 253 RHRMAQPAYDQCIKASHVFNLLDARGVISVTERQSYILRVRDLAKACGAAWLRTQAGG 310


>gi|254429074|ref|ZP_05042781.1| glycyl-tRNA synthetase, alpha subunit [Alcanivorax sp. DG881]
 gi|196195243|gb|EDX90202.1| glycyl-tRNA synthetase, alpha subunit [Alcanivorax sp. DG881]
          Length = 334

 Score =  560 bits (1444), Expect = e-158,   Method: Composition-based stats.
 Identities = 182/297 (61%), Positives = 227/297 (76%), Gaps = 10/297 (3%)

Query: 7   KKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPS 66
           + + L+FQ +IL L QYWA+QGC ++QP DMEVGAGTFHPST LRA+GP +W +AYVQPS
Sbjct: 6   QTDILTFQGLILALQQYWAEQGCVVVQPLDMEVGAGTFHPSTFLRAIGPENWNSAYVQPS 65

Query: 67  RRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWE 126
           RRP DGRY ENPNRLQHYYQFQV++KP+P N+Q LY+ SL+ +G DPL+HD+RFVEDNWE
Sbjct: 66  RRPTDGRYGENPNRLQHYYQFQVVLKPSPDNIQELYLGSLRMLGFDPLVHDIRFVEDNWE 125

Query: 127 SPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYD 186
           SPTLGAWGLGWE W +GME++QFTYFQQV GI+C P++GEITYGLERLAMY+Q V+SVYD
Sbjct: 126 SPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGIDCYPVTGEITYGLERLAMYIQGVDSVYD 185

Query: 187 IVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEH 246
           +V++      V YGD+F Q+E E S +NFE+AN + L   F   E E   L+  G+P   
Sbjct: 186 LVWSDGPFGKVSYGDVFLQNEVEMSTFNFEHANVDELFKQFDLFEGESTKLIAAGLP--- 242

Query: 247 HRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTP 303
                   PAY+  +KASH FNLLDAR  IS TERQR+ILR+R+LA+A  +A+    
Sbjct: 243 -------LPAYEYVLKASHTFNLLDARKAISVTERQRFILRVRTLARAVAQAYFDKR 292


>gi|330500956|ref|YP_004377825.1| glycyl-tRNA synthetase subunit alpha [Pseudomonas mendocina NK-01]
 gi|328915242|gb|AEB56073.1| glycyl-tRNA synthetase subunit alpha [Pseudomonas mendocina NK-01]
          Length = 315

 Score =  560 bits (1444), Expect = e-158,   Method: Composition-based stats.
 Identities = 184/300 (61%), Positives = 224/300 (74%), Gaps = 10/300 (3%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
            NK    +FQ++IL L  YWA+QGC +LQPYDMEVGAGTFH +T LRA+GP +W AAYVQ
Sbjct: 3   QNKPAVRTFQDLILALQNYWAEQGCVVLQPYDMEVGAGTFHTATFLRAVGPETWNAAYVQ 62

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQV++KPNP N Q LY+ SLKA+G+DP +HD+RFVEDN
Sbjct: 63  PSRRPTDGRYGENPNRLQHYYQFQVVLKPNPENFQELYLGSLKAIGLDPEVHDIRFVEDN 122

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WESPTLGAWGLGWE W +GME++QFTYFQQV GIEC P++GEITYGLERLAMY+Q V+SV
Sbjct: 123 WESPTLGAWGLGWEIWLNGMEVTQFTYFQQVGGIECYPVTGEITYGLERLAMYLQGVDSV 182

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+++       V YGD+F Q+E E S YNFE+AN E L   F   E E   L++  +P 
Sbjct: 183 YDLIWTDGPFGTVTYGDVFHQNEVEQSTYNFEHANVEKLFELFDFYESEANRLIELELP- 241

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     P Y+  +KASH FNLLDAR  IS T RQ+YILR+R+LA+A  +++L    
Sbjct: 242 ---------LPTYEMVLKASHTFNLLDARRAISVTARQQYILRVRTLARAVAQSYLQARA 292


>gi|39995685|ref|NP_951636.1| glycyl-tRNA synthetase subunit alpha [Geobacter sulfurreducens PCA]
 gi|81703270|sp|Q74FM8|SYGA_GEOSL RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|39982448|gb|AAR33909.1| glycyl-tRNA synthetase, alpha subunit [Geobacter sulfurreducens
           PCA]
 gi|298504696|gb|ADI83419.1| glycyl-tRNA synthetase, alpha subunit [Geobacter sulfurreducens
           KN400]
          Length = 292

 Score =  560 bits (1444), Expect = e-158,   Method: Composition-based stats.
 Identities = 174/294 (59%), Positives = 218/294 (74%), Gaps = 14/294 (4%)

Query: 11  LSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPL 70
           ++FQ++IL L  YWAQQGC I QPYD E GAGTF+P+T LR LGP  W  AYV+PSRRP 
Sbjct: 1   MTFQDLILALQGYWAQQGCVIQQPYDTEKGAGTFNPATFLRVLGPEPWNVAYVEPSRRPT 60

Query: 71  DGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTL 130
           DGRY ENPNRLQHYYQFQVI+KP+P+N+ +LY++SL+A GIDP  HD+RFVED+WESPTL
Sbjct: 61  DGRYGENPNRLQHYYQFQVIMKPSPMNILDLYLDSLRAFGIDPAKHDIRFVEDDWESPTL 120

Query: 131 GAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFN 190
           GAWGLGWE W DGMEI+QFTYFQQ  GI+  P+S EITYG ER+AMY+Q V++VYD+ + 
Sbjct: 121 GAWGLGWEVWLDGMEITQFTYFQQAGGIDLKPVSSEITYGCERIAMYLQGVDNVYDLEWV 180

Query: 191 AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHH 250
               + V YGDI  ++E E+S YNFE A+ ++L   F   EKEC+ L+++G+        
Sbjct: 181 ----KGVSYGDIHHRTEVEFSTYNFEEADVDMLLTLFTMYEKECVRLVERGL-------- 228

Query: 251 LCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
             V PAYD  +K SH FNLLDARG IS TER  YI R+R++A+ C E +L    
Sbjct: 229 --VLPAYDFVMKCSHTFNLLDARGAISVTERASYIGRVRNVARLCAEGYLKLRE 280


>gi|257095240|ref|YP_003168881.1| glycyl-tRNA synthetase subunit alpha [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
 gi|257047764|gb|ACV36952.1| glycyl-tRNA synthetase, alpha subunit [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
          Length = 303

 Score =  560 bits (1444), Expect = e-157,   Method: Composition-based stats.
 Identities = 168/294 (57%), Positives = 217/294 (73%), Gaps = 10/294 (3%)

Query: 12  SFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPLD 71
           +FQ +IL L  +W +QGC +LQPYD+EVGAGTFH +T LRA+GP  W AAYVQPSRRP D
Sbjct: 3   TFQEVILRLQDFWDKQGCALLQPYDIEVGAGTFHTATFLRAIGPEPWNAAYVQPSRRPKD 62

Query: 72  GRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTLG 131
           GRY ENPNRLQHYYQ+QV++KP+P N+Q+LY++SL+A+GID   HD+RFVED+WESPTLG
Sbjct: 63  GRYGENPNRLQHYYQYQVVLKPSPANIQDLYLDSLRALGIDTSRHDIRFVEDDWESPTLG 122

Query: 132 AWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFNA 191
           AWGLGWE W DGME++QFTYFQ+V  + C P+ GEITYG+ERLAMY+Q V +V+D+V+  
Sbjct: 123 AWGLGWEVWLDGMEVTQFTYFQEVGSLPCKPVLGEITYGIERLAMYLQGVENVFDLVWGE 182

Query: 192 IEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHHL 251
             G  V YGD++ Q+E E S+YNFE++N E+L  HF + E E   L+  G+         
Sbjct: 183 GPGYRVTYGDVYHQNEVEQSKYNFEHSNVEMLFRHFNEHESEARRLIAAGL--------- 233

Query: 252 CVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNG 305
              P Y+  +K SH FNLLDARG IS TER  YI R+R+LA+   +A+  +   
Sbjct: 234 -ALPGYEMVMKCSHTFNLLDARGAISVTERAAYIGRVRALAREVAQAYHDSRQA 286


>gi|119897076|ref|YP_932289.1| glycyl-tRNA synthetase subunit alpha [Azoarcus sp. BH72]
 gi|119669489|emb|CAL93402.1| Glycyl-tRNA synthetase alpha chain [Azoarcus sp. BH72]
          Length = 308

 Score =  560 bits (1444), Expect = e-157,   Method: Composition-based stats.
 Identities = 175/306 (57%), Positives = 228/306 (74%), Gaps = 14/306 (4%)

Query: 1   MAPIHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKA 60
           M+P H K    +FQ +ILTL Q+W ++GC +LQPYD+EVGAGT H +T LRA+GP  W A
Sbjct: 1   MSPAHAKP---TFQQVILTLQQFWGERGCVLLQPYDLEVGAGTSHTATFLRAIGPEPWNA 57

Query: 61  AYVQPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRF 120
           AYVQPSRRP DGRY ENPNRLQHYYQ+QV++KP+PLN+Q LY++SL+A+GIDP  HD+RF
Sbjct: 58  AYVQPSRRPKDGRYGENPNRLQHYYQYQVVLKPSPLNIQELYLDSLRALGIDPNAHDIRF 117

Query: 121 VEDNWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQN 180
           VED+WE+PTLGAWGLGWE W DGME++QFTYFQQV G++C P+ GEITYGLERLAMY+Q 
Sbjct: 118 VEDDWENPTLGAWGLGWEVWLDGMEVTQFTYFQQVGGLDCKPVLGEITYGLERLAMYLQG 177

Query: 181 VNSVYDIVFN-AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLK 239
           V +VYD+ +    +G  V YGD++ Q+E E S+YNFE++N + L + F + E E   L+ 
Sbjct: 178 VENVYDLTWAVYPDGSKVTYGDVYHQNEVEQSKYNFEHSNVDFLFSLFNNYESEAKRLMD 237

Query: 240 KGIPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAF 299
            G+            PAY+  +KA+H FN+LDARG IS TER  YI RIR+L++A  +A+
Sbjct: 238 AGL----------ALPAYEMVLKAAHNFNMLDARGAISVTERAAYIGRIRNLSRAVAQAY 287

Query: 300 LMTPNG 305
             +   
Sbjct: 288 FESREA 293


>gi|238897023|ref|YP_002921769.1| glycyl-tRNA synthetase subunit alpha [Klebsiella pneumoniae
           NTUH-K2044]
 gi|238549351|dbj|BAH65702.1| glycyl-tRNA synthetase alpha subunit [Klebsiella pneumoniae subsp.
           pneumoniae NTUH-K2044]
          Length = 303

 Score =  560 bits (1444), Expect = e-157,   Method: Composition-based stats.
 Identities = 186/301 (61%), Positives = 221/301 (73%), Gaps = 8/301 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +ILTL  YWA+QGCTI+QP DMEVGAGT HP T LRALGP     AYVQ
Sbjct: 1   MQKFDTRTFQGLILTLQDYWARQGCTIVQPLDMEVGAGTSHPMTCLRALGPEPMATAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQV+IKP+P N+Q LY+ SLK +G+DP IHD+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVVIKPSPDNIQELYLGSLKELGMDPTIHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLERLAMY+Q V+SV
Sbjct: 121 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGLERLAMYIQGVDSV 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V++        YGD+F Q+E E S YNFEYA+ + L   F   EKE   LL    P 
Sbjct: 181 YDLVWSDGPLGKTTYGDVFHQNEVEQSTYNFEYADVDFLFTCFEQYEKEAQQLLALESP- 239

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY++ +KA+H FNLLDAR  IS TERQRYILRIR+L KA  EA+  +  
Sbjct: 240 -------LPLPAYERILKAAHSFNLLDARKAISVTERQRYILRIRTLTKAVAEAYYASRE 292

Query: 305 G 305
            
Sbjct: 293 A 293


>gi|311277513|ref|YP_003939744.1| glycyl-tRNA synthetase, alpha subunit [Enterobacter cloacae SCF1]
 gi|308746708|gb|ADO46460.1| glycyl-tRNA synthetase, alpha subunit [Enterobacter cloacae SCF1]
          Length = 303

 Score =  560 bits (1444), Expect = e-157,   Method: Composition-based stats.
 Identities = 186/301 (61%), Positives = 221/301 (73%), Gaps = 8/301 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +ILTL  YWA+QGCTI+QP DMEVGAGT HP T LRALGP     AYVQ
Sbjct: 1   MQKFDTRTFQGLILTLQDYWARQGCTIVQPLDMEVGAGTSHPMTCLRALGPEPMATAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQV+IKP+P N+Q LY+ SLK +G+DP IHD+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVVIKPSPDNIQELYLGSLKELGMDPTIHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLERLAMY+Q V+SV
Sbjct: 121 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGLERLAMYIQGVDSV 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V++        YGD+F Q+E E S YNFEYA+ + L   F   EKE   LL    P 
Sbjct: 181 YDLVWSDGPLGKTTYGDVFHQNEVEQSTYNFEYADVDFLFTCFEQYEKEAQQLLALETP- 239

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY++ +KA+H FNLLDAR  IS TERQRYILRIR+L KA  EA+  +  
Sbjct: 240 -------LPLPAYERILKAAHSFNLLDARKAISVTERQRYILRIRTLTKAVAEAYYASRE 292

Query: 305 G 305
            
Sbjct: 293 A 293


>gi|16766941|ref|NP_462556.1| glycyl-tRNA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|62182161|ref|YP_218578.1| glycyl-tRNA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|167990887|ref|ZP_02571986.1| glycyl-tRNA synthetase, alpha subunit [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|168232494|ref|ZP_02657552.1| glycyl-tRNA synthetase, alpha subunit [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|168241825|ref|ZP_02666757.1| glycyl-tRNA synthetase, alpha subunit [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|168260600|ref|ZP_02682573.1| glycyl-tRNA synthetase, alpha subunit [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
 gi|168465045|ref|ZP_02698937.1| glycyl-tRNA synthetase, alpha subunit [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|168818523|ref|ZP_02830523.1| glycyl-tRNA synthetase, alpha subunit [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|194444075|ref|YP_002042902.1| glycyl-tRNA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194449591|ref|YP_002047684.1| glycyl-tRNA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|194472354|ref|ZP_03078338.1| glycyl-tRNA synthetase, alpha subunit [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|197247944|ref|YP_002148584.1| glycyl-tRNA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|197263135|ref|ZP_03163209.1| glycyl-tRNA synthetase, alpha subunit [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|198244424|ref|YP_002217614.1| glycyl-tRNA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|200388662|ref|ZP_03215274.1| glycyl-tRNA synthetase, alpha subunit [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|205354737|ref|YP_002228538.1| glycyl-tRNA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|207858893|ref|YP_002245544.1| glycyl-tRNA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|224585455|ref|YP_002639254.1| glycyl-tRNA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Paratyphi C strain RKS4594]
 gi|237728874|ref|ZP_04559355.1| glycyl-tRNA synthetase subunit alpha [Citrobacter sp. 30_2]
 gi|238910310|ref|ZP_04654147.1| glycyl-tRNA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Tennessee str. CDC07-0191]
 gi|283787795|ref|YP_003367660.1| glycine-tRNA synthetase, alpha subunit [Citrobacter rodentium
           ICC168]
 gi|283835938|ref|ZP_06355679.1| glycyl-tRNA synthetase, alpha subunit [Citrobacter youngae ATCC
           29220]
 gi|25009310|sp|Q8ZL95|SYGA_SALTY RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|75479973|sp|Q57IG5|SYGA_SALCH RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|238689994|sp|B5EX66|SYGA_SALA4 RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|238690225|sp|B4T946|SYGA_SALHS RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|238690328|sp|B5FLD0|SYGA_SALDC RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|238690462|sp|B5R4P3|SYGA_SALEP RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|238690541|sp|B5RGM1|SYGA_SALG2 RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|238693535|sp|B4SWK2|SYGA_SALNS RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|254781829|sp|C0Q1B7|SYGA_SALPC RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|16422220|gb|AAL22515.1| glycine tRNA synthetase, alpha subunit [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|62129794|gb|AAX67497.1| glycine tRNA synthetase, alpha subunit [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|194402738|gb|ACF62960.1| glycyl-tRNA synthetase, alpha subunit [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194407895|gb|ACF68114.1| glycyl-tRNA synthetase, alpha subunit [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|194458718|gb|EDX47557.1| glycyl-tRNA synthetase, alpha subunit [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|195632343|gb|EDX50827.1| glycyl-tRNA synthetase, alpha subunit [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|197211647|gb|ACH49044.1| glycyl-tRNA synthetase, alpha subunit [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|197241390|gb|EDY24010.1| glycyl-tRNA synthetase, alpha subunit [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|197938940|gb|ACH76273.1| glycyl-tRNA synthetase, alpha subunit [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|199605760|gb|EDZ04305.1| glycyl-tRNA synthetase, alpha subunit [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|205274518|emb|CAR39555.1| glycine-tRNA synthetase, alpha subunit [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|205330796|gb|EDZ17560.1| glycyl-tRNA synthetase, alpha subunit [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|205333312|gb|EDZ20076.1| glycyl-tRNA synthetase, alpha subunit [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|205338694|gb|EDZ25458.1| glycyl-tRNA synthetase, alpha subunit [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|205344474|gb|EDZ31238.1| glycyl-tRNA synthetase, alpha subunit [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|205350145|gb|EDZ36776.1| glycyl-tRNA synthetase, alpha subunit [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
 gi|206710696|emb|CAR35057.1| glycine-tRNA synthetase, alpha subunit [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|224469983|gb|ACN47813.1| glycyl-tRNA synthetase alpha subunit [Salmonella enterica subsp.
           enterica serovar Paratyphi C strain RKS4594]
 gi|226909496|gb|EEH95414.1| glycyl-tRNA synthetase subunit alpha [Citrobacter sp. 30_2]
 gi|261248805|emb|CBG26658.1| glycine-tRNA synthetase, alpha subunit [Salmonella enterica subsp.
           enterica serovar Typhimurium str. D23580]
 gi|267995906|gb|ACY90791.1| glycyl-tRNA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 14028S]
 gi|282951249|emb|CBG90943.1| glycine-tRNA synthetase, alpha subunit [Citrobacter rodentium
           ICC168]
 gi|291068115|gb|EFE06224.1| glycyl-tRNA synthetase, alpha subunit [Citrobacter youngae ATCC
           29220]
 gi|301160192|emb|CBW19714.1| glycine-tRNA synthetase, alpha subunit [Salmonella enterica subsp.
           enterica serovar Typhimurium str. SL1344]
 gi|312914682|dbj|BAJ38656.1| glycyl-tRNA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Typhimurium str. T000240]
 gi|320088073|emb|CBY97835.1| glycine tRNA synthetase, alpha subunit [Salmonella enterica subsp.
           enterica serovar Weltevreden str. 2007-60-3289-1]
 gi|321226710|gb|EFX51760.1| Glycyl-tRNA synthetase alpha chain [Salmonella enterica subsp.
           enterica serovar Typhimurium str. TN061786]
 gi|322613959|gb|EFY10895.1| glycyl-tRNA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315996572]
 gi|322620328|gb|EFY17196.1| glycyl-tRNA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-1]
 gi|322625333|gb|EFY22160.1| glycyl-tRNA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-3]
 gi|322630000|gb|EFY26773.1| glycyl-tRNA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-4]
 gi|322634190|gb|EFY30925.1| glycyl-tRNA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-1]
 gi|322635909|gb|EFY32618.1| glycyl-tRNA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-2]
 gi|322643063|gb|EFY39638.1| glycyl-tRNA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Montevideo str. 531954]
 gi|322644606|gb|EFY41142.1| glycyl-tRNA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Montevideo str. NC_MB110209-0054]
 gi|322650848|gb|EFY47240.1| glycyl-tRNA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Montevideo str. OH_2009072675]
 gi|322652988|gb|EFY49323.1| glycyl-tRNA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Montevideo str. CASC_09SCPH15965]
 gi|322659951|gb|EFY56191.1| glycyl-tRNA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Montevideo str. 19N]
 gi|322663284|gb|EFY59488.1| glycyl-tRNA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Montevideo str. 81038-01]
 gi|322668770|gb|EFY64923.1| glycyl-tRNA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Montevideo str. MD_MDA09249507]
 gi|322674427|gb|EFY70520.1| glycyl-tRNA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Montevideo str. 414877]
 gi|322678365|gb|EFY74426.1| glycyl-tRNA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Montevideo str. 366867]
 gi|322680871|gb|EFY76905.1| glycyl-tRNA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Montevideo str. 413180]
 gi|322687193|gb|EFY83166.1| glycyl-tRNA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Montevideo str. 446600]
 gi|322716648|gb|EFZ08219.1| glycyl-tRNA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. A50]
 gi|323132016|gb|ADX19446.1| glycyl-tRNA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 4/74]
 gi|323192152|gb|EFZ77385.1| glycyl-tRNA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609458-1]
 gi|323200656|gb|EFZ85730.1| glycyl-tRNA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556150-1]
 gi|323201366|gb|EFZ86432.1| glycyl-tRNA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609460]
 gi|323206766|gb|EFZ91720.1| glycyl-tRNA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Montevideo str. 507440-20]
 gi|323211804|gb|EFZ96636.1| glycyl-tRNA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556152]
 gi|323216163|gb|EGA00891.1| glycyl-tRNA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB101509-0077]
 gi|323220386|gb|EGA04840.1| glycyl-tRNA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB102109-0047]
 gi|323226243|gb|EGA10458.1| glycyl-tRNA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB110209-0055]
 gi|323228363|gb|EGA12494.1| glycyl-tRNA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB111609-0052]
 gi|323234184|gb|EGA18272.1| glycyl-tRNA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009083312]
 gi|323237169|gb|EGA21236.1| glycyl-tRNA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009085258]
 gi|323244688|gb|EGA28692.1| glycyl-tRNA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315731156]
 gi|323249169|gb|EGA33087.1| glycyl-tRNA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2009159199]
 gi|323250712|gb|EGA34592.1| glycyl-tRNA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008282]
 gi|323257587|gb|EGA41274.1| glycyl-tRNA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008283]
 gi|323262296|gb|EGA45857.1| glycyl-tRNA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008284]
 gi|323266149|gb|EGA49640.1| glycyl-tRNA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008285]
 gi|323268784|gb|EGA52242.1| glycyl-tRNA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008287]
 gi|326625399|gb|EGE31744.1| glycyl-tRNA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Dublin str. 3246]
 gi|326629877|gb|EGE36220.1| glycyl-tRNA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 9]
 gi|332990506|gb|AEF09489.1| glycyl-tRNA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Typhimurium str. UK-1]
          Length = 303

 Score =  560 bits (1444), Expect = e-157,   Method: Composition-based stats.
 Identities = 186/301 (61%), Positives = 221/301 (73%), Gaps = 8/301 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +ILTL  YWA+QGCTI+QP DMEVGAGT HP T LRALGP     AYVQ
Sbjct: 1   MQKFDTRTFQGLILTLQDYWARQGCTIVQPLDMEVGAGTSHPMTCLRALGPEPMATAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQV+IKP+P N+Q LY+ SLK +G+DP IHD+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVVIKPSPDNIQELYLGSLKELGMDPTIHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLERLAMY+Q V+SV
Sbjct: 121 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGLERLAMYIQGVDSV 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V++        YGD+F Q+E E S YNFEYA+ + L   F   EKE   LL    P 
Sbjct: 181 YDLVWSDGPLGKTTYGDVFHQNEVEQSTYNFEYADVDFLFTCFEQYEKEAQQLLALENP- 239

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY++ +KA+H FNLLDAR  IS TERQRYILRIR+L KA  EA+  +  
Sbjct: 240 -------LPLPAYERILKAAHSFNLLDARKAISVTERQRYILRIRTLTKAVAEAYYASRE 292

Query: 305 G 305
            
Sbjct: 293 A 293


>gi|312958113|ref|ZP_07772636.1| glycyl-tRNA synthetase alpha subunit [Pseudomonas fluorescens WH6]
 gi|311287544|gb|EFQ66102.1| glycyl-tRNA synthetase alpha subunit [Pseudomonas fluorescens WH6]
          Length = 317

 Score =  560 bits (1443), Expect = e-157,   Method: Composition-based stats.
 Identities = 183/293 (62%), Positives = 223/293 (76%), Gaps = 8/293 (2%)

Query: 12  SFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPLD 71
           +FQ++IL L QYWA+QGC +LQPYDMEVGAGTFH +T LRA+GP +W AAYVQPSRRP D
Sbjct: 10  TFQDLILALQQYWAEQGCVVLQPYDMEVGAGTFHTATFLRAIGPETWNAAYVQPSRRPTD 69

Query: 72  GRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTLG 131
           GRY ENPNRLQHYYQFQV++KPNP N Q LY+ SLK VG+DPL+HD+RFVEDNWESPTLG
Sbjct: 70  GRYGENPNRLQHYYQFQVVLKPNPDNFQELYLGSLKHVGLDPLVHDIRFVEDNWESPTLG 129

Query: 132 AWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFNA 191
           AWGLGWE W +GME++QFTYFQQ  GIEC P++GEITYGLERLAMY+Q V+SVYD+V+  
Sbjct: 130 AWGLGWEVWLNGMEVTQFTYFQQAGGIECYPVTGEITYGLERLAMYLQGVDSVYDLVWAD 189

Query: 192 IEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHHL 251
                V YGD+F Q+E E S YNFE+AN + L   F   E E   L++   P        
Sbjct: 190 GPFGKVTYGDVFHQNEVEQSTYNFEHANVDKLFELFDFYESEAKRLIELDQP-------- 241

Query: 252 CVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
              P+Y+  +KASH FNLLDAR  IS T RQ+YILR+R+LA++  +A+L+   
Sbjct: 242 LPLPSYEMVLKASHTFNLLDARRAISVTARQQYILRVRTLARSVAQAYLLARA 294


>gi|192289647|ref|YP_001990252.1| glycyl-tRNA synthetase subunit alpha [Rhodopseudomonas palustris
           TIE-1]
 gi|192283396|gb|ACE99776.1| glycyl-tRNA synthetase, alpha subunit [Rhodopseudomonas palustris
           TIE-1]
          Length = 314

 Score =  560 bits (1443), Expect = e-157,   Method: Composition-based stats.
 Identities = 200/306 (65%), Positives = 241/306 (78%), Gaps = 5/306 (1%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
            + + + SFQ +ILTL ++WA  GC ILQPYDMEVGAGTFHP+TTLRALGP  W AAYVQ
Sbjct: 6   PHMRPERSFQGLILTLQRFWADYGCVILQPYDMEVGAGTFHPATTLRALGPKRWNAAYVQ 65

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQVI+KP+P ++Q+LY++SL A+G+D  +HDVRFVED+
Sbjct: 66  PSRRPKDGRYGENPNRLQHYYQFQVILKPSPPDIQDLYLKSLAAIGVDTALHDVRFVEDD 125

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WESPTLGAWGLGWECWCDGME+SQFTYFQQV G+EC+P++GE+TYGLERLAMYVQ ++ V
Sbjct: 126 WESPTLGAWGLGWECWCDGMEVSQFTYFQQVAGVECAPVAGELTYGLERLAMYVQGIDRV 185

Query: 185 YDIVFNAIEG-QNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGI- 242
           YD+ FN  +G   V YGD+F Q+E+EYS++NFE A+ ++L   F  +E  C   L  G  
Sbjct: 186 YDLNFNGRDGDDKVTYGDVFLQAEKEYSKHNFEVADTDMLFEQFKMAEAACKKYLDAGWV 245

Query: 243 ---PNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAF 299
                     H    PAYDQCIKASH+FNLLDARGVIS TERQ YILR+R LAKACGEA+
Sbjct: 246 MSADGAKREAHAMALPAYDQCIKASHVFNLLDARGVISVTERQSYILRVRELAKACGEAW 305

Query: 300 LMTPNG 305
           + T  G
Sbjct: 306 VHTEAG 311


>gi|213163578|ref|ZP_03349288.1| glycyl-tRNA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Typhi str. E00-7866]
          Length = 362

 Score =  560 bits (1443), Expect = e-157,   Method: Composition-based stats.
 Identities = 185/301 (61%), Positives = 220/301 (73%), Gaps = 8/301 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +ILTL  YWA+QGCTI+QP DMEVGAGT HP T LRALGP     AYVQ
Sbjct: 1   MQKFDTRTFQGLILTLQDYWARQGCTIVQPLDMEVGAGTSHPMTCLRALGPEPMATAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQV+IKP+P N+Q LY+ SLK +G+DP IHD+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVVIKPSPENIQELYLGSLKELGMDPTIHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC  ++GEITYGLERLAMY+Q V+SV
Sbjct: 121 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKLVTGEITYGLERLAMYIQGVDSV 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V++        YGD+F Q+E E S YNFEYA+ + L   F   EKE   LL    P 
Sbjct: 181 YDLVWSDGPLGKTTYGDVFHQNEVEQSTYNFEYADVDFLFTCFEQYEKEAQQLLALENP- 239

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY++ +KA+H FNLLDAR  IS TERQRYILRIR+L KA  EA+  +  
Sbjct: 240 -------LPLPAYERILKAAHSFNLLDARKAISVTERQRYILRIRTLTKAVAEAYYASRE 292

Query: 305 G 305
            
Sbjct: 293 A 293


>gi|78484699|ref|YP_390624.1| glycyl-tRNA synthetase subunit alpha [Thiomicrospira crunogena
           XCL-2]
 gi|78362985|gb|ABB40950.1| glycyl-tRNA synthetase, alpha subunit [Thiomicrospira crunogena
           XCL-2]
          Length = 308

 Score =  560 bits (1443), Expect = e-157,   Method: Composition-based stats.
 Identities = 177/294 (60%), Positives = 220/294 (74%), Gaps = 10/294 (3%)

Query: 12  SFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPLD 71
           +FQ +I TL  +WA+QGC I+QPYD E+GAGTFHPST LR++GP  W+AAYVQP RRP D
Sbjct: 11  TFQGLIQTLQAFWAEQGCVIMQPYDNEMGAGTFHPSTFLRSIGPEPWRAAYVQPCRRPTD 70

Query: 72  GRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTLG 131
           GRY ENPNRLQHYYQFQV++KP+P N+Q LY+ESLK +GIDPL HD+RFVEDNWESPTLG
Sbjct: 71  GRYGENPNRLQHYYQFQVMLKPSPDNIQELYLESLKKLGIDPLEHDIRFVEDNWESPTLG 130

Query: 132 AWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFNA 191
           AWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLER+AMY+Q VNSVYD+ +  
Sbjct: 131 AWGLGWEVWMNGMEVTQFTYFQQVGGLECRPVTGEITYGLERIAMYLQGVNSVYDLTWVN 190

Query: 192 IEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHHL 251
                V YGD+F Q+E E S YNFE A+ +IL   F + E+    L++  +P        
Sbjct: 191 GPEGKVTYGDVFHQNEVEMSTYNFEKADTDILFRTFDECEQIFTKLVEDKLP-------- 242

Query: 252 CVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNG 305
              PAY+Q +KASH FNLLDAR  IS TER R+I R+R++AK   E++      
Sbjct: 243 --LPAYEQVLKASHAFNLLDARHAISVTERARFIGRVRNMAKQIAESYYEGREA 294


>gi|70733527|ref|YP_257166.1| glycyl-tRNA synthetase subunit alpha [Pseudomonas fluorescens Pf-5]
 gi|330806670|ref|YP_004351132.1| glycine--tRNA ligase, alpha subunit (glycyl-tRNA synthetase)
           [Pseudomonas brassicacearum subsp. brassicacearum
           NFM421]
 gi|123658970|sp|Q4KKR7|SYGA_PSEF5 RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|68347826|gb|AAY95432.1| glycyl-tRNA synthetase, alpha subunit [Pseudomonas fluorescens
           Pf-5]
 gi|327374778|gb|AEA66128.1| Glycine--tRNA ligase, alpha subunit (Glycyl-tRNA synthetase)
           [Pseudomonas brassicacearum subsp. brassicacearum
           NFM421]
          Length = 317

 Score =  560 bits (1443), Expect = e-157,   Method: Composition-based stats.
 Identities = 184/293 (62%), Positives = 223/293 (76%), Gaps = 8/293 (2%)

Query: 12  SFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPLD 71
           +FQ++IL L QYWA+QGC +LQPYDMEVGAGTFH +T LRA+GP +W AAYVQPSRRP D
Sbjct: 10  TFQDLILALQQYWAEQGCVVLQPYDMEVGAGTFHTATFLRAIGPETWNAAYVQPSRRPTD 69

Query: 72  GRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTLG 131
           GRY ENPNRLQHYYQFQV++KPNP N Q LY+ SLK VG+DPL+HD+RFVEDNWESPTLG
Sbjct: 70  GRYGENPNRLQHYYQFQVVLKPNPENFQELYLGSLKHVGLDPLVHDIRFVEDNWESPTLG 129

Query: 132 AWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFNA 191
           AWGLGWE W +GME++QFTYFQQ  GIEC P++GEITYGLERLAMY+Q V+SVYD+V+  
Sbjct: 130 AWGLGWEVWLNGMEVTQFTYFQQAGGIECYPVTGEITYGLERLAMYLQGVDSVYDLVWAD 189

Query: 192 IEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHHL 251
                V YGD+F Q+E E S YNFE+AN E L   F   E E   L++   P        
Sbjct: 190 GPFGKVTYGDVFHQNEVEQSTYNFEHANVEKLFELFDFYESEAKRLIELDQP-------- 241

Query: 252 CVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
              P+Y+  +KASH FNLLDAR  IS T RQ+YILR+R+LA++  +A+L+   
Sbjct: 242 LPLPSYEMVLKASHTFNLLDARRAISVTARQQYILRVRTLARSVAQAYLLARA 294


>gi|126461279|ref|YP_001042393.1| glycyl-tRNA synthetase subunit alpha [Rhodobacter sphaeroides ATCC
           17029]
 gi|126102943|gb|ABN75621.1| Glycine--tRNA ligase [Rhodobacter sphaeroides ATCC 17029]
          Length = 307

 Score =  560 bits (1443), Expect = e-157,   Method: Composition-based stats.
 Identities = 193/297 (64%), Positives = 233/297 (78%), Gaps = 1/297 (0%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
             SFQ IIL L  YW  +GC +LQPYDMEVGAGTFHP+TTLR+LG   W AAYVQPSRRP
Sbjct: 8   PRSFQEIILRLMTYWGAKGCAVLQPYDMEVGAGTFHPATTLRSLGARPWAAAYVQPSRRP 67

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNRLQHYYQ+QV+IKP+P +LQ LY+ SL+A+GID  +HD+RFVED+WESPT
Sbjct: 68  TDGRYGENPNRLQHYYQYQVLIKPSPPDLQKLYLGSLEAIGIDMDLHDIRFVEDDWESPT 127

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE WCDGME+SQFTYFQQV G +C P+SGE+TYGLERLAMYV  ++ V D+ F
Sbjct: 128 LGAWGLGWEVWCDGMEVSQFTYFQQVGGHDCRPVSGELTYGLERLAMYVLGIDHVMDMPF 187

Query: 190 NAIEGQN-VLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHR 248
           N  +G   + YGD+F Q+EQEYSR+NF+ A+ ++L  HF D+E EC  +L     ++  R
Sbjct: 188 NDPDGPTPLTYGDVFRQTEQEYSRWNFDQADTDMLLQHFRDAEAECERILAAPETDKAGR 247

Query: 249 HHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNG 305
             +   PAYDQCIKASH+FNLLDARGVIS TERQ YI R+R+LAK C +AF+ T  G
Sbjct: 248 RIVMAHPAYDQCIKASHLFNLLDARGVISVTERQAYIGRVRALAKKCADAFVTTEAG 304


>gi|221135261|ref|ZP_03561564.1| glycyl-tRNA synthetase subunit alpha [Glaciecola sp. HTCC2999]
          Length = 302

 Score =  560 bits (1443), Expect = e-157,   Method: Composition-based stats.
 Identities = 181/301 (60%), Positives = 225/301 (74%), Gaps = 10/301 (3%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
            +  +  +FQ +I +L  YWA+QGC I+QP DMEVGAGTFHP T LR+LGP    +AYVQ
Sbjct: 1   MSNYDVKTFQGLIQSLQDYWAKQGCVIIQPLDMEVGAGTFHPMTFLRSLGPEPISSAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           P RRP DGRY +NPNRLQHYYQFQV++KP+P N+Q LY+ SLK +G DPL+HD+RFVEDN
Sbjct: 61  PCRRPTDGRYGDNPNRLQHYYQFQVMLKPSPKNIQELYLGSLKELGFDPLVHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WESPTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLERLAMYVQ V+S+
Sbjct: 121 WESPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGLERLAMYVQGVDSI 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V+       V YGD+F Q+E E S YNFE+A+ + L   F  SEK+ L L+++ +P 
Sbjct: 181 YDLVWTHGPNGPVTYGDVFHQNEVEQSAYNFEHADVDALFAAFDQSEKDALHLIEQNLP- 239

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY+Q +KASH FNLLDAR  IS TERQRYILR+R+LAKA  E++     
Sbjct: 240 ---------LPAYEQVMKASHSFNLLDARHAISVTERQRYILRVRTLAKAVAESYFAARE 290

Query: 305 G 305
            
Sbjct: 291 A 291


>gi|83942789|ref|ZP_00955250.1| glycyl-tRNA synthetase alpha subunit [Sulfitobacter sp. EE-36]
 gi|83955612|ref|ZP_00964192.1| glycyl-tRNA synthetase alpha subunit [Sulfitobacter sp. NAS-14.1]
 gi|83839906|gb|EAP79082.1| glycyl-tRNA synthetase alpha subunit [Sulfitobacter sp. NAS-14.1]
 gi|83846882|gb|EAP84758.1| glycyl-tRNA synthetase alpha subunit [Sulfitobacter sp. EE-36]
          Length = 312

 Score =  560 bits (1443), Expect = e-157,   Method: Composition-based stats.
 Identities = 197/301 (65%), Positives = 240/301 (79%), Gaps = 2/301 (0%)

Query: 8   KNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSR 67
           +   SFQ IIL L  YWA+QGC +LQPYDMEVGAGTFHP+TTLRALG   W AAYVQPSR
Sbjct: 6   QRPRSFQEIILALQSYWARQGCAVLQPYDMEVGAGTFHPATTLRALGTNPWAAAYVQPSR 65

Query: 68  RPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWES 127
           RP DGRY ENPNRLQHYYQFQ +IKP+P NLQ LY+ SL+A+GID  +HD+RFVED+WES
Sbjct: 66  RPTDGRYGENPNRLQHYYQFQALIKPSPPNLQELYLGSLEAIGIDMALHDIRFVEDDWES 125

Query: 128 PTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDI 187
           PTLGAWGLGWE WCDGME+SQFTYFQQV G +C P+SGE+TYGLERLAMYV  V+ V D+
Sbjct: 126 PTLGAWGLGWEVWCDGMEVSQFTYFQQVGGHDCHPVSGELTYGLERLAMYVLGVDHVMDM 185

Query: 188 VFNAIEGQ-NVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKG-IPNE 245
            FN+ +    + YGD+F Q+E+EY+R+NF+ AN ++L +HF+++E EC  +L +  +  +
Sbjct: 186 PFNSPDAPIPLTYGDVFKQTEEEYARWNFDVANTDVLLDHFVEAENECKAILAQDAVDPK 245

Query: 246 HHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNG 305
             +  +   PAYDQCIKASHIFNLLDARGVIS TERQ YI R+R+LAKAC +AF+ T  G
Sbjct: 246 TGKRIVMAHPAYDQCIKASHIFNLLDARGVISVTERQAYIGRVRTLAKACADAFVQTRAG 305

Query: 306 G 306
           G
Sbjct: 306 G 306


>gi|56415549|ref|YP_152624.1| glycyl-tRNA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|168235258|ref|ZP_02660316.1| glycyl-tRNA synthetase, alpha subunit [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|194737193|ref|YP_002116588.1| glycyl-tRNA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|197364477|ref|YP_002144114.1| glycyl-tRNA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
 gi|204928722|ref|ZP_03219921.1| glycyl-tRNA synthetase, alpha subunit [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
 gi|81599767|sp|Q5PLN1|SYGA_SALPA RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|238689773|sp|B4TZ50|SYGA_SALSV RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|238690751|sp|B5BHU2|SYGA_SALPK RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|56129806|gb|AAV79312.1| glycine-tRNA synthetase, alpha subunit [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|194712695|gb|ACF91916.1| glycyl-tRNA synthetase, alpha subunit [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|197095954|emb|CAR61537.1| glycine-tRNA synthetase, alpha subunit [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
 gi|197291601|gb|EDY30953.1| glycyl-tRNA synthetase, alpha subunit [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|204322155|gb|EDZ07353.1| glycyl-tRNA synthetase, alpha subunit [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
          Length = 303

 Score =  560 bits (1443), Expect = e-157,   Method: Composition-based stats.
 Identities = 186/301 (61%), Positives = 221/301 (73%), Gaps = 8/301 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +ILTL  YWA+QGCTI+QP DMEVGAGT HP T LRALGP     AYVQ
Sbjct: 1   MQKFDTRTFQGLILTLQDYWARQGCTIVQPLDMEVGAGTSHPMTCLRALGPEPMATAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQV+IKP+P N+Q LY+ SLK +G+DP IHD+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVVIKPSPENIQELYLGSLKELGMDPTIHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLERLAMY+Q V+SV
Sbjct: 121 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGLERLAMYIQGVDSV 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V++        YGD+F Q+E E S YNFEYA+ + L   F   EKE   LL    P 
Sbjct: 181 YDLVWSDGPLGKTTYGDVFHQNEVEQSTYNFEYADVDFLFTCFEQYEKEAQQLLALENP- 239

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY++ +KA+H FNLLDAR  IS TERQRYILRIR+L KA  EA+  +  
Sbjct: 240 -------LPLPAYERILKAAHSFNLLDARKAISVTERQRYILRIRTLTKAVAEAYYASRE 292

Query: 305 G 305
            
Sbjct: 293 A 293


>gi|331006048|ref|ZP_08329386.1| Glycyl-tRNA synthetase alpha chain [gamma proteobacterium IMCC1989]
 gi|330420134|gb|EGG94462.1| Glycyl-tRNA synthetase alpha chain [gamma proteobacterium IMCC1989]
          Length = 320

 Score =  559 bits (1442), Expect = e-157,   Method: Composition-based stats.
 Identities = 178/302 (58%), Positives = 231/302 (76%), Gaps = 11/302 (3%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
            +  +  +FQ +IL L ++WA+QGC ILQP DMEVGAGTFHP+T LRA+GP +W +AYVQ
Sbjct: 1   MSTPDVKTFQGLILALQEFWAEQGCVILQPLDMEVGAGTFHPATFLRAIGPETWSSAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           P RRP DGRY ENPNRLQHYYQFQV++KP+P N+Q+LY+ SL+ +GID  +HD+RFVEDN
Sbjct: 61  PCRRPTDGRYGENPNRLQHYYQFQVVLKPSPANIQDLYLASLRRIGIDTAVHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WESPTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLER+AMY+Q V+S+
Sbjct: 121 WESPTLGAWGLGWELWLNGMEVTQFTYFQQVGGLECFPVTGEITYGLERIAMYLQGVDSI 180

Query: 185 YDIVF-NAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIP 243
           YD+V+    EG++V YGD+F Q+E E S YNFE+A+ E L   F   E++   L+++ +P
Sbjct: 181 YDLVWTTNAEGKSVTYGDVFHQNEVEMSTYNFEHADVEFLFQSFDAYERDSQRLIEQKLP 240

Query: 244 NEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTP 303
                      PAY+  +KASH+FNLLDAR  IS TERQR+ILR+RSLA+A  +A+    
Sbjct: 241 ----------LPAYEMVMKASHVFNLLDARHAISVTERQRFILRVRSLARAVAQAYYDAR 290

Query: 304 NG 305
             
Sbjct: 291 KA 292


>gi|296100578|ref|YP_003610724.1| glycyl-tRNA synthetase subunit alpha [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
 gi|295055037|gb|ADF59775.1| glycyl-tRNA synthetase subunit alpha [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
 gi|295098693|emb|CBK87783.1| glycyl-tRNA synthetase alpha chain [Enterobacter cloacae subsp.
           cloacae NCTC 9394]
          Length = 303

 Score =  559 bits (1442), Expect = e-157,   Method: Composition-based stats.
 Identities = 187/301 (62%), Positives = 222/301 (73%), Gaps = 8/301 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +ILTL  YWA+QGCTI+QP DMEVGAGT HP T+LRALGP     AYVQ
Sbjct: 1   MQKFDTKTFQGLILTLQDYWARQGCTIVQPLDMEVGAGTSHPMTSLRALGPEPMATAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQV+IKP+P N+Q LY+ SLK +G+DP IHD+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVVIKPSPDNIQELYLGSLKELGMDPTIHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC PI+GEITYGLERLAMY+Q V+SV
Sbjct: 121 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPITGEITYGLERLAMYIQGVDSV 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V++        YGD+F Q+E E S YNFEYA+ + L   F   EKE   LL    P 
Sbjct: 181 YDLVWSDGPLGKTTYGDVFHQNEVEQSTYNFEYADVDFLFTCFEQYEKEAQQLLALETP- 239

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY++ +KA+H FNLLDAR  IS TERQRYILRIR+L KA  EA+  +  
Sbjct: 240 -------LPLPAYERILKAAHSFNLLDARKAISVTERQRYILRIRTLTKAVAEAYYASRE 292

Query: 305 G 305
            
Sbjct: 293 A 293


>gi|161505805|ref|YP_001572917.1| glycyl-tRNA synthetase subunit alpha [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|189082260|sp|A9MLF6|SYGA_SALAR RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|160867152|gb|ABX23775.1| hypothetical protein SARI_03981 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 303

 Score =  559 bits (1442), Expect = e-157,   Method: Composition-based stats.
 Identities = 186/301 (61%), Positives = 221/301 (73%), Gaps = 8/301 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +ILTL  YWA+QGCTI+QP DMEVGAGT HP T LRALGP     AYVQ
Sbjct: 1   MQKFDTRTFQGLILTLQDYWARQGCTIVQPLDMEVGAGTSHPMTCLRALGPEPMATAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQV+IKP+P N+Q LY+ SLK +G+DP IHD+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVVIKPSPENIQELYLGSLKELGMDPTIHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLERLAMY+Q V+SV
Sbjct: 121 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGLERLAMYIQGVDSV 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V++        YGD+F Q+E E S YNFEYA+ + L   F   EKE   LL    P 
Sbjct: 181 YDLVWSDGPLGKTTYGDVFHQNEVEQSTYNFEYADVDFLFTCFEQYEKEAQQLLALENP- 239

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY++ +KA+H FNLLDAR  IS TERQRYILRIR+L KA  EA+  +  
Sbjct: 240 -------LPLPAYERILKAAHSFNLLDARKAISVTERQRYILRIRTLTKAVAEAYYASRE 292

Query: 305 G 305
            
Sbjct: 293 A 293


>gi|146276694|ref|YP_001166853.1| glycyl-tRNA synthetase subunit alpha [Rhodobacter sphaeroides ATCC
           17025]
 gi|145554935|gb|ABP69548.1| Glycine--tRNA ligase [Rhodobacter sphaeroides ATCC 17025]
          Length = 307

 Score =  559 bits (1442), Expect = e-157,   Method: Composition-based stats.
 Identities = 193/297 (64%), Positives = 232/297 (78%), Gaps = 1/297 (0%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
             SFQ IIL L  YW  +GC +LQPYDMEVGAGTFHP+TTLR+LG   W AAYVQPSRRP
Sbjct: 8   PRSFQEIILRLMTYWGGKGCAVLQPYDMEVGAGTFHPATTLRSLGARPWAAAYVQPSRRP 67

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNRLQHYYQ+QV+IKP+P +LQ LY+ SL+A+GID  +HD+RFVED+WESPT
Sbjct: 68  TDGRYGENPNRLQHYYQYQVLIKPSPPDLQQLYLGSLQAIGIDMELHDIRFVEDDWESPT 127

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE WCDGME+SQFTYFQQV G +C P+SGE+TYGLERLAMYV  V+ V D+ +
Sbjct: 128 LGAWGLGWEVWCDGMEVSQFTYFQQVGGHDCKPVSGELTYGLERLAMYVLGVDHVMDMPY 187

Query: 190 NAIEGQN-VLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHR 248
           N  +    + YGD+F Q+EQEYSR+NF+ A+ E+L  HF D+E EC  +L     ++  R
Sbjct: 188 NDPDSPTPLKYGDVFRQTEQEYSRWNFDQADTEMLLQHFKDAEAECERILSAPETDKAGR 247

Query: 249 HHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNG 305
             +   PAYDQCIKASH+FNLLDARGVIS TERQ YI R+R+LAK C +AF+ T  G
Sbjct: 248 RIVMAHPAYDQCIKASHLFNLLDARGVISVTERQAYIGRVRALAKKCADAFVTTEAG 304


>gi|158422653|ref|YP_001523945.1| glycyl-tRNA synthetase subunit alpha [Azorhizobium caulinodans ORS
           571]
 gi|158329542|dbj|BAF87027.1| glycyl-tRNA synthetase alpha subunit [Azorhizobium caulinodans ORS
           571]
          Length = 310

 Score =  559 bits (1442), Expect = e-157,   Method: Composition-based stats.
 Identities = 209/303 (68%), Positives = 242/303 (79%), Gaps = 4/303 (1%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
            + + D SFQ ++LTL  +WA QGC +LQPYDMEVGAGTFHP+TTLRALGP  WKAAYVQ
Sbjct: 8   PHMRPDRSFQGLLLTLQTFWANQGCVVLQPYDMEVGAGTFHPATTLRALGPKHWKAAYVQ 67

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQVI+KP+P NLQ LY++SL A+GID  +HDVRFVED+
Sbjct: 68  PSRRPKDGRYGENPNRLQHYYQFQVILKPSPANLQELYLQSLDAIGIDTRLHDVRFVEDD 127

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WESPTLGAWGLGWECWCDGME+SQFTYFQQV G EC+P+SGE+TYGLERLAMYVQ V +V
Sbjct: 128 WESPTLGAWGLGWECWCDGMEVSQFTYFQQVAGFECAPVSGELTYGLERLAMYVQGVENV 187

Query: 185 YDIVFNAIEG-QNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIP 243
           YD+ FN  EG +   YGD+F Q+E+EYSR+NFEYA+ ++L   F  +E  C   L     
Sbjct: 188 YDLNFNGREGAEKTTYGDVFLQAEKEYSRHNFEYADTDMLFEQFRMAEAACAKYLAA--- 244

Query: 244 NEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTP 303
            +    HL   PAYDQCIKASH+FNLLDARGVIS TERQ YILR+R LAKACG A+L T 
Sbjct: 245 GDAGEKHLMAQPAYDQCIKASHVFNLLDARGVISVTERQSYILRVRELAKACGAAWLKTE 304

Query: 304 NGG 306
            GG
Sbjct: 305 AGG 307


>gi|117618098|ref|YP_854663.1| glycyl-tRNA synthetase subunit alpha [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
 gi|330831644|ref|YP_004394596.1| glycyl-tRNA synthetase subunit alpha [Aeromonas veronii B565]
 gi|166200187|sp|A0KEK0|SYGA_AERHH RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|117559505|gb|ABK36453.1| glycyl-tRNA synthetase, alpha subunit [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
 gi|328806780|gb|AEB51979.1| Glycyl-tRNA synthetase alpha subunit [Aeromonas veronii B565]
          Length = 307

 Score =  559 bits (1442), Expect = e-157,   Method: Composition-based stats.
 Identities = 185/301 (61%), Positives = 222/301 (73%), Gaps = 8/301 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +IL L  YW++QGCTI+QP DMEVGAGT HP T LRALGP     AYVQ
Sbjct: 1   MQKFDVKTFQGLILQLQDYWSRQGCTIIQPLDMEVGAGTSHPMTCLRALGPEPIACAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQVIIKP+P N+Q LY+ SLK +G+DP IHD+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVIIKPSPDNIQELYLGSLKELGMDPEIHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLERLAMY+Q V+SV
Sbjct: 121 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGLERLAMYIQGVDSV 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V++        YGD+F Q+E E S YNFE+A+ E L + F   EKE  +LL    P 
Sbjct: 181 YDLVWSDGPLGKTTYGDVFHQNEVEQSTYNFEHADVEFLFHCFEQYEKEAQNLLALEKP- 239

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY++ +KA+H FNLLDAR  IS TERQRYILRIR+L KA  EA+  +  
Sbjct: 240 -------LPLPAYERILKAAHSFNLLDARKAISVTERQRYILRIRTLTKAVAEAYYASRE 292

Query: 305 G 305
            
Sbjct: 293 A 293


>gi|212632931|ref|YP_002309456.1| glycyl-tRNA synthetase subunit alpha [Shewanella piezotolerans WP3]
 gi|226737043|sp|B8CH77|SYGA_SHEPW RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|212554415|gb|ACJ26869.1| Glycyl-tRNA synthetase, alpha subunit [Shewanella piezotolerans
           WP3]
          Length = 301

 Score =  559 bits (1442), Expect = e-157,   Method: Composition-based stats.
 Identities = 187/302 (61%), Positives = 223/302 (73%), Gaps = 8/302 (2%)

Query: 4   IHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYV 63
           +  K +  +FQ  I+TL +YWAQQGC I+QP DMEVGAGTFHP T LRALGP     AYV
Sbjct: 1   MTTKHDVKTFQGFIMTLQEYWAQQGCAIVQPLDMEVGAGTFHPMTFLRALGPEPMSCAYV 60

Query: 64  QPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVED 123
           QPSRRP DGRY +NPNRLQH+YQ+QV++KP+P N+Q LY+ SL+A GID  IHDVRFVED
Sbjct: 61  QPSRRPTDGRYGDNPNRLQHFYQYQVVLKPSPDNIQELYLGSLEAAGIDMNIHDVRFVED 120

Query: 124 NWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNS 183
           NWESPTLGAWGLGWE W +GME+SQFTYFQQV G+EC P++GEITYGLERLAMY+Q V++
Sbjct: 121 NWESPTLGAWGLGWEVWLNGMEVSQFTYFQQVGGLECKPVTGEITYGLERLAMYIQEVDN 180

Query: 184 VYDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIP 243
           VYD+V+       V+YGDIF Q+E E S YNFE+AN E+L   F D E  C  LL    P
Sbjct: 181 VYDLVWTDGPMGKVMYGDIFHQNEVEQSAYNFEHANVEVLFRAFDDCEVACQHLLSLEKP 240

Query: 244 NEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTP 303
                      PAY+Q +KASH FNLLDAR  IS TERQRYILR+R++AK   EA+  + 
Sbjct: 241 --------LALPAYEQVMKASHAFNLLDARHAISVTERQRYILRVRTMAKGVAEAYYQSR 292

Query: 304 NG 305
             
Sbjct: 293 EA 294


>gi|261341814|ref|ZP_05969672.1| hypothetical protein ENTCAN_08298 [Enterobacter cancerogenus ATCC
           35316]
 gi|288316187|gb|EFC55125.1| glycyl-tRNA synthetase, alpha subunit [Enterobacter cancerogenus
           ATCC 35316]
          Length = 303

 Score =  559 bits (1441), Expect = e-157,   Method: Composition-based stats.
 Identities = 187/301 (62%), Positives = 222/301 (73%), Gaps = 8/301 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +ILTL  YWA+QGCTI+QP DMEVGAGT HP T+LRALGP     AYVQ
Sbjct: 1   MQKFDTKTFQGLILTLQDYWARQGCTIVQPLDMEVGAGTSHPMTSLRALGPEPMATAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQV+IKP+P N+Q LY+ SLK +G+DP IHD+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVVIKPSPENIQELYLGSLKELGMDPTIHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC PI+GEITYGLERLAMY+Q V+SV
Sbjct: 121 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPITGEITYGLERLAMYIQGVDSV 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V++        YGD+F Q+E E S YNFEYA+ + L   F   EKE   LL    P 
Sbjct: 181 YDLVWSDGPLGKTTYGDVFHQNEVEQSTYNFEYADVDFLFTCFEQYEKEAQQLLALETP- 239

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY++ +KA+H FNLLDAR  IS TERQRYILRIR+L KA  EA+  +  
Sbjct: 240 -------LPLPAYERILKAAHSFNLLDARKAISVTERQRYILRIRTLTKAVAEAYYASRE 292

Query: 305 G 305
            
Sbjct: 293 A 293


>gi|77918212|ref|YP_356027.1| glycyl-tRNA synthetase subunit alpha [Pelobacter carbinolicus DSM
           2380]
 gi|123575242|sp|Q3A8N6|SYGA_PELCD RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|77544295|gb|ABA87857.1| glycyl-tRNA synthetase alpha chain [Pelobacter carbinolicus DSM
           2380]
          Length = 290

 Score =  559 bits (1441), Expect = e-157,   Method: Composition-based stats.
 Identities = 176/294 (59%), Positives = 211/294 (71%), Gaps = 14/294 (4%)

Query: 11  LSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPL 70
           ++FQ +IL L  YWA+QGC I QPYDME GAGTF+P+T LR LGP  W  AYV+PSRRP 
Sbjct: 1   MNFQELILALQNYWAKQGCIIQQPYDMEKGAGTFNPATFLRVLGPEPWNVAYVEPSRRPT 60

Query: 71  DGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTL 130
           DGRY ENPNRLQHYYQFQV++KP+P N+Q LY++SLK+ GI P  HD+RFVED+WESPTL
Sbjct: 61  DGRYGENPNRLQHYYQFQVVMKPSPTNIQELYLDSLKSFGISPSRHDIRFVEDDWESPTL 120

Query: 131 GAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFN 190
           GAWGLGWE W DGMEI+QFTYFQQV GI+  P+S EITYG ER+AMY+Q V++VYD+ + 
Sbjct: 121 GAWGLGWEVWLDGMEITQFTYFQQVGGIDLKPVSAEITYGCERIAMYLQGVDNVYDLEW- 179

Query: 191 AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHH 250
                 + YGD+  QSE EYS YNFE A+  +L N F   EKEC  L             
Sbjct: 180 ---IDGIKYGDVHHQSEVEYSTYNFEEADAGMLFNLFDMYEKECSRL----------AKS 226

Query: 251 LCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
             V PAYD  +KASH FNLLDARG IS TER  YI R+R+LA+ C E ++    
Sbjct: 227 QLVLPAYDYVLKASHAFNLLDARGAISVTERAHYIGRVRNLARLCAEGYVAQRE 280


>gi|77462402|ref|YP_351906.1| glycyl-tRNA synthetase subunit alpha [Rhodobacter sphaeroides
           2.4.1]
 gi|77386820|gb|ABA78005.1| Heterodimeric glycyl-transfer RNA synthetase [Rhodobacter
           sphaeroides 2.4.1]
          Length = 307

 Score =  559 bits (1441), Expect = e-157,   Method: Composition-based stats.
 Identities = 193/297 (64%), Positives = 232/297 (78%), Gaps = 1/297 (0%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
             SFQ IIL L  YW  +GC +LQPYDMEVGAGTFHP+TTLR+LG   W AAYVQPSRRP
Sbjct: 8   PRSFQEIILRLMTYWGAKGCAVLQPYDMEVGAGTFHPATTLRSLGARPWAAAYVQPSRRP 67

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNRLQHYYQ+QV+IKP+P +LQ LY+ SL+A+GID  +HD+RFVED+WESPT
Sbjct: 68  TDGRYGENPNRLQHYYQYQVLIKPSPPDLQKLYLGSLEAIGIDMDLHDIRFVEDDWESPT 127

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE WCDGME+SQFTYFQQV G +C P+SGE+TYGLERLAMYV  ++ V D+ F
Sbjct: 128 LGAWGLGWEVWCDGMEVSQFTYFQQVGGHDCRPVSGELTYGLERLAMYVLGIDHVMDMPF 187

Query: 190 NAIEGQN-VLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHR 248
           N   G   + YGD+F Q+EQEYSR+NF+ A+ ++L  HF D+E EC  +L     ++  R
Sbjct: 188 NDPCGPTPLTYGDVFRQTEQEYSRWNFDQADTDMLLQHFKDAEAECERILAAPETDKAGR 247

Query: 249 HHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNG 305
             +   PAYDQCIKASH+FNLLDARGVIS TERQ YI R+R+LAK C +AF+ T  G
Sbjct: 248 RIVMAHPAYDQCIKASHLFNLLDARGVISVTERQAYIGRVRALAKKCADAFVTTEAG 304


>gi|307543599|ref|YP_003896078.1| glycyl-tRNA synthetase subunit alpha [Halomonas elongata DSM 2581]
 gi|307215623|emb|CBV40893.1| glycyl-tRNA synthetase subunit alpha [Halomonas elongata DSM 2581]
          Length = 327

 Score =  559 bits (1441), Expect = e-157,   Method: Composition-based stats.
 Identities = 184/305 (60%), Positives = 230/305 (75%), Gaps = 11/305 (3%)

Query: 2   APIHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAA 61
           A   +  +  +FQ +IL L QYWA+QGC +LQP DMEVGAGTFH +T LR++GP +W AA
Sbjct: 7   AMTQSTPDVTTFQGLILALQQYWAEQGCVVLQPLDMEVGAGTFHTATFLRSIGPETWNAA 66

Query: 62  YVQPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFV 121
           YVQPSRRP DGRY ENPNRLQHYYQFQV++KP+P +LQ LY+ SLK +GIDPL+HD+RFV
Sbjct: 67  YVQPSRRPTDGRYGENPNRLQHYYQFQVVMKPSPADLQELYLGSLKCLGIDPLVHDIRFV 126

Query: 122 EDNWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNV 181
           EDNWESPTLGAWGLGWE W +GME++QFTYFQQ  G+EC P++GE+TYGLER+AMYVQ+V
Sbjct: 127 EDNWESPTLGAWGLGWEVWLNGMEVTQFTYFQQAGGLECYPVTGELTYGLERIAMYVQDV 186

Query: 182 NSVYDIVFN-AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKK 240
           +SVYD+V+  A +G  V YGD+F Q+E+E S YNFE+A+   L   F   E+EC  LL  
Sbjct: 187 DSVYDLVWTVAPDGSRVTYGDVFLQNEREQSAYNFEHADVPALFEAFDHQERECTKLLDA 246

Query: 241 GIPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFL 300
            +P           PAY+Q +KASH FNLLDAR  IS TERQRYILR+R++A+    A+ 
Sbjct: 247 SLP----------LPAYEQVLKASHTFNLLDARHAISVTERQRYILRVRTMARDVAHAYY 296

Query: 301 MTPNG 305
            +   
Sbjct: 297 ESRKA 301


>gi|315633361|ref|ZP_07888652.1| glycyl-tRNA synthetase alpha subunit [Aggregatibacter segnis ATCC
           33393]
 gi|315477861|gb|EFU68602.1| glycyl-tRNA synthetase alpha subunit [Aggregatibacter segnis ATCC
           33393]
          Length = 301

 Score =  558 bits (1440), Expect = e-157,   Method: Composition-based stats.
 Identities = 181/301 (60%), Positives = 218/301 (72%), Gaps = 8/301 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K N  +FQ +IL L +YWA QGCTI+QP+DMEVGAGT HP T LRALGP     AYVQ
Sbjct: 1   MTKFNVKTFQGMILALQEYWANQGCTIVQPFDMEVGAGTSHPMTALRALGPEPMAFAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQV+IKP+P N+Q LY+ SL+ +G DP  +D+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVVIKPSPDNIQELYLGSLEMLGFDPTKNDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GE+TYGLERLAMY+Q V+SV
Sbjct: 121 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEVTYGLERLAMYIQGVDSV 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V++        YGD+F Q+E E S YNFEYA+ + L   F   EKE   LL    P 
Sbjct: 181 YDLVWSDGPLGKTTYGDVFHQNEVEQSTYNFEYADTDFLFQCFDQYEKEAKSLLALERP- 239

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY++ +KA+H FNLLDAR  IS TERQRYILRIR+L K   EA+  +  
Sbjct: 240 -------LPLPAYERILKAAHSFNLLDARKAISVTERQRYILRIRALTKGVAEAYYASRE 292

Query: 305 G 305
            
Sbjct: 293 A 293


>gi|119471662|ref|ZP_01614047.1| glycyl-tRNA synthetase subunit alpha [Alteromonadales bacterium
           TW-7]
 gi|119445441|gb|EAW26728.1| glycyl-tRNA synthetase subunit alpha [Alteromonadales bacterium
           TW-7]
          Length = 300

 Score =  558 bits (1440), Expect = e-157,   Method: Composition-based stats.
 Identities = 183/301 (60%), Positives = 223/301 (74%), Gaps = 10/301 (3%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +IL L  YWAQQGC I+QP DMEVGAGTFHP T L+++GP    +AYVQ
Sbjct: 1   MQKYDVKTFQGLILALQDYWAQQGCVIIQPLDMEVGAGTFHPQTFLKSIGPEPMSSAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           P RRP DGRY ENPNRLQHYYQFQV++KP+P N+Q LY+ SLKA+GID L H+VRFVEDN
Sbjct: 61  PCRRPTDGRYGENPNRLQHYYQFQVVLKPSPDNIQELYLGSLKAMGIDTLTHEVRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WESPTLGAWGLGWE W +GME++QFTYFQQV G+ECSP++GEITYGLERLAMY+Q V+S+
Sbjct: 121 WESPTLGAWGLGWEIWLNGMEVTQFTYFQQVGGLECSPVTGEITYGLERLAMYIQGVDSI 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V+       V YGD+F Q+E E S YNFE+AN E L   F   E E   L++  +P 
Sbjct: 181 YDLVWADGPLGRVTYGDVFHQNEVEQSTYNFEHANVEDLFAQFDKCEAESQKLIEANLP- 239

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY+Q +KASH FNLLDAR  IS TERQRYILR+R+L+KAC +++     
Sbjct: 240 ---------LPAYEQVMKASHAFNLLDARHAISVTERQRYILRVRALSKACAQSYYDARE 290

Query: 305 G 305
            
Sbjct: 291 A 291


>gi|127510945|ref|YP_001092142.1| glycyl-tRNA synthetase subunit alpha [Shewanella loihica PV-4]
 gi|166200568|sp|A3Q8T5|SYGA_SHELP RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|126636240|gb|ABO21883.1| Glycine--tRNA ligase [Shewanella loihica PV-4]
          Length = 301

 Score =  558 bits (1440), Expect = e-157,   Method: Composition-based stats.
 Identities = 188/302 (62%), Positives = 227/302 (75%), Gaps = 8/302 (2%)

Query: 4   IHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYV 63
           +  K +  +FQ  ILTL +YWAQQGC I+QP DMEVGAGTFHP T LR+LGP    +AYV
Sbjct: 1   MTTKHDVKTFQGFILTLQEYWAQQGCAIVQPLDMEVGAGTFHPMTFLRSLGPEPMSSAYV 60

Query: 64  QPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVED 123
           QP RRP DGRY ENPNRLQHYYQFQV++KP+P N+Q LY+ SL+A+G+D  IHDVRFVED
Sbjct: 61  QPCRRPTDGRYGENPNRLQHYYQFQVVLKPSPSNIQELYLGSLEALGVDMNIHDVRFVED 120

Query: 124 NWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNS 183
           NWESPTLGAWGLGWE W +GME+SQFTYFQQV G+ECSP++GEITYGLERLAMY+Q V+S
Sbjct: 121 NWESPTLGAWGLGWEVWLNGMEVSQFTYFQQVGGLECSPVTGEITYGLERLAMYIQEVDS 180

Query: 184 VYDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIP 243
           VYD+V+       ++YGD+F Q+E E S YNFE+AN E+L   F D EK C +LL    P
Sbjct: 181 VYDLVWTDGPMGKIMYGDVFHQNEVEQSTYNFEHANVEVLFKQFDDCEKACNELLALETP 240

Query: 244 NEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTP 303
                      PAY+Q +KASH FNLLDAR  IS TERQRYILR+R++AK+  E++    
Sbjct: 241 --------LPLPAYEQVMKASHAFNLLDARHAISVTERQRYILRVRTMAKSVAESYYQAR 292

Query: 304 NG 305
             
Sbjct: 293 EA 294


>gi|85057989|ref|YP_453691.1| glycyl-tRNA synthetase subunit alpha [Sodalis glossinidius str.
           'morsitans']
 gi|123520404|sp|Q2NX39|SYGA_SODGM RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|84778509|dbj|BAE73286.1| glycyl-tRNA synthase alpha subunit [Sodalis glossinidius str.
           'morsitans']
          Length = 304

 Score =  558 bits (1440), Expect = e-157,   Method: Composition-based stats.
 Identities = 187/301 (62%), Positives = 222/301 (73%), Gaps = 8/301 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +ILTL  YWA+QGCTI+QP DMEVGAGT HP T LRALGP    AAYVQ
Sbjct: 1   MQKFDPKTFQGLILTLQDYWARQGCTIVQPLDMEVGAGTSHPMTCLRALGPEPIAAAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRR  DGRY ENPNRLQHYYQFQVIIKP+P N+Q LY+ SL+ VG+DP IHD+RFVEDN
Sbjct: 61  PSRRSTDGRYGENPNRLQHYYQFQVIIKPSPENIQELYLGSLREVGLDPTIHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLERLAMY+Q V+SV
Sbjct: 121 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECRPVTGEITYGLERLAMYLQGVDSV 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V++        YGD+F Q+E E S YNFEYA+ + L   F   EKE  +LL    P 
Sbjct: 181 YDLVWSDGPLGRTTYGDVFHQNEVEQSTYNFEYADVDFLFTCFEQYEKEAQNLLALEKP- 239

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY++ +KA+H FNLLDAR  IS TERQRYILRIR+L KA  EA+  +  
Sbjct: 240 -------LPLPAYERILKAAHSFNLLDARKAISVTERQRYILRIRTLTKAVAEAYYASRE 292

Query: 305 G 305
            
Sbjct: 293 A 293


>gi|261856635|ref|YP_003263918.1| glycyl-tRNA synthetase subunit alpha [Halothiobacillus neapolitanus
           c2]
 gi|261837104|gb|ACX96871.1| glycyl-tRNA synthetase, alpha subunit [Halothiobacillus
           neapolitanus c2]
          Length = 308

 Score =  558 bits (1440), Expect = e-157,   Method: Composition-based stats.
 Identities = 182/306 (59%), Positives = 230/306 (75%), Gaps = 11/306 (3%)

Query: 1   MAPIHNKKNDL-SFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWK 59
           M    N  +DL +FQ +IL L+++WA QGC +LQP D+EVGAGTFHP+T LRA+GP  W+
Sbjct: 1   MPIKMNTHHDLSTFQGLILALSEFWANQGCAVLQPLDIEVGAGTFHPATFLRAIGPEPWR 60

Query: 60  AAYVQPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVR 119
           AAYVQPSRRP DGRY ENPNRLQHYYQFQV++KP+P N+Q LY++SL  +G DPL HD+R
Sbjct: 61  AAYVQPSRRPTDGRYGENPNRLQHYYQFQVLLKPSPDNIQQLYLDSLALLGFDPLTHDIR 120

Query: 120 FVEDNWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQ 179
           FVEDNWESPTLGAWGLGWE W +GME++QFTYFQQ+ G++C P+SGEITYGLERLAMY+Q
Sbjct: 121 FVEDNWESPTLGAWGLGWEVWLNGMEVTQFTYFQQIGGLDCRPVSGEITYGLERLAMYMQ 180

Query: 180 NVNSVYDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLK 239
            V SVYD+V++  E   + YGD++ Q+E E S YNFE+A+   L   F  +E+E L L++
Sbjct: 181 GVQSVYDLVWSKSEAGIITYGDVYHQNEVEQSTYNFEHADTAFLFKVFDQAERESLRLVE 240

Query: 240 KGIPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAF 299
            G+P           PAY+Q +KASH FNLLDAR  IS TERQR+ILR+R+LA+   E +
Sbjct: 241 LGLP----------LPAYEQVLKASHAFNLLDARRAISVTERQRFILRVRTLARGVAETY 290

Query: 300 LMTPNG 305
                 
Sbjct: 291 YARREA 296


>gi|153874659|ref|ZP_02002794.1| glycyl-tRNA synthetase, alpha chain [Beggiatoa sp. PS]
 gi|152068878|gb|EDN67207.1| glycyl-tRNA synthetase, alpha chain [Beggiatoa sp. PS]
          Length = 296

 Score =  558 bits (1440), Expect = e-157,   Method: Composition-based stats.
 Identities = 180/298 (60%), Positives = 226/298 (75%), Gaps = 10/298 (3%)

Query: 7   KKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPS 66
             +  +FQ +IL L +YWA QGC + QPYDMEVGAGTFHP+T LRA+GP  W AAYVQPS
Sbjct: 1   MSSPTTFQALILALQEYWANQGCVLQQPYDMEVGAGTFHPATFLRAIGPEPWSAAYVQPS 60

Query: 67  RRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWE 126
           RRP DGRY ENPNRLQHYYQ+QV+IKP+PLN+Q+LY++SLK +G DPLIHD+RFVEDNWE
Sbjct: 61  RRPTDGRYGENPNRLQHYYQYQVVIKPSPLNIQDLYLDSLKMLGFDPLIHDIRFVEDNWE 120

Query: 127 SPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYD 186
           SPTLGAWGLGWE W +GMEI+QFTYFQQ+ G++C P++GEITYGLER+AMY+Q+V SVYD
Sbjct: 121 SPTLGAWGLGWEVWLNGMEITQFTYFQQIGGLDCKPVTGEITYGLERIAMYLQDVKSVYD 180

Query: 187 IVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEH 246
           +V+       + YGD+F Q+E E S YNFE+A  + L + F   E++   L++K +P   
Sbjct: 181 LVWTDGPLGRITYGDVFHQNEVEMSAYNFEHAPVDELFHLFDMYEQQSNSLIEKNLP--- 237

Query: 247 HRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                   PAY+  +K SH FNLLDAR  IS TERQRYILR+R+LA+A  +A+     
Sbjct: 238 -------LPAYEMMLKTSHTFNLLDARHAISVTERQRYILRVRALARAVAQAYYDRRE 288


>gi|99082152|ref|YP_614306.1| glycyl-tRNA synthetase subunit alpha [Ruegeria sp. TM1040]
 gi|99038432|gb|ABF65044.1| Glycine--tRNA ligase [Ruegeria sp. TM1040]
          Length = 316

 Score =  558 bits (1440), Expect = e-157,   Method: Composition-based stats.
 Identities = 194/306 (63%), Positives = 238/306 (77%), Gaps = 2/306 (0%)

Query: 4   IHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYV 63
           +       SFQ IIL L  YWA +GC ILQPYDMEVGAGTFHP+TTLR+LG   W AAYV
Sbjct: 1   MTQTTAPRSFQEIILRLQTYWASKGCAILQPYDMEVGAGTFHPATTLRSLGSKPWAAAYV 60

Query: 64  QPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVED 123
           QPSRRP DGRY ENPNRLQHYYQ+QV+IKP+P +LQ LY+ SL+A+G+D  +HD+RFVED
Sbjct: 61  QPSRRPTDGRYGENPNRLQHYYQYQVLIKPSPPDLQELYLGSLEAIGVDMDLHDIRFVED 120

Query: 124 NWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNS 183
           +WESPTLGAWGLGWE WCDGME+SQFTYFQQV G +C P+SGE+TYGLERLAMY+  V+ 
Sbjct: 121 DWESPTLGAWGLGWEVWCDGMEVSQFTYFQQVGGHDCHPVSGELTYGLERLAMYILGVDH 180

Query: 184 VYDIVFNAIEGQ-NVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLL-KKG 241
           V D+ FN  +    + YGDIF Q+E+EY+R+NF+ AN E+L  HF ++E EC  +L ++ 
Sbjct: 181 VMDMPFNDPQSPQPLSYGDIFKQTEEEYARWNFDVANTEVLLRHFEEAETECAAILAQEH 240

Query: 242 IPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLM 301
              +  +  +   PAYDQCIKASH+FNLLDARGVIS TERQ YI R+R+LAK C +AF++
Sbjct: 241 TDPKTGKRIIMAHPAYDQCIKASHVFNLLDARGVISVTERQAYIGRVRALAKQCADAFVL 300

Query: 302 TPNGGH 307
           T  GGH
Sbjct: 301 TEAGGH 306


>gi|86748218|ref|YP_484714.1| glycyl-tRNA synthetase subunit alpha [Rhodopseudomonas palustris
           HaA2]
 gi|86571246|gb|ABD05803.1| glycyl-tRNA synthetase, alpha subunit [Rhodopseudomonas palustris
           HaA2]
          Length = 324

 Score =  558 bits (1440), Expect = e-157,   Method: Composition-based stats.
 Identities = 202/305 (66%), Positives = 244/305 (80%), Gaps = 5/305 (1%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
            + + + SFQ +ILTL ++WA  GC ILQPYDMEVGAGTFHP+TTLRALGP  W+AAYVQ
Sbjct: 6   PHMRPERSFQGLILTLQRFWADYGCVILQPYDMEVGAGTFHPATTLRALGPKPWRAAYVQ 65

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQVI+KP+P +LQ+LY++SL+A+G+D  +HDVRFVED+
Sbjct: 66  PSRRPKDGRYGENPNRLQHYYQFQVILKPSPPDLQDLYLKSLQAIGVDTALHDVRFVEDD 125

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WESPTLGAWGLGWECWCDGME+SQFTYFQQV G+EC+P++GE+TYGLERLAMYVQ ++ V
Sbjct: 126 WESPTLGAWGLGWECWCDGMEVSQFTYFQQVAGVECAPVAGELTYGLERLAMYVQGIDRV 185

Query: 185 YDIVFNAIEG-QNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGI- 242
           YD+ FN  +G   V YGD+F Q+E+EYS++NFE A+ ++L   F  +E+ C   L  G  
Sbjct: 186 YDLNFNGRDGADKVTYGDVFLQAEKEYSKHNFEVADTDMLFAQFKMAEEACKKYLDAGWQ 245

Query: 243 ---PNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAF 299
                     HL   PAYDQCIKASH+FNLLDARGVIS TERQ YILR+R LAKACGEA+
Sbjct: 246 MSADGGKREAHLMALPAYDQCIKASHVFNLLDARGVISVTERQSYILRVRDLAKACGEAW 305

Query: 300 LMTPN 304
           L T  
Sbjct: 306 LHTEA 310


>gi|104779331|ref|YP_605829.1| glycyl-tRNA synthetase subunit alpha [Pseudomonas entomophila L48]
 gi|166200562|sp|Q1IH41|SYGA_PSEE4 RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|95108318|emb|CAK13012.1| glycyl-tRNA synthetase, alpha chain [Pseudomonas entomophila L48]
          Length = 315

 Score =  558 bits (1440), Expect = e-157,   Method: Composition-based stats.
 Identities = 186/293 (63%), Positives = 223/293 (76%), Gaps = 10/293 (3%)

Query: 12  SFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPLD 71
           +FQ++IL L  YWA+QGC +LQPYDMEVGAGTFH +T LRA+GP +W AAYVQPSRRP D
Sbjct: 10  TFQDLILALQNYWAEQGCVVLQPYDMEVGAGTFHTATFLRAVGPETWNAAYVQPSRRPAD 69

Query: 72  GRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTLG 131
           GRY ENPNRLQHYYQFQV++KPNP N Q LY+ SLKA+G+DPL+HD+RFVEDNWESPTLG
Sbjct: 70  GRYGENPNRLQHYYQFQVVLKPNPANFQELYLGSLKAIGLDPLVHDIRFVEDNWESPTLG 129

Query: 132 AWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFNA 191
           AWGLGWE W +GME++QFTYFQQV GIEC P++GEITYGLERLAMY+Q V+SVYD+V+  
Sbjct: 130 AWGLGWEIWLNGMEVTQFTYFQQVGGIECYPVTGEITYGLERLAMYLQGVDSVYDLVWAD 189

Query: 192 IEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHHL 251
                V YGD+F Q+E E S YNFE+AN E L   F   E E   L+K  +P        
Sbjct: 190 GPFGKVTYGDVFHQNEVEQSTYNFEHANVEKLFELFDFYESEANRLIKLDLP-------- 241

Query: 252 CVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
              P Y+  +KASH FNLLDAR  IS TERQRYILR+R+LA+   +++L    
Sbjct: 242 --LPTYEMVLKASHTFNLLDARRAISVTERQRYILRVRTLARDVAQSYLQARA 292


>gi|152978093|ref|YP_001343722.1| glycyl-tRNA synthetase subunit alpha [Actinobacillus succinogenes
           130Z]
 gi|171472950|sp|A6VLE0|SYGA_ACTSZ RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|150839816|gb|ABR73787.1| glycyl-tRNA synthetase, alpha subunit [Actinobacillus succinogenes
           130Z]
          Length = 314

 Score =  558 bits (1440), Expect = e-157,   Method: Composition-based stats.
 Identities = 183/306 (59%), Positives = 223/306 (72%), Gaps = 4/306 (1%)

Query: 4   IHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYV 63
           +  K N  +FQ +IL L  YWAQQGCTI+QP+DMEVGAGT HP T LRA+GP     AYV
Sbjct: 1   MDAKFNVKTFQGMILALQDYWAQQGCTIVQPFDMEVGAGTSHPMTALRAIGPEPMAFAYV 60

Query: 64  QPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVED 123
           QPSRRP DGRY ENPNRLQHYYQFQV+IKP+P N+Q LY+ SLK +G DP  HD+RFVED
Sbjct: 61  QPSRRPTDGRYGENPNRLQHYYQFQVVIKPSPDNIQELYLGSLKMLGFDPTQHDIRFVED 120

Query: 124 NWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNS 183
           NWE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GE+TYGLERLAMY+Q V+S
Sbjct: 121 NWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEVTYGLERLAMYIQGVDS 180

Query: 184 VYDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIP 243
           VYD+V++        YGD+F Q+E E S YNFEYA+ + L   F   E+E   LLK+   
Sbjct: 181 VYDLVWSDGPLGKTTYGDVFHQNEVEQSTYNFEYADVDFLFECFNKYEQEAKFLLKQEPR 240

Query: 244 NEHHRHH----LCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAF 299
            E+ +          PAY++ +KA+H FNLLDAR  IS TERQRYILRIR+L K   EA+
Sbjct: 241 MENDKEIWVETALPLPAYERILKAAHSFNLLDARKAISVTERQRYILRIRALTKGVAEAY 300

Query: 300 LMTPNG 305
             +   
Sbjct: 301 YASREA 306


>gi|332533696|ref|ZP_08409555.1| glycyl-tRNA synthetase alpha chain [Pseudoalteromonas haloplanktis
           ANT/505]
 gi|332036860|gb|EGI73321.1| glycyl-tRNA synthetase alpha chain [Pseudoalteromonas haloplanktis
           ANT/505]
          Length = 300

 Score =  558 bits (1440), Expect = e-157,   Method: Composition-based stats.
 Identities = 182/301 (60%), Positives = 222/301 (73%), Gaps = 10/301 (3%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +IL L  YWAQQGC I+QP DMEVGAGTFHP T L+++GP    +AYVQ
Sbjct: 1   MQKYDVKTFQGLILALQDYWAQQGCVIIQPLDMEVGAGTFHPQTFLKSIGPEPMSSAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           P RRP DGRY ENPNRLQHYYQFQV++KP+P N+Q LY+ SL A+GID L H+VRFVEDN
Sbjct: 61  PCRRPTDGRYGENPNRLQHYYQFQVVLKPSPDNIQELYLGSLAAMGIDTLTHEVRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WESPTLGAWGLGWE W +GME++QFTYFQQV G+ECSP++GEITYGLERLAMY+Q V+S+
Sbjct: 121 WESPTLGAWGLGWEIWLNGMEVTQFTYFQQVGGLECSPVTGEITYGLERLAMYIQGVDSI 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V+       V YGD+F Q+E E S YNFE+AN E L   F   E E   L++  +P 
Sbjct: 181 YDLVWADGPLGRVTYGDVFHQNEVEQSTYNFEHANVEDLFAQFDKCEAESQKLIEANLP- 239

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY+Q +KASH FNLLDAR  IS TERQRYILR+R+L+KAC +++     
Sbjct: 240 ---------LPAYEQVMKASHAFNLLDARHAISVTERQRYILRVRALSKACAQSYYDKRE 290

Query: 305 G 305
            
Sbjct: 291 A 291


>gi|78224138|ref|YP_385885.1| glycyl-tRNA synthetase subunit alpha [Geobacter metallireducens
           GS-15]
 gi|123571060|sp|Q39RG4|SYGA_GEOMG RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|78195393|gb|ABB33160.1| glycyl-tRNA synthetase alpha chain [Geobacter metallireducens
           GS-15]
          Length = 291

 Score =  558 bits (1439), Expect = e-157,   Method: Composition-based stats.
 Identities = 175/294 (59%), Positives = 218/294 (74%), Gaps = 14/294 (4%)

Query: 11  LSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPL 70
           ++FQ++IL+L  YWA+QGC I QPYD E GAGTF+P+T LR LGP  W  AYV+PSRRP 
Sbjct: 1   MTFQDLILSLQGYWAKQGCVIQQPYDTEKGAGTFNPATFLRVLGPEPWNVAYVEPSRRPT 60

Query: 71  DGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTL 130
           DGRY ENPNRLQHYYQFQVI+KP+PLN+ +LY++SL+A GIDP  HD+RFVED+WESPTL
Sbjct: 61  DGRYGENPNRLQHYYQFQVIMKPSPLNILDLYLDSLRAFGIDPQKHDIRFVEDDWESPTL 120

Query: 131 GAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFN 190
           GAWGLGWE W DGMEI+QFTYFQQ  GI+  P+S EITYG ER+AMY+Q V++VYD+ + 
Sbjct: 121 GAWGLGWEVWLDGMEITQFTYFQQAGGIDLKPVSSEITYGCERIAMYLQGVDNVYDLEW- 179

Query: 191 AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHH 250
               + V YGDI  +SE E+S YNFE A+  +L   F   EKEC+ L+++G+        
Sbjct: 180 ---IKGVSYGDIHHRSEVEFSTYNFEEADVAMLLQLFTMYEKECVRLVERGL-------- 228

Query: 251 LCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
             V PAYD  +K SH FNLLDARG IS TER  YI R+R++A+ C E +L    
Sbjct: 229 --VLPAYDFVMKCSHTFNLLDARGAISVTERASYIGRVRNVARLCAEGYLKLRE 280


>gi|92118677|ref|YP_578406.1| glycyl-tRNA synthetase subunit alpha [Nitrobacter hamburgensis X14]
 gi|91801571|gb|ABE63946.1| glycyl-tRNA synthetase alpha chain [Nitrobacter hamburgensis X14]
          Length = 314

 Score =  558 bits (1439), Expect = e-157,   Method: Composition-based stats.
 Identities = 206/308 (66%), Positives = 247/308 (80%), Gaps = 6/308 (1%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
            + + + SFQ +ILTL +YWA  GC ILQPYDMEVGAGTFHP+TTLRALGP  W AAYVQ
Sbjct: 6   PHMRPERSFQGLILTLQRYWADFGCVILQPYDMEVGAGTFHPATTLRALGPKRWNAAYVQ 65

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQVI+KP+P ++Q+LY++SL A+G+D  +HD+RFVED+
Sbjct: 66  PSRRPKDGRYGENPNRLQHYYQFQVILKPSPPDIQDLYLKSLAAIGVDSALHDIRFVEDD 125

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WESPTLGAWGLGWECWCDGME+SQFTYFQQV G+EC+P++GE+TYGLERLAM+VQ V+ V
Sbjct: 126 WESPTLGAWGLGWECWCDGMEVSQFTYFQQVAGVECAPVAGELTYGLERLAMFVQGVDRV 185

Query: 185 YDIVFNAIEG-QNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIP 243
           YD+ FN  EG   V YGD+F Q+EQEYSR+NFE+++  +L   F  +E  C   L+ G  
Sbjct: 186 YDLNFNGREGADKVTYGDVFLQAEQEYSRHNFEHSDTAMLFEQFRMAESACKTYLEAGWQ 245

Query: 244 NEHHRH-----HLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEA 298
           +   +      HL V PAYDQCIKASH+FNLLDARGVIS TERQ YILR+R LAKACGEA
Sbjct: 246 DNPQKPGKREAHLMVLPAYDQCIKASHVFNLLDARGVISVTERQSYILRVRELAKACGEA 305

Query: 299 FLMTPNGG 306
           +L T  GG
Sbjct: 306 WLHTEAGG 313


>gi|16272864|ref|NP_439087.1| glycyl-tRNA synthetase subunit alpha [Haemophilus influenzae Rd
           KW20]
 gi|145632314|ref|ZP_01788049.1| glycyl-tRNA synthetase alpha subunit [Haemophilus influenzae 3655]
 gi|260580016|ref|ZP_05847846.1| glycyl-tRNA synthetase, alpha subunit [Haemophilus influenzae RdAW]
 gi|1174510|sp|P43821|SYGA_HAEIN RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|1573948|gb|AAC22586.1| glycyl-tRNA synthetase, alpha chain (glyQ) [Haemophilus influenzae
           Rd KW20]
 gi|144987221|gb|EDJ93751.1| glycyl-tRNA synthetase alpha subunit [Haemophilus influenzae 3655]
 gi|260093300|gb|EEW77233.1| glycyl-tRNA synthetase, alpha subunit [Haemophilus influenzae RdAW]
 gi|301169651|emb|CBW29252.1| glycine tRNA synthetase, alpha subunit [Haemophilus influenzae
           10810]
          Length = 302

 Score =  558 bits (1439), Expect = e-157,   Method: Composition-based stats.
 Identities = 181/302 (59%), Positives = 220/302 (72%), Gaps = 8/302 (2%)

Query: 4   IHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYV 63
           +  K N  +FQ +IL L +YWA QGCTI+QP+DMEVGAGT HP T LRALGP     AYV
Sbjct: 1   MSTKFNVKTFQGMILALQEYWANQGCTIVQPFDMEVGAGTSHPMTALRALGPEPMAFAYV 60

Query: 64  QPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVED 123
           QPSRRP DGRY ENPNRLQHYYQFQV+IKP+P N+Q LY+ SL+ +G DP  +D+RFVED
Sbjct: 61  QPSRRPTDGRYGENPNRLQHYYQFQVVIKPSPDNIQELYLGSLEMLGFDPTKNDIRFVED 120

Query: 124 NWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNS 183
           NWE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GE+TYGLERLAMY+Q V+S
Sbjct: 121 NWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEVTYGLERLAMYIQGVDS 180

Query: 184 VYDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIP 243
           VYD+V++        YGD+F Q+E E S YNFE+AN + L   F   EKE  +LL    P
Sbjct: 181 VYDLVWSDGPLGKTTYGDVFHQNEVEQSTYNFEHANTDFLFYCFDQYEKEAQELLALEKP 240

Query: 244 NEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTP 303
                      PAY++ +KA+H FNLLDAR  IS TERQRYILRIR+L K   EA+  + 
Sbjct: 241 --------LPLPAYERILKAAHSFNLLDARKAISVTERQRYILRIRALTKGVAEAYYASR 292

Query: 304 NG 305
             
Sbjct: 293 EA 294


>gi|304320102|ref|YP_003853745.1| glycyl-tRNA synthetase subunit alpha [Parvularcula bermudensis
           HTCC2503]
 gi|303299005|gb|ADM08604.1| glycyl-tRNA synthetase, alpha subunit [Parvularcula bermudensis
           HTCC2503]
          Length = 301

 Score =  558 bits (1439), Expect = e-157,   Method: Composition-based stats.
 Identities = 192/296 (64%), Positives = 233/296 (78%), Gaps = 13/296 (4%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
             SFQ++IL L  YWA++GC +LQPYD+E+GAGTFHP+TTLRALGP  W+AAYVQP RRP
Sbjct: 8   PPSFQDLILILQTYWAERGCVLLQPYDLEMGAGTFHPATTLRALGPKPWRAAYVQPCRRP 67

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY  NPNR QHYYQFQV++KP+P ++Q LY+ SLKA+GID   HD+RFVED+WESPT
Sbjct: 68  GDGRYGANPNRFQHYYQFQVVLKPSPTDIQELYLGSLKAMGIDAAKHDIRFVEDDWESPT 127

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE WCDGME++QFTYFQQV G++C P++GE+TYGLERLAMYVQ V++ YD+ F
Sbjct: 128 LGAWGLGWEVWCDGMEVTQFTYFQQVGGVDCRPVTGELTYGLERLAMYVQGVDNGYDLDF 187

Query: 190 NAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRH 249
           N      V YGD+F Q E+E+S YNFE AN E+L + F ++E  C  +L KG+       
Sbjct: 188 NGA---GVTYGDVFHQQEREFSAYNFELANTEVLFDQFREAEAACSAILDKGL------- 237

Query: 250 HLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNG 305
                PAYDQCIKASH+FNLLDARGVIS TERQ YILR+R LAKAC EA+L +P G
Sbjct: 238 ---ALPAYDQCIKASHLFNLLDARGVISVTERQSYILRVRRLAKACCEAWLASPQG 290


>gi|148828104|ref|YP_001292857.1| glycyl-tRNA synthetase subunit alpha [Haemophilus influenzae
           PittGG]
 gi|166200225|sp|A5UI68|SYGA_HAEIG RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|148719346|gb|ABR00474.1| hypothetical protein CGSHiGG_08200 [Haemophilus influenzae PittGG]
          Length = 302

 Score =  558 bits (1439), Expect = e-157,   Method: Composition-based stats.
 Identities = 181/302 (59%), Positives = 220/302 (72%), Gaps = 8/302 (2%)

Query: 4   IHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYV 63
           +  K N  +FQ +IL L +YWA QGCTI+QP+DMEVGAGT HP T LRALGP     AYV
Sbjct: 1   MSTKFNVKTFQGMILALQEYWANQGCTIVQPFDMEVGAGTSHPMTALRALGPEPMAFAYV 60

Query: 64  QPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVED 123
           QPSRRP DGRY ENPNRLQHYYQFQV+IKP+P N+Q LY+ SL+ +G DP  +D+RFVED
Sbjct: 61  QPSRRPTDGRYGENPNRLQHYYQFQVVIKPSPDNIQELYLGSLEMLGFDPTQNDIRFVED 120

Query: 124 NWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNS 183
           NWE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GE+TYGLERLAMY+Q V+S
Sbjct: 121 NWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEVTYGLERLAMYIQGVDS 180

Query: 184 VYDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIP 243
           VYD+V++        YGD+F Q+E E S YNFE+AN + L   F   EKE  +LL    P
Sbjct: 181 VYDLVWSDGPLGKTTYGDVFHQNEVEQSTYNFEHANTDFLFYCFDQYEKEAQELLALEKP 240

Query: 244 NEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTP 303
                      PAY++ +KA+H FNLLDAR  IS TERQRYILRIR+L K   EA+  + 
Sbjct: 241 --------LPLPAYERILKAAHSFNLLDARKAISVTERQRYILRIRTLTKGVAEAYYASR 292

Query: 304 NG 305
             
Sbjct: 293 EA 294


>gi|332750150|gb|EGJ80561.1| glycyl-tRNA synthetase alpha subunit [Shigella flexneri 4343-70]
          Length = 303

 Score =  558 bits (1439), Expect = e-157,   Method: Composition-based stats.
 Identities = 185/301 (61%), Positives = 221/301 (73%), Gaps = 8/301 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +ILTL  YWA+QGCTI+QP DMEVGAGT HP T LRALGP    AAYVQ
Sbjct: 1   MQKFDTRTFQGLILTLQDYWARQGCTIVQPLDMEVGAGTSHPMTCLRALGPEPMAAAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQV+IKP+P N+Q LY+ SLK +G+DP IHD+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVVIKPSPDNIQELYLGSLKELGMDPTIHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLERLAMY+Q V+SV
Sbjct: 121 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGLERLAMYIQGVDSV 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V++        YGD+F Q+E E S YNFEYA+ + L   F   EKE   L       
Sbjct: 181 YDLVWSDGPLGKTTYGDVFHQNEVEQSTYNFEYADVDFLFTCFEQYEKEAQQL------- 233

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                +    PAY++ +KA+H FNLLDAR  IS TERQRYILRIR+L KA  EA+  +  
Sbjct: 234 -RALENPLPLPAYERILKAAHSFNLLDARKAISVTERQRYILRIRTLTKAVAEAYYASRE 292

Query: 305 G 305
            
Sbjct: 293 A 293


>gi|126725593|ref|ZP_01741435.1| glycyl-tRNA synthetase subunit alpha [Rhodobacterales bacterium
           HTCC2150]
 gi|126704797|gb|EBA03888.1| glycyl-tRNA synthetase subunit alpha [Rhodobacterales bacterium
           HTCC2150]
          Length = 309

 Score =  558 bits (1439), Expect = e-157,   Method: Composition-based stats.
 Identities = 195/303 (64%), Positives = 233/303 (76%), Gaps = 2/303 (0%)

Query: 6   NKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQP 65
           N     SFQ IIL L  YWA +GC +LQPYDMEVGAGTFHP+TTLR+LG   W AAYVQP
Sbjct: 4   NTAAPRSFQEIILRLQNYWASKGCAVLQPYDMEVGAGTFHPATTLRSLGSTPWAAAYVQP 63

Query: 66  SRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNW 125
           SRRP DGRY ENPNRLQHYYQFQ I+KP+P +LQ LY+ SL A+G+D  +HD+RFVED+W
Sbjct: 64  SRRPTDGRYGENPNRLQHYYQFQAILKPSPPDLQALYLGSLVAIGVDMEMHDIRFVEDDW 123

Query: 126 ESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVY 185
           ESPTLGAWGLGWE WCDGME+SQFTYFQQV G +C P+SGE+TYGLERLAMY+  V+ V 
Sbjct: 124 ESPTLGAWGLGWEVWCDGMEVSQFTYFQQVGGHDCKPVSGELTYGLERLAMYILGVDHVM 183

Query: 186 DIVFNAIEGQ-NVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           D+ FN  +    + YGDIFAQ+E EYSR+NF+ A+ +IL  HF+D+E EC  +L     +
Sbjct: 184 DMPFNDPDAPIPLKYGDIFAQTEAEYSRWNFDVADTDILLQHFVDAEAECARILDAPYDD 243

Query: 245 EH-HRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTP 303
               +  +   PAYDQCIKASH+FNLLDARGVIS TERQ YI R+R+LAK C +AF+ T 
Sbjct: 244 PKTGKRIVMAHPAYDQCIKASHLFNLLDARGVISVTERQAYIGRVRTLAKRCADAFVETT 303

Query: 304 NGG 306
            GG
Sbjct: 304 AGG 306


>gi|16131431|ref|NP_418017.1| glycine tRNA synthetase, alpha subunit [Escherichia coli str. K-12
           substr. MG1655]
 gi|89110453|ref|AP_004233.1| glycine tRNA synthetase, alpha subunit [Escherichia coli str. K-12
           substr. W3110]
 gi|586055|sp|P00960|SYGA_ECOLI RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|466698|gb|AAB18537.1| glycine-tRNA synthetase, alpha subunit [Escherichia coli str. K-12
           substr. MG1655]
 gi|1789983|gb|AAC76584.1| glycine tRNA synthetase, alpha subunit [Escherichia coli str. K-12
           substr. MG1655]
 gi|85676484|dbj|BAE77734.1| glycine tRNA synthetase, alpha subunit [Escherichia coli str. K12
           substr. W3110]
          Length = 303

 Score =  558 bits (1439), Expect = e-157,   Method: Composition-based stats.
 Identities = 186/301 (61%), Positives = 221/301 (73%), Gaps = 8/301 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +ILTL  YWA+QGCTI+QP DMEVGAGT HP T LR LGP    AAYVQ
Sbjct: 1   MQKFDTRTFQGLILTLQDYWARQGCTIVQPLDMEVGAGTSHPMTCLRELGPEPMAAAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQV+IKP+P N+Q LY+ SLK +G+DP IHD+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVVIKPSPDNIQELYLGSLKELGMDPTIHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLERLAMY+Q V+SV
Sbjct: 121 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGLERLAMYIQGVDSV 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V++        YGD+F Q+E E S YNFEYA+ + L   F   EKE   LL    P 
Sbjct: 181 YDLVWSDGPLGKTTYGDVFHQNEVEQSTYNFEYADVDFLFTCFEQYEKEAQQLLALENP- 239

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY++ +KA+H FNLLDAR  IS TERQRYILRIR+L KA  EA+  +  
Sbjct: 240 -------LPLPAYERILKAAHSFNLLDARKAISVTERQRYILRIRTLTKAVAEAYYASRE 292

Query: 305 G 305
            
Sbjct: 293 A 293


>gi|238690871|sp|B5ED83|SYGA_GEOBB RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
          Length = 291

 Score =  558 bits (1438), Expect = e-157,   Method: Composition-based stats.
 Identities = 175/294 (59%), Positives = 218/294 (74%), Gaps = 14/294 (4%)

Query: 11  LSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPL 70
           ++FQ +IL+L  YWA QGC I QPYD E GAGTF+P+T LR LGP  WK AYV+PSRRP 
Sbjct: 1   MTFQELILSLQGYWAGQGCVIQQPYDTEKGAGTFNPATFLRVLGPEPWKVAYVEPSRRPT 60

Query: 71  DGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTL 130
           DGRY ENPNRLQHYYQFQVI+KP+P+N+ +LY++SL+A GIDP  HD+RFVED+WESPTL
Sbjct: 61  DGRYGENPNRLQHYYQFQVIMKPSPMNILDLYLDSLRAFGIDPGKHDIRFVEDDWESPTL 120

Query: 131 GAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFN 190
           GAWGLGWE W DGMEI+QFTYFQQ  GI+  P+S EITYG ER+AMY+Q V++VYD+ + 
Sbjct: 121 GAWGLGWEVWLDGMEITQFTYFQQAGGIDLKPVSSEITYGCERIAMYLQGVDNVYDLEWV 180

Query: 191 AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHH 250
               + V YGDI  +SE E+S YNFE A+ ++L   F   EKEC+ L++KG+        
Sbjct: 181 ----KGVRYGDIHHESEVEFSTYNFEEADVDMLLQLFKMYEKECVRLVEKGL-------- 228

Query: 251 LCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
             V PAYD  +K SH FNLLDARG IS TER  YI ++R++A+ C E +L    
Sbjct: 229 --VLPAYDYVMKCSHTFNLLDARGAISVTERASYIGKVRNVARLCAEGYLQMRE 280


>gi|167031098|ref|YP_001666329.1| glycyl-tRNA synthetase subunit alpha [Pseudomonas putida GB-1]
 gi|189082258|sp|B0KF23|SYGA_PSEPG RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|166857586|gb|ABY95993.1| glycyl-tRNA synthetase, alpha subunit [Pseudomonas putida GB-1]
          Length = 315

 Score =  558 bits (1438), Expect = e-157,   Method: Composition-based stats.
 Identities = 185/293 (63%), Positives = 222/293 (75%), Gaps = 10/293 (3%)

Query: 12  SFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPLD 71
           +FQ++IL L  YWA QGC +LQPYDMEVGAGTFH +T LRA+GP +W AAYVQPSRRP D
Sbjct: 10  TFQDLILALQNYWAAQGCVVLQPYDMEVGAGTFHTATFLRAVGPETWNAAYVQPSRRPAD 69

Query: 72  GRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTLG 131
           GRY ENPNRLQHYYQFQV++KPNP N Q LY+ SLKA+G+DPL+HD+RFVEDNWESPTLG
Sbjct: 70  GRYGENPNRLQHYYQFQVVLKPNPANFQELYLGSLKAIGLDPLVHDIRFVEDNWESPTLG 129

Query: 132 AWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFNA 191
           AWGLGWE W +GME++QFTYFQQV GIEC P++GEITYGLERLAMY+Q V+SVYD+V+  
Sbjct: 130 AWGLGWEIWLNGMEVTQFTYFQQVGGIECYPVTGEITYGLERLAMYIQGVDSVYDLVWAD 189

Query: 192 IEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHHL 251
                V YGD+F Q+E E S YNFE+AN + L   F   E E   L+K  +P        
Sbjct: 190 GPFGKVTYGDVFHQNEVEQSTYNFEHANVDKLFELFDFYESEANRLIKLDLP-------- 241

Query: 252 CVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
              P Y+  +KASH FNLLDAR  IS TERQRYILR+R+LA+   +++L    
Sbjct: 242 --LPTYEMVLKASHTFNLLDARRAISVTERQRYILRVRTLARDVAQSYLQARA 292


>gi|154247258|ref|YP_001418216.1| glycyl-tRNA synthetase subunit alpha [Xanthobacter autotrophicus
           Py2]
 gi|154161343|gb|ABS68559.1| glycyl-tRNA synthetase, alpha subunit [Xanthobacter autotrophicus
           Py2]
          Length = 310

 Score =  558 bits (1438), Expect = e-157,   Method: Composition-based stats.
 Identities = 209/302 (69%), Positives = 245/302 (81%), Gaps = 4/302 (1%)

Query: 6   NKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQP 65
           + + D SFQ ++LTL ++WA QGC +LQPYDMEVGAGTFHP+TTLRALGP  WKAAYVQP
Sbjct: 10  HMRPDRSFQALLLTLQRFWADQGCVVLQPYDMEVGAGTFHPATTLRALGPKPWKAAYVQP 69

Query: 66  SRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNW 125
           SRRP DGRY ENPNRLQHYYQFQVI+KP+P NLQ LY++SL+A+G+D  +HDVRFVED+W
Sbjct: 70  SRRPKDGRYGENPNRLQHYYQFQVILKPSPDNLQELYLKSLQAIGVDLGLHDVRFVEDDW 129

Query: 126 ESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVY 185
           ESPTLGAWGLGWECWCDGME+SQFTYFQQV GIEC+P+SGE+TYGLERLAMYVQ V +VY
Sbjct: 130 ESPTLGAWGLGWECWCDGMEVSQFTYFQQVAGIECAPVSGELTYGLERLAMYVQGVENVY 189

Query: 186 DIVFNAIEG-QNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           D+ FN  +G + + YGD+F Q+EQEYSR+NFE A+ E+L   F  +EK C   L      
Sbjct: 190 DLNFNGRDGAEKISYGDVFHQAEQEYSRHNFEAADTEMLLEQFRMAEKACHKYLA---FG 246

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
           +    H    PAYDQCIKASH+FNLLDARGVIS TERQ YILR+R LAKACG A+L T  
Sbjct: 247 DKGERHEMALPAYDQCIKASHVFNLLDARGVISVTERQSYILRVRELAKACGAAWLKTAA 306

Query: 305 GG 306
           GG
Sbjct: 307 GG 308


>gi|253699298|ref|YP_003020487.1| glycyl-tRNA synthetase subunit alpha [Geobacter sp. M21]
 gi|251774148|gb|ACT16729.1| glycyl-tRNA synthetase, alpha subunit [Geobacter sp. M21]
          Length = 292

 Score =  558 bits (1438), Expect = e-157,   Method: Composition-based stats.
 Identities = 176/295 (59%), Positives = 218/295 (73%), Gaps = 14/295 (4%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ +IL+L  YWA QGC I QPYD E GAGTF+P+T LR LGP  WK AYV+PSRRP
Sbjct: 1   MLTFQELILSLQGYWAGQGCVIQQPYDTEKGAGTFNPATFLRVLGPEPWKVAYVEPSRRP 60

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNRLQHYYQFQVI+KP+P+N+ +LY++SL+A GIDP  HD+RFVED+WESPT
Sbjct: 61  TDGRYGENPNRLQHYYQFQVIMKPSPMNILDLYLDSLRAFGIDPGKHDIRFVEDDWESPT 120

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W DGMEI+QFTYFQQ  GI+  P+S EITYG ER+AMY+Q V++VYD+ +
Sbjct: 121 LGAWGLGWEVWLDGMEITQFTYFQQAGGIDLKPVSSEITYGCERIAMYLQGVDNVYDLEW 180

Query: 190 NAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRH 249
                + V YGDI  +SE E+S YNFE A+ ++L   F   EKEC+ L++KG+       
Sbjct: 181 V----KGVKYGDIHHESEVEFSTYNFEEADVDMLLQLFKMYEKECVRLVEKGL------- 229

Query: 250 HLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
              V PAYD  +K SH FNLLDARG IS TER  YI ++R++A+ C E +L    
Sbjct: 230 ---VLPAYDYVMKCSHTFNLLDARGAISVTERASYIGKVRNVARLCAEGYLQMRE 281


>gi|300902751|ref|ZP_07120706.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli MS 84-1]
 gi|301304612|ref|ZP_07210721.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli MS 124-1]
 gi|300405179|gb|EFJ88717.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli MS 84-1]
 gi|300840090|gb|EFK67850.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli MS 124-1]
 gi|315254089|gb|EFU34057.1| glycyl-tRNA synthetase, alpha subunit [Escherichia coli MS 85-1]
          Length = 303

 Score =  558 bits (1438), Expect = e-157,   Method: Composition-based stats.
 Identities = 186/301 (61%), Positives = 221/301 (73%), Gaps = 8/301 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +ILTL  YWA+QGCTI+QP DMEVGAGT HP T LRALGP    AAYVQ
Sbjct: 1   MQKFDTRTFQGLILTLQDYWARQGCTIVQPLDMEVGAGTSHPMTCLRALGPEPMAAAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQV+IKP+P N+Q LY+ SLK +G+DP IHD+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVVIKPSPDNIQELYLGSLKELGMDPTIHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLERLAMY+Q V+SV
Sbjct: 121 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGLERLAMYIQGVDSV 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V++        YGD+F Q+E E S YNFEYA+ + L   F   EKE   LL    P 
Sbjct: 181 YDLVWSDGPLGKTTYGDVFHQNEVEQSTYNFEYADVDFLFTCFEQYEKEAQQLLALENP- 239

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY++ +KA+H FNLLDAR  IS TERQRYILRIR+L  A  EA+  +  
Sbjct: 240 -------LPLPAYERILKAAHSFNLLDARKAISVTERQRYILRIRTLTTAVAEAYYASRE 292

Query: 305 G 305
            
Sbjct: 293 A 293


>gi|322830760|ref|YP_004210787.1| glycyl-tRNA synthetase, subunit alpha [Rahnella sp. Y9602]
 gi|321165961|gb|ADW71660.1| glycyl-tRNA synthetase, alpha subunit [Rahnella sp. Y9602]
          Length = 332

 Score =  558 bits (1438), Expect = e-157,   Method: Composition-based stats.
 Identities = 189/300 (63%), Positives = 225/300 (75%), Gaps = 8/300 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +ILTL  YWAQQGCTI+QP DMEVGAGT HP T+LRALGP  + AAYVQ
Sbjct: 29  MQKFDTKTFQGLILTLQDYWAQQGCTIVQPLDMEVGAGTSHPMTSLRALGPEPFAAAYVQ 88

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQV+IKP+P N+Q LY+ SLK +G+DPLIHD+RFVEDN
Sbjct: 89  PSRRPTDGRYGENPNRLQHYYQFQVMIKPSPENIQELYLGSLKELGLDPLIHDIRFVEDN 148

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLERLAMY+Q V+SV
Sbjct: 149 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGLERLAMYIQGVDSV 208

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V++        YGD+F Q+E E S YNFEYA+ + L   F   EKE   LL    P 
Sbjct: 209 YDLVWSNGPLGKTTYGDVFHQNEVEQSTYNFEYADVDFLFTCFEQHEKEAQTLLALEKP- 267

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY++ +KA+H FNLLDAR  IS TERQRYILRIR+L KA  EA+  +  
Sbjct: 268 -------LALPAYERILKAAHCFNLLDARKAISVTERQRYILRIRTLTKAVAEAYYASRE 320


>gi|257465124|ref|ZP_05629495.1| glycyl-tRNA synthetase subunit alpha [Actinobacillus minor 202]
 gi|257450784|gb|EEV24827.1| glycyl-tRNA synthetase subunit alpha [Actinobacillus minor 202]
          Length = 302

 Score =  558 bits (1438), Expect = e-157,   Method: Composition-based stats.
 Identities = 183/302 (60%), Positives = 221/302 (73%), Gaps = 8/302 (2%)

Query: 4   IHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYV 63
           + +K N  +FQ +IL L  YWA QGCT++QP+DMEVGAGT HP T LRALGP     AYV
Sbjct: 1   MTSKFNVKTFQGMILALQDYWANQGCTVVQPFDMEVGAGTSHPMTCLRALGPEPMAFAYV 60

Query: 64  QPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVED 123
           QPSRRP DGRY ENPNRLQHYYQFQV+IKP+P N+Q LY++SLK +G DP  +D+RFVED
Sbjct: 61  QPSRRPTDGRYGENPNRLQHYYQFQVVIKPSPDNIQELYLDSLKMLGFDPTQNDIRFVED 120

Query: 124 NWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNS 183
           NWE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLERLAMY+Q V+S
Sbjct: 121 NWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGLERLAMYIQGVDS 180

Query: 184 VYDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIP 243
           VYD+V++        YGD+F Q+E E S YNFEYAN + L   F   EKE  +LL    P
Sbjct: 181 VYDLVWSDGPLGKTTYGDVFHQNEVEQSTYNFEYANTDFLFYCFDQYEKEAQELLALEKP 240

Query: 244 NEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTP 303
                      PAY++ +KA+H FNLLDAR  IS TERQRYILRIR+L K   EA+  + 
Sbjct: 241 --------LPLPAYERILKAAHSFNLLDARKAISVTERQRYILRIRTLTKGVAEAYYASR 292

Query: 304 NG 305
             
Sbjct: 293 EA 294


>gi|315125116|ref|YP_004067119.1| glycyl-tRNA synthetase subunit alpha [Pseudoalteromonas sp. SM9913]
 gi|315013629|gb|ADT66967.1| glycyl-tRNA synthetase subunit alpha [Pseudoalteromonas sp. SM9913]
          Length = 300

 Score =  558 bits (1438), Expect = e-157,   Method: Composition-based stats.
 Identities = 182/301 (60%), Positives = 222/301 (73%), Gaps = 10/301 (3%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +IL L  YWAQQGC I+QP DMEVGAGTFHP T L+++GP    +AYVQ
Sbjct: 1   MQKYDVKTFQGLILALQDYWAQQGCVIIQPLDMEVGAGTFHPQTFLKSIGPEPMSSAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           P RRP DGRY ENPNRLQHYYQFQV++KP+P N+Q LY+ SL A+GID L H+VRFVEDN
Sbjct: 61  PCRRPTDGRYGENPNRLQHYYQFQVVLKPSPDNIQELYLGSLAAMGIDTLTHEVRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WESPTLGAWGLGWE W +GME++QFTYFQQV G+ECSP++GEITYGLERLAMY+Q V+S+
Sbjct: 121 WESPTLGAWGLGWEIWLNGMEVTQFTYFQQVGGLECSPVTGEITYGLERLAMYIQGVDSI 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V+       V YGD+F Q+E E S YNFE+AN E L   F   E E   L++  +P 
Sbjct: 181 YDLVWADGPLGRVTYGDVFHQNEVEQSTYNFEHANVEDLFAQFDKCEAESQKLIEANLP- 239

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY+Q +KASH FNLLDAR  IS TERQRYILR+R+L+KAC +++     
Sbjct: 240 ---------LPAYEQVMKASHAFNLLDARHAISVTERQRYILRVRALSKACAQSYYDARE 290

Query: 305 G 305
            
Sbjct: 291 A 291


>gi|89092285|ref|ZP_01165239.1| glycyl-tRNA synthetase alpha subunit [Oceanospirillum sp. MED92]
 gi|89083373|gb|EAR62591.1| glycyl-tRNA synthetase alpha subunit [Oceanospirillum sp. MED92]
          Length = 319

 Score =  558 bits (1438), Expect = e-157,   Method: Composition-based stats.
 Identities = 181/293 (61%), Positives = 222/293 (75%), Gaps = 9/293 (3%)

Query: 12  SFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPLD 71
           +FQ +IL L +YWA+QGC I+QP DMEVGAGTFHP+T LRA+GP +W++AYVQPSRRP D
Sbjct: 11  TFQGLILALQEYWAEQGCVIVQPLDMEVGAGTFHPATFLRAIGPETWRSAYVQPSRRPTD 70

Query: 72  GRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTLG 131
           GRY ENPNRLQHYYQFQV++KP+P N+Q LY+ SL+ +GID  IHDVRFVEDNWESPTLG
Sbjct: 71  GRYGENPNRLQHYYQFQVVLKPSPDNIQELYLGSLERMGIDLGIHDVRFVEDNWESPTLG 130

Query: 132 AWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFN- 190
           AWGLGWE W +GME++QFTYFQQ  G+EC P++GEITYGLER+AMY+Q V+SVYD+ +  
Sbjct: 131 AWGLGWEVWLNGMEVTQFTYFQQAGGLECYPVTGEITYGLERIAMYLQGVDSVYDLTWAV 190

Query: 191 AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHH 250
             +G  V YGD+F Q+E E S +NFE+AN E L   F + E EC  LL    P       
Sbjct: 191 NPDGSKVTYGDVFHQNEVEQSTFNFEHANVEELFKTFDNCEAECNKLLSLETP------- 243

Query: 251 LCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTP 303
               PAY+Q +KASH FNLLDAR  IS TERQR+ILR+R+LA+    A+    
Sbjct: 244 -LPLPAYEQVLKASHTFNLLDARHAISVTERQRFILRVRTLAREVAHAYFNAR 295


>gi|26986806|ref|NP_742231.1| glycyl-tRNA synthetase subunit alpha [Pseudomonas putida KT2440]
 gi|148545334|ref|YP_001265436.1| glycyl-tRNA synthetase subunit alpha [Pseudomonas putida F1]
 gi|325275348|ref|ZP_08141298.1| glycyl-tRNA synthetase subunit alpha [Pseudomonas sp. TJI-51]
 gi|38258506|sp|Q88RR8|SYGA_PSEPK RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|166200564|sp|A5VWJ2|SYGA_PSEP1 RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|24981402|gb|AAN65695.1|AE016196_6 glycyl-tRNA synthetase, tetrameric type, alpha subunit [Pseudomonas
           putida KT2440]
 gi|148509392|gb|ABQ76252.1| Glycine--tRNA ligase [Pseudomonas putida F1]
 gi|313496433|gb|ADR57799.1| GlyQ [Pseudomonas putida BIRD-1]
 gi|324099519|gb|EGB97415.1| glycyl-tRNA synthetase subunit alpha [Pseudomonas sp. TJI-51]
          Length = 315

 Score =  558 bits (1438), Expect = e-157,   Method: Composition-based stats.
 Identities = 185/293 (63%), Positives = 222/293 (75%), Gaps = 10/293 (3%)

Query: 12  SFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPLD 71
           +FQ++IL L  YWA QGC +LQPYDMEVGAGTFH +T LRA+GP +W AAYVQPSRRP D
Sbjct: 10  TFQDLILALQNYWAAQGCVVLQPYDMEVGAGTFHTATFLRAVGPETWNAAYVQPSRRPAD 69

Query: 72  GRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTLG 131
           GRY ENPNRLQHYYQFQV++KPNP N Q LY+ SLKA+G+DPL+HD+RFVEDNWESPTLG
Sbjct: 70  GRYGENPNRLQHYYQFQVVLKPNPANFQELYLGSLKAIGLDPLVHDIRFVEDNWESPTLG 129

Query: 132 AWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFNA 191
           AWGLGWE W +GME++QFTYFQQV GIEC P++GEITYGLERLAMY+Q V+SVYD+V+  
Sbjct: 130 AWGLGWEIWLNGMEVTQFTYFQQVGGIECYPVTGEITYGLERLAMYIQGVDSVYDLVWAD 189

Query: 192 IEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHHL 251
                V YGD+F Q+E E S YNFE+AN + L   F   E E   L+K  +P        
Sbjct: 190 GPFGKVTYGDVFHQNEVEQSTYNFEHANVDKLFELFDFYESEANRLIKLELP-------- 241

Query: 252 CVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
              P Y+  +KASH FNLLDAR  IS TERQRYILR+R+LA+   +++L    
Sbjct: 242 --LPTYEMVLKASHTFNLLDARRAISVTERQRYILRVRTLARDVAQSYLQARA 292


>gi|170719267|ref|YP_001746955.1| glycyl-tRNA synthetase subunit alpha [Pseudomonas putida W619]
 gi|229558518|sp|B1J426|SYGA_PSEPW RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|169757270|gb|ACA70586.1| glycyl-tRNA synthetase, alpha subunit [Pseudomonas putida W619]
          Length = 315

 Score =  558 bits (1438), Expect = e-157,   Method: Composition-based stats.
 Identities = 186/293 (63%), Positives = 222/293 (75%), Gaps = 10/293 (3%)

Query: 12  SFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPLD 71
           +FQ++IL L  YWA QGC +LQPYDMEVGAGTFH +T LRA+GP +W AAYVQPSRRP D
Sbjct: 10  TFQDLILALQNYWAAQGCVVLQPYDMEVGAGTFHTATFLRAVGPETWNAAYVQPSRRPAD 69

Query: 72  GRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTLG 131
           GRY ENPNRLQHYYQFQV++KPNP N Q LY+ SLKA+G+DPL+HD+RFVEDNWESPTLG
Sbjct: 70  GRYGENPNRLQHYYQFQVVLKPNPANFQELYLGSLKAIGLDPLVHDIRFVEDNWESPTLG 129

Query: 132 AWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFNA 191
           AWGLGWE W +GME++QFTYFQQV GIEC P++GEITYGLERLAMY+Q V+SVYD+V+  
Sbjct: 130 AWGLGWEIWLNGMEVTQFTYFQQVGGIECYPVTGEITYGLERLAMYIQGVDSVYDLVWAD 189

Query: 192 IEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHHL 251
                V YGD+F Q+E E S YNFE+AN E L   F   E E   L+K  +P        
Sbjct: 190 GPFGKVTYGDVFHQNEVEQSTYNFEHANVEKLFELFDFYESEANRLIKLDLP-------- 241

Query: 252 CVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
              P Y+  +KASH FNLLDAR  IS TERQRYILR+R+LA+   +++L    
Sbjct: 242 --LPTYEMVLKASHTFNLLDARRAISVTERQRYILRVRTLARDVAQSYLQARA 292


>gi|322421193|ref|YP_004200416.1| glycyl-tRNA synthetase subunit alpha [Geobacter sp. M18]
 gi|320127580|gb|ADW15140.1| glycyl-tRNA synthetase, alpha subunit [Geobacter sp. M18]
          Length = 292

 Score =  557 bits (1437), Expect = e-157,   Method: Composition-based stats.
 Identities = 176/295 (59%), Positives = 219/295 (74%), Gaps = 14/295 (4%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ++IL+L  YWA QGC I QPYD E GAGTF+P+T LR LGP  WK AYV+PSRRP
Sbjct: 1   MLTFQDLILSLQGYWAGQGCVIQQPYDTEKGAGTFNPATFLRVLGPEPWKVAYVEPSRRP 60

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNRLQHYYQFQVI+KP+P+N+ +LY++SL+A GIDP  HD+RFVED+WESPT
Sbjct: 61  TDGRYGENPNRLQHYYQFQVIMKPSPMNILDLYLDSLRAFGIDPNKHDIRFVEDDWESPT 120

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W DGMEI+QFTYFQQ  GI+  P+S EITYG ER+AMY+Q V++VYD+ +
Sbjct: 121 LGAWGLGWEVWLDGMEITQFTYFQQAGGIDLKPVSAEITYGCERIAMYLQGVDNVYDLEW 180

Query: 190 NAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRH 249
                + V YGDI  +SE E+S YNFE A+ ++L   F   EKEC+ L++KG+       
Sbjct: 181 V----KGVRYGDIHHESEVEFSTYNFEEADVDMLLTLFKMYEKECVRLVEKGL------- 229

Query: 250 HLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
              V PAYD  +K SH FNLLDARG IS TER  YI ++R++A+ C E +L    
Sbjct: 230 ---VLPAYDYVMKCSHTFNLLDARGAISVTERASYIGKVRNVARLCAEGYLQMRE 281


>gi|68249514|ref|YP_248626.1| glycyl-tRNA synthetase subunit alpha [Haemophilus influenzae
           86-028NP]
 gi|145630019|ref|ZP_01785801.1| glycyl-tRNA synthetase alpha subunit [Haemophilus influenzae R3021]
 gi|145638251|ref|ZP_01793861.1| glycyl-tRNA synthetase alpha subunit [Haemophilus influenzae
           PittII]
 gi|260581761|ref|ZP_05849558.1| glycyl-tRNA synthetase, alpha subunit [Haemophilus influenzae
           NT127]
 gi|319775138|ref|YP_004137626.1| glycine tRNA synthetase subunit alpha [Haemophilus influenzae
           F3047]
 gi|319897582|ref|YP_004135779.1| glycine tRNA synthetase, alpha subunit [Haemophilus influenzae
           F3031]
 gi|329122948|ref|ZP_08251519.1| glycyl-tRNA synthetase alpha subunit [Haemophilus aegyptius ATCC
           11116]
 gi|81336059|sp|Q4QLY1|SYGA_HAEI8 RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|68057713|gb|AAX87966.1| glycyl-tRNA synthetase alpha chain [Haemophilus influenzae
           86-028NP]
 gi|144984300|gb|EDJ91723.1| glycyl-tRNA synthetase alpha subunit [Haemophilus influenzae R3021]
 gi|145272580|gb|EDK12487.1| glycyl-tRNA synthetase alpha subunit [Haemophilus influenzae
           PittII]
 gi|260095354|gb|EEW79245.1| glycyl-tRNA synthetase, alpha subunit [Haemophilus influenzae
           NT127]
 gi|309751406|gb|ADO81390.1| Glycyl-tRNA synthetase, alpha subunit [Haemophilus influenzae
           R2866]
 gi|317433088|emb|CBY81462.1| glycine tRNA synthetase, alpha subunit [Haemophilus influenzae
           F3031]
 gi|317449729|emb|CBY85936.1| glycine tRNA synthetase, alpha subunit [Haemophilus influenzae
           F3047]
 gi|327471879|gb|EGF17319.1| glycyl-tRNA synthetase alpha subunit [Haemophilus aegyptius ATCC
           11116]
          Length = 302

 Score =  557 bits (1437), Expect = e-157,   Method: Composition-based stats.
 Identities = 181/302 (59%), Positives = 220/302 (72%), Gaps = 8/302 (2%)

Query: 4   IHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYV 63
           +  K N  +FQ +IL L +YWA QGCTI+QP+DMEVGAGT HP T LRALGP     AYV
Sbjct: 1   MSTKFNVKTFQGMILALQEYWANQGCTIVQPFDMEVGAGTSHPMTALRALGPEPMAFAYV 60

Query: 64  QPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVED 123
           QPSRRP DGRY ENPNRLQHYYQFQV+IKP+P N+Q LY+ SL+ +G DP  +D+RFVED
Sbjct: 61  QPSRRPTDGRYGENPNRLQHYYQFQVVIKPSPDNIQELYLGSLEMLGFDPTQNDIRFVED 120

Query: 124 NWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNS 183
           NWE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GE+TYGLERLAMY+Q V+S
Sbjct: 121 NWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEVTYGLERLAMYIQGVDS 180

Query: 184 VYDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIP 243
           VYD+V++        YGD+F Q+E E S YNFE+AN + L   F   EKE  +LL    P
Sbjct: 181 VYDLVWSDGPLGKTTYGDVFHQNEVEQSTYNFEHANTDFLFYCFDQYEKEAQELLALEKP 240

Query: 244 NEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTP 303
                      PAY++ +KA+H FNLLDAR  IS TERQRYILRIR+L K   EA+  + 
Sbjct: 241 --------LPLPAYERILKAAHSFNLLDARKAISVTERQRYILRIRALTKGVAEAYYASR 292

Query: 304 NG 305
             
Sbjct: 293 EA 294


>gi|192358918|ref|YP_001980581.1| glycyl-tRNA synthetase subunit alpha [Cellvibrio japonicus Ueda107]
 gi|190685083|gb|ACE82761.1| glycyl-tRNA synthetase, alpha subunit [Cellvibrio japonicus
           Ueda107]
          Length = 323

 Score =  557 bits (1437), Expect = e-157,   Method: Composition-based stats.
 Identities = 173/301 (57%), Positives = 222/301 (73%), Gaps = 11/301 (3%)

Query: 4   IHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYV 63
              + +  +FQ +IL L  YWA+QGC ILQP D+EVGAGTFHP+T LRA+GP +W  AYV
Sbjct: 2   TEKRYDVSTFQGLILALQDYWARQGCVILQPLDLEVGAGTFHPATFLRAIGPETWNTAYV 61

Query: 64  QPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVED 123
           QP RRP DGRY ENPNRLQHYYQFQV +KP+P N+Q LY+ SL+ +GID  +HD+RFVED
Sbjct: 62  QPCRRPKDGRYGENPNRLQHYYQFQVALKPSPDNIQELYLGSLREMGIDTSVHDIRFVED 121

Query: 124 NWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNS 183
           NWESPTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYG+ER+AMY+Q V+S
Sbjct: 122 NWESPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECYPVTGEITYGIERIAMYLQGVDS 181

Query: 184 VYDIVFN-AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGI 242
           ++D+V+     G  V YGD+F Q+E E S +NFE A+ + L   F   E+E   L+ + +
Sbjct: 182 IFDLVWTINPNGDKVTYGDVFHQNEVEMSTFNFEEADTDYLFKSFDFYERESTRLMARNL 241

Query: 243 PNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMT 302
           P           PAY+  +KASH FNLLDAR  IS TERQR+ILR+R+LA+A  +A+  +
Sbjct: 242 P----------LPAYEMVMKASHAFNLLDARHAISVTERQRFILRVRTLARAVAQAYFDS 291

Query: 303 P 303
            
Sbjct: 292 R 292


>gi|148826421|ref|YP_001291174.1| glycyl-tRNA synthetase subunit alpha [Haemophilus influenzae
           PittEE]
 gi|229845986|ref|ZP_04466098.1| glycyl-tRNA synthetase subunit alpha [Haemophilus influenzae
           7P49H1]
 gi|166200224|sp|A5UDE0|SYGA_HAEIE RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|148716581|gb|ABQ98791.1| glycyl-tRNA synthetase alpha subunit [Haemophilus influenzae
           PittEE]
 gi|229810990|gb|EEP46707.1| glycyl-tRNA synthetase subunit alpha [Haemophilus influenzae
           7P49H1]
          Length = 302

 Score =  557 bits (1437), Expect = e-157,   Method: Composition-based stats.
 Identities = 181/302 (59%), Positives = 221/302 (73%), Gaps = 8/302 (2%)

Query: 4   IHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYV 63
           ++ K N  +FQ +IL L +YWA QGCTI+QP+DMEVGAGT HP T LRALGP     AYV
Sbjct: 1   MNTKFNVKTFQGMILALQEYWANQGCTIVQPFDMEVGAGTSHPMTALRALGPEPMAFAYV 60

Query: 64  QPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVED 123
           QPSRRP DGRY ENPNRLQHYYQFQV+IKP+P N+Q LY+ SL+ +G DP  +D+RFVED
Sbjct: 61  QPSRRPTDGRYGENPNRLQHYYQFQVVIKPSPDNIQELYLGSLEMLGFDPTQNDIRFVED 120

Query: 124 NWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNS 183
           NWE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GE+TYGLERLAMY+Q V+S
Sbjct: 121 NWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEVTYGLERLAMYIQGVDS 180

Query: 184 VYDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIP 243
           VYD+V++        YGD+F Q+E E S YNFE+AN + L   F   EKE  +LL    P
Sbjct: 181 VYDLVWSDGPLGKTTYGDVFHQNEVEQSTYNFEHANTDFLFYCFDQYEKEAQELLALEKP 240

Query: 244 NEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTP 303
                      PAY++ +KA+H FNLLDAR  IS TERQRYILRIR+L K   EA+  + 
Sbjct: 241 --------LPLPAYERILKAAHSFNLLDARKAISVTERQRYILRIRALTKGVAEAYYASR 292

Query: 304 NG 305
             
Sbjct: 293 EA 294


>gi|240948888|ref|ZP_04753244.1| glycyl-tRNA synthetase subunit alpha [Actinobacillus minor NM305]
 gi|240296703|gb|EER47314.1| glycyl-tRNA synthetase subunit alpha [Actinobacillus minor NM305]
          Length = 302

 Score =  557 bits (1436), Expect = e-157,   Method: Composition-based stats.
 Identities = 183/302 (60%), Positives = 220/302 (72%), Gaps = 8/302 (2%)

Query: 4   IHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYV 63
           +  K N  +FQ +IL L  YWA QGCT++QP+DMEVGAGT HP T LRALGP     AYV
Sbjct: 1   MTAKFNVKTFQGMILALQDYWANQGCTVVQPFDMEVGAGTSHPMTCLRALGPEPMAFAYV 60

Query: 64  QPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVED 123
           QPSRRP DGRY ENPNRLQHYYQFQV+IKP+P N+Q LY++SLK +G DP  +D+RFVED
Sbjct: 61  QPSRRPTDGRYGENPNRLQHYYQFQVVIKPSPDNIQELYLDSLKMLGFDPTQNDIRFVED 120

Query: 124 NWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNS 183
           NWE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLERLAMY+Q V+S
Sbjct: 121 NWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGLERLAMYIQGVDS 180

Query: 184 VYDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIP 243
           VYD+V++        YGD+F Q+E E S YNFEYAN + L   F   EKE  +LL    P
Sbjct: 181 VYDLVWSDGPLGKTTYGDVFHQNEVEQSTYNFEYANTDFLFYCFDQYEKEAQELLALEKP 240

Query: 244 NEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTP 303
                      PAY++ +KA+H FNLLDAR  IS TERQRYILRIR+L K   EA+  + 
Sbjct: 241 --------LPLPAYERILKAAHSFNLLDARKAISVTERQRYILRIRTLTKGVAEAYYASR 292

Query: 304 NG 305
             
Sbjct: 293 EA 294


>gi|145636928|ref|ZP_01792592.1| glycyl-tRNA synthetase alpha subunit [Haemophilus influenzae
           PittHH]
 gi|145269786|gb|EDK09725.1| glycyl-tRNA synthetase alpha subunit [Haemophilus influenzae
           PittHH]
          Length = 302

 Score =  557 bits (1436), Expect = e-157,   Method: Composition-based stats.
 Identities = 181/302 (59%), Positives = 220/302 (72%), Gaps = 8/302 (2%)

Query: 4   IHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYV 63
           +  K N  +FQ +IL L +YWA QGCTI+QP+DMEVGAGT HP T LRALGP     AYV
Sbjct: 1   MSTKFNVKTFQGMILALQEYWATQGCTIVQPFDMEVGAGTSHPMTALRALGPEPMAFAYV 60

Query: 64  QPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVED 123
           QPSRRP DGRY ENPNRLQHYYQFQV+IKP+P N+Q LY+ SL+ +G DP  +D+RFVED
Sbjct: 61  QPSRRPTDGRYGENPNRLQHYYQFQVVIKPSPDNIQELYLGSLEMLGFDPTQNDIRFVED 120

Query: 124 NWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNS 183
           NWE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GE+TYGLERLAMY+Q V+S
Sbjct: 121 NWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEVTYGLERLAMYIQGVDS 180

Query: 184 VYDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIP 243
           VYD+V++        YGD+F Q+E E S YNFE+AN + L   F   EKE  +LL    P
Sbjct: 181 VYDLVWSDGPLGKTTYGDVFHQNEVEQSTYNFEHANTDFLFYCFDQYEKEAQELLALEKP 240

Query: 244 NEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTP 303
                      PAY++ +KA+H FNLLDAR  IS TERQRYILRIR+L K   EA+  + 
Sbjct: 241 --------LPLPAYERILKAAHSFNLLDARKAISVTERQRYILRIRALTKGVAEAYYASR 292

Query: 304 NG 305
             
Sbjct: 293 EA 294


>gi|167854806|ref|ZP_02477584.1| glycyl-tRNA synthetase alpha subunit [Haemophilus parasuis 29755]
 gi|219871681|ref|YP_002476056.1| glycyl-tRNA synthetase subunit alpha [Haemophilus parasuis SH0165]
 gi|254781826|sp|B8F706|SYGA_HAEPS RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|167854104|gb|EDS25340.1| glycyl-tRNA synthetase alpha subunit [Haemophilus parasuis 29755]
 gi|219691885|gb|ACL33108.1| glycyl-tRNA synthetase subunit alpha [Haemophilus parasuis SH0165]
          Length = 301

 Score =  557 bits (1436), Expect = e-157,   Method: Composition-based stats.
 Identities = 183/302 (60%), Positives = 220/302 (72%), Gaps = 8/302 (2%)

Query: 4   IHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYV 63
           +  K N  +FQ +IL L  YWA QGCT++QP+DMEVGAGT HP T LRALGP     AYV
Sbjct: 1   MTAKFNVKTFQGMILALQDYWANQGCTVVQPFDMEVGAGTSHPMTCLRALGPEPMAFAYV 60

Query: 64  QPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVED 123
           QPSRRP DGRY ENPNRLQHYYQFQV+IKP+P N+Q LY++SLK +G DP  +D+RFVED
Sbjct: 61  QPSRRPTDGRYGENPNRLQHYYQFQVVIKPSPDNIQELYLDSLKMLGFDPTQNDIRFVED 120

Query: 124 NWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNS 183
           NWE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLERLAMY+Q V+S
Sbjct: 121 NWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGLERLAMYIQGVDS 180

Query: 184 VYDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIP 243
           VYD+V++        YGD+F Q+E E S YNFEYAN + L   F   EKE  +LL    P
Sbjct: 181 VYDLVWSDGPLGKTTYGDVFHQNEVEQSTYNFEYANTDFLFYCFDQYEKEAQELLALEKP 240

Query: 244 NEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTP 303
                      PAY++ +KA+H FNLLDAR  IS TERQRYILRIR+L K   EA+  + 
Sbjct: 241 --------LPLPAYERILKAAHSFNLLDARKAISVTERQRYILRIRTLTKGVAEAYYASR 292

Query: 304 NG 305
             
Sbjct: 293 EA 294


>gi|326560539|gb|EGE10920.1| glycyl-tRNA synthetase subunit alpha [Moraxella catarrhalis
           103P14B1]
 gi|326574911|gb|EGE24841.1| glycyl-tRNA synthetase subunit alpha [Moraxella catarrhalis
           101P30B1]
 gi|326576239|gb|EGE26154.1| glycyl-tRNA synthetase subunit alpha [Moraxella catarrhalis CO72]
          Length = 318

 Score =  557 bits (1436), Expect = e-157,   Method: Composition-based stats.
 Identities = 184/300 (61%), Positives = 221/300 (73%), Gaps = 10/300 (3%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
            +    L+FQ +ILTL  YWA +GC +LQPYDMEVGAGTFH +T LRAL P  W AAYVQ
Sbjct: 1   MDSGKTLTFQALILTLQNYWASRGCVVLQPYDMEVGAGTFHTATFLRALTPERWNAAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY +NPNRLQHYYQFQV++KPNP N+Q LY+ SLKA+GID L HDVRFVEDN
Sbjct: 61  PSRRPTDGRYGDNPNRLQHYYQFQVVLKPNPANIQELYLGSLKAIGIDTLTHDVRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WESPTLGAWGLGWE W +GME++QFTYFQQV GIEC P++GEITYGLERLAMY+Q V+SV
Sbjct: 121 WESPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGIECFPVTGEITYGLERLAMYIQGVDSV 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V+   E   V YGD+F Q+E E S YNFE+A+   L   F   E++   L+   +P 
Sbjct: 181 YDLVWADGEFGRVTYGDVFHQNEVEQSAYNFEHADVAKLFELFDFYEEQADKLVAVNLP- 239

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY+  +KASH FNLLDARG IS TERQR+ILR+R+LA+    ++     
Sbjct: 240 ---------LPAYEMVLKASHAFNLLDARGAISVTERQRFILRVRTLARKVAISYTEARA 290


>gi|298293952|ref|YP_003695891.1| glycyl-tRNA synthetase, subunit alpha [Starkeya novella DSM 506]
 gi|296930463|gb|ADH91272.1| glycyl-tRNA synthetase, alpha subunit [Starkeya novella DSM 506]
          Length = 315

 Score =  557 bits (1436), Expect = e-157,   Method: Composition-based stats.
 Identities = 207/303 (68%), Positives = 244/303 (80%), Gaps = 2/303 (0%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
            + + D SFQ +IL L  +WA +GC +LQPYDMEVGAGTFHP+TTLRALGPL WKAAYVQ
Sbjct: 8   PHMRPDKSFQGLILALHAFWADKGCVVLQPYDMEVGAGTFHPATTLRALGPLPWKAAYVQ 67

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQ+QVI+KP+P +LQ+LY+ SL A+GID  +HDVRFVED+
Sbjct: 68  PSRRPKDGRYGENPNRLQHYYQYQVILKPSPADLQDLYLASLDAIGIDLRLHDVRFVEDD 127

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WESPTLGAWGLGWECWCDGME+SQFTYFQQV G EC+P++GE+TYGLERLAMYVQ V +V
Sbjct: 128 WESPTLGAWGLGWECWCDGMEVSQFTYFQQVAGFECAPVAGELTYGLERLAMYVQGVENV 187

Query: 185 YDIVFNAIEG-QNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIP 243
           YD+ FN  EG + V YGD+F Q+EQEYSR+NFE+A+ ++L   F  +E      L+ G  
Sbjct: 188 YDLNFNGREGAEKVTYGDVFLQAEQEYSRHNFEHADTDMLFEQFRMAESAAAKYLEAGWA 247

Query: 244 NEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTP 303
           +     HL   PAYDQCIKASH+FNLLDARGVIS TERQ YILR+R LAKACG A+L T 
Sbjct: 248 D-DRARHLMAQPAYDQCIKASHVFNLLDARGVISVTERQSYILRVRELAKACGAAWLATA 306

Query: 304 NGG 306
            GG
Sbjct: 307 AGG 309


>gi|56459118|ref|YP_154399.1| glycyl-tRNA synthetase subunit alpha [Idiomarina loihiensis L2TR]
 gi|56178128|gb|AAV80850.1| Glycyl-tRNA synthetase, alpha subunit [Idiomarina loihiensis L2TR]
          Length = 308

 Score =  557 bits (1436), Expect = e-157,   Method: Composition-based stats.
 Identities = 181/294 (61%), Positives = 220/294 (74%), Gaps = 10/294 (3%)

Query: 12  SFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPLD 71
           +FQ +IL L  YWAQQGC ++QP DMEVGAGTFHP T LR+LGP     AYVQP RRP D
Sbjct: 10  TFQGLILALQDYWAQQGCAVVQPLDMEVGAGTFHPMTFLRSLGPEPASFAYVQPCRRPTD 69

Query: 72  GRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTLG 131
           GRY ENPNRLQHYYQFQVI+KP+P ++Q LY+ SL+ +G D L HD+RFVEDNWESPTLG
Sbjct: 70  GRYGENPNRLQHYYQFQVIMKPSPKDIQELYLGSLEMLGFDTLTHDIRFVEDNWESPTLG 129

Query: 132 AWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFNA 191
           AWGLGWE W +GME++QFTYFQQV GIEC P++GEITYGLERLAMY+Q V+S+YD+V+  
Sbjct: 130 AWGLGWEVWLNGMEVTQFTYFQQVGGIECRPVAGEITYGLERLAMYIQGVDSIYDLVWTD 189

Query: 192 IEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHHL 251
                +LY D+F Q+E E S YNFEYA+ ++L   F D EKEC  L++K +         
Sbjct: 190 GPRGKILYRDVFHQNEVEQSTYNFEYADVDVLFRRFDDCEKECELLIEKSL--------- 240

Query: 252 CVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNG 305
              PAY+Q ++ASH FNLLDAR  IS TERQRYILR+R++AKA  E +  T   
Sbjct: 241 -ALPAYEQVMRASHAFNLLDARHAISVTERQRYILRVRTMAKAVAEVYYQTREA 293


>gi|15602963|ref|NP_246035.1| glycyl-tRNA synthetase subunit alpha [Pasteurella multocida subsp.
           multocida str. Pm70]
 gi|13431895|sp|P57904|SYGA_PASMU RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|12721440|gb|AAK03182.1| GlyQ [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 300

 Score =  557 bits (1436), Expect = e-157,   Method: Composition-based stats.
 Identities = 183/301 (60%), Positives = 219/301 (72%), Gaps = 8/301 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K N  +FQ +IL L  YWA QGC I+QP+DMEVGAGT HP T L+ALGP    AAYVQ
Sbjct: 1   MTKFNVKTFQGMILALQDYWANQGCVIVQPFDMEVGAGTSHPMTCLKALGPEPMAAAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQV+IKP+P N+Q LY++SLK +G DP  +D+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVVIKPSPDNIQELYLDSLKMLGFDPTQNDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLERLAMY+Q V+SV
Sbjct: 121 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGLERLAMYIQGVDSV 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V++        YGD+F Q+E E S YNFEYAN + L   F   EKE  +LL    P 
Sbjct: 181 YDLVWSDGPLGKTTYGDVFHQNEVEQSTYNFEYANTDFLFYCFDQYEKEASELLALEKP- 239

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY++ +KA+H FNLLDAR  IS TERQRYILRIR+L K   EA+  +  
Sbjct: 240 -------LPLPAYERILKAAHSFNLLDARKAISVTERQRYILRIRALTKGVAEAYYASRE 292

Query: 305 G 305
            
Sbjct: 293 A 293


>gi|319407553|emb|CBI81203.1| glycyl-tRNA synthetase alpha chain [Bartonella sp. 1-1C]
          Length = 314

 Score =  556 bits (1435), Expect = e-156,   Method: Composition-based stats.
 Identities = 218/306 (71%), Positives = 256/306 (83%), Gaps = 1/306 (0%)

Query: 1   MAPIHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKA 60
           M    N     SFQ +IL+L  YWAQ GC ILQPYDMEVGAGTFHP+TTLR+LGP  WKA
Sbjct: 1   MNLPSNLNPKRSFQGLILSLQNYWAQHGCAILQPYDMEVGAGTFHPATTLRSLGPRPWKA 60

Query: 61  AYVQPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRF 120
           AYVQP+RRP DGRY  NPNRLQHYYQFQV++KP+P NLQ LYI SL+A+G+D  +HD+RF
Sbjct: 61  AYVQPTRRPTDGRYGTNPNRLQHYYQFQVLLKPSPPNLQELYIGSLQAIGLDTTLHDIRF 120

Query: 121 VEDNWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQN 180
           VED+WESPTLGAWGLGWECWCDGME+SQFTYFQQVCGIEC+P+SGEITYGLERLAMY+Q+
Sbjct: 121 VEDDWESPTLGAWGLGWECWCDGMEVSQFTYFQQVCGIECAPVSGEITYGLERLAMYIQD 180

Query: 181 VNSVYDIVFNAIEG-QNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLK 239
           V++VY++ FN ++G   + YGD+F Q+EQEYS YNFE+AN ++L  HFID+E+EC  LL 
Sbjct: 181 VSNVYNLNFNGLDGADRISYGDVFLQAEQEYSHYNFEFANTDLLQQHFIDAERECTALLD 240

Query: 240 KGIPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAF 299
            G PN+ +  HLCVFPAYDQCIKASHIFNLL ARGVIS TERQ YILR+R LA+ CGEAF
Sbjct: 241 AGKPNKENNFHLCVFPAYDQCIKASHIFNLLQARGVISVTERQNYILRVRDLARRCGEAF 300

Query: 300 LMTPNG 305
           L+T  G
Sbjct: 301 LLTEAG 306


>gi|332991515|gb|AEF01570.1| glycyl-tRNA synthetase subunit alpha [Alteromonas sp. SN2]
          Length = 301

 Score =  556 bits (1435), Expect = e-156,   Method: Composition-based stats.
 Identities = 184/301 (61%), Positives = 222/301 (73%), Gaps = 10/301 (3%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +IL L  YWA+QGC I+QP DMEVGAGTFHP T LR+LGP    +AYVQ
Sbjct: 1   MQKYDINTFQGLILALQDYWARQGCVIIQPLDMEVGAGTFHPMTFLRSLGPEPMSSAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
             RRP DGRY ENPNRLQHYYQFQV++KP+P N+Q LY+ SLK +G DPL+HD+RFVEDN
Sbjct: 61  TCRRPTDGRYGENPNRLQHYYQFQVMLKPSPDNIQELYLGSLKELGFDPLVHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WESPTLGAWGLGWE W +GME++QFTYFQQV GIEC P++GEITYGLERLAMYVQ V+S+
Sbjct: 121 WESPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGIECKPVTGEITYGLERLAMYVQGVDSI 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V+       V YGD+F Q+E E S YNFEYAN + L   F + E     L++K +P 
Sbjct: 181 YDLVWADGPMGKVTYGDVFHQNEVEQSTYNFEYANVDALFRTFDECEAASQLLIEKNLP- 239

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY+Q +KASH FN+LDAR  IS TERQRYILR+R+LAKAC E++     
Sbjct: 240 ---------LPAYEQVMKASHAFNMLDARHAISVTERQRYILRVRTLAKACAESYFQKRE 290

Query: 305 G 305
            
Sbjct: 291 A 291


>gi|167621948|ref|YP_001672242.1| glycyl-tRNA synthetase subunit alpha [Shewanella halifaxensis
           HAW-EB4]
 gi|189082262|sp|B0TLB0|SYGA_SHEHH RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|167351970|gb|ABZ74583.1| glycyl-tRNA synthetase, alpha subunit [Shewanella halifaxensis
           HAW-EB4]
          Length = 301

 Score =  556 bits (1435), Expect = e-156,   Method: Composition-based stats.
 Identities = 185/302 (61%), Positives = 224/302 (74%), Gaps = 8/302 (2%)

Query: 4   IHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYV 63
           +  K +  +FQ  I+TL +YWAQQGC I+QP DMEVGAGTFHP T LR+LGP    +AYV
Sbjct: 1   MTTKHDVKTFQGFIMTLQEYWAQQGCAIVQPLDMEVGAGTFHPMTFLRSLGPEPMSSAYV 60

Query: 64  QPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVED 123
           QPSRRP DGRY ENPNRLQHYYQFQV++KP+P N+Q LY+ SL+A+G+D  +HDVRFVED
Sbjct: 61  QPSRRPTDGRYGENPNRLQHYYQFQVVLKPSPSNMQELYLGSLEALGVDMNVHDVRFVED 120

Query: 124 NWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNS 183
           NWESPTLGAWGLGWE W +GME+SQFTYFQQV G+EC P++GEITYGLERLAMY+Q V+S
Sbjct: 121 NWESPTLGAWGLGWEIWLNGMEVSQFTYFQQVGGLECKPVTGEITYGLERLAMYIQEVDS 180

Query: 184 VYDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIP 243
           VYD+V+       V+YGDIF Q+E E S YNFE+A+ ++    F D E+ C  LL    P
Sbjct: 181 VYDLVWTDGPLGKVMYGDIFHQNEVEQSTYNFEHADVDVQFKMFDDCEQACQRLLALEKP 240

Query: 244 NEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTP 303
                      PAY+Q +KASH FNLLDAR  IS TERQRYILR+R++AK   EA+    
Sbjct: 241 --------LPLPAYEQVMKASHAFNLLDARHAISVTERQRYILRVRTMAKGVAEAYYQAR 292

Query: 304 NG 305
             
Sbjct: 293 EA 294


>gi|254463416|ref|ZP_05076832.1| glycyl-tRNA synthetase, alpha subunit [Rhodobacterales bacterium
           HTCC2083]
 gi|206680005|gb|EDZ44492.1| glycyl-tRNA synthetase, alpha subunit [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 332

 Score =  556 bits (1435), Expect = e-156,   Method: Composition-based stats.
 Identities = 193/308 (62%), Positives = 242/308 (78%), Gaps = 2/308 (0%)

Query: 2   APIHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAA 61
           A + N +   SFQ+IIL L  YWA QGC ++QPYDMEVGAGTFHP+TTLR+LG   W AA
Sbjct: 23  ATVMNSEKPKSFQDIILRLQSYWATQGCAVMQPYDMEVGAGTFHPATTLRSLGSKPWAAA 82

Query: 62  YVQPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFV 121
           YVQPSRRP DGRY ENPNRLQHYYQ+QV+IKP+P +LQ LY+ SL+A+G+D  +HD+RFV
Sbjct: 83  YVQPSRRPTDGRYGENPNRLQHYYQYQVVIKPSPPDLQALYLGSLEAIGVDMEMHDLRFV 142

Query: 122 EDNWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNV 181
           ED+WESPTLGAWGLGWE WCDGME+SQFTYFQQV G +C+P++GE+TYGLERLAMY+ N 
Sbjct: 143 EDDWESPTLGAWGLGWEVWCDGMEVSQFTYFQQVGGHDCAPVAGELTYGLERLAMYILNC 202

Query: 182 NSVYDIVFNAIEGQ-NVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLK- 239
           + V D+ +N  +    + YGD+F Q+E+EY+R+NF+ AN ++L  HF ++E EC ++L  
Sbjct: 203 DHVMDMPYNDPQSPIPLSYGDVFKQTEEEYARWNFDVANTDVLLRHFEEAEAECANILDQ 262

Query: 240 KGIPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAF 299
                +  +  +   PAYDQCIKASHIFNLLDARGVIS TERQ YI R+R+LAKAC +AF
Sbjct: 263 AHDDPKTGKRIIMAHPAYDQCIKASHIFNLLDARGVISVTERQAYIGRVRTLAKACADAF 322

Query: 300 LMTPNGGH 307
           + T  GGH
Sbjct: 323 VQTSAGGH 330


>gi|146222|gb|AAA23914.1| glycyl-tRNA synthetase alpha subunit [Escherichia coli]
          Length = 303

 Score =  556 bits (1435), Expect = e-156,   Method: Composition-based stats.
 Identities = 186/301 (61%), Positives = 221/301 (73%), Gaps = 8/301 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +ILTL  YWA+QGCTI+QP DMEVGAGT HP T LRALGP    AAYVQ
Sbjct: 1   MQKFDTRTFQGLILTLQDYWARQGCTIVQPLDMEVGAGTSHPMTCLRALGPEPMAAAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRR  DGRY ENPNRLQHYYQFQV+IKP+P N+Q LY+ SLK +G+DP IHD+RFVEDN
Sbjct: 61  PSRRATDGRYGENPNRLQHYYQFQVVIKPSPDNIQELYLGSLKELGMDPTIHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLERLAMY+Q V+SV
Sbjct: 121 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGLERLAMYIQGVDSV 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V++        YGD+F Q+E E S YNFEYA+ + L   F   EKE   LL    P 
Sbjct: 181 YDLVWSDGPLGKTTYGDVFHQNEVEQSTYNFEYADVDFLFTCFEQYEKEAQQLLALENP- 239

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY++ +KA+H FNLLDAR  IS TERQRYILRIR+L KA  EA+  +  
Sbjct: 240 -------LPLPAYERILKAAHSFNLLDARKAISVTERQRYILRIRTLTKAVAEAYYASRE 292

Query: 305 G 305
            
Sbjct: 293 A 293


>gi|126735417|ref|ZP_01751163.1| glycyl-tRNA synthetase subunit alpha [Roseobacter sp. CCS2]
 gi|126715972|gb|EBA12837.1| glycyl-tRNA synthetase subunit alpha [Roseobacter sp. CCS2]
          Length = 306

 Score =  556 bits (1435), Expect = e-156,   Method: Composition-based stats.
 Identities = 194/301 (64%), Positives = 234/301 (77%), Gaps = 2/301 (0%)

Query: 8   KNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSR 67
               SFQ+IIL L  YWA +GC ILQPYDMEVGAGTFHP+TTLRALG   W AAYVQP R
Sbjct: 3   DKPRSFQDIILRLQTYWAAKGCAILQPYDMEVGAGTFHPATTLRALGSKPWAAAYVQPCR 62

Query: 68  RPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWES 127
           RP DGRY ENPNRLQHYYQ+QV++KP+P ++Q+LY+ SL+A+G+D   HD+RFVED+WES
Sbjct: 63  RPTDGRYGENPNRLQHYYQYQVLMKPSPPDMQDLYLGSLEAIGVDASAHDIRFVEDDWES 122

Query: 128 PTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDI 187
           PTLGAWGLGWE WCDGME+SQFTYFQQV G +C P+SGE+TYGLERLA+Y+  V+ V D+
Sbjct: 123 PTLGAWGLGWEVWCDGMEVSQFTYFQQVGGHDCKPVSGELTYGLERLAIYILGVDHVMDM 182

Query: 188 VFNAIEGQ-NVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEH 246
            FN  +    + YGDIF Q+EQEYSR+NF+ A  E+L  HF+D+E EC  +L     +  
Sbjct: 183 PFNDPQTPIPLTYGDIFKQTEQEYSRWNFDIAETEVLLQHFVDAEAECQRILDAPADDPK 242

Query: 247 -HRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNG 305
             R  +   PAYDQCIKASH+FNLLDARGVIS TERQ YI R+R+LAKAC +AF+ T  G
Sbjct: 243 TGRKIIMAHPAYDQCIKASHVFNLLDARGVISVTERQAYIGRVRALAKACADAFVQTKAG 302

Query: 306 G 306
           G
Sbjct: 303 G 303


>gi|326565637|gb|EGE15800.1| glycyl-tRNA synthetase subunit alpha [Moraxella catarrhalis
           12P80B1]
          Length = 318

 Score =  556 bits (1434), Expect = e-156,   Method: Composition-based stats.
 Identities = 184/300 (61%), Positives = 221/300 (73%), Gaps = 10/300 (3%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
            +    L+FQ +ILTL  YWA +GC +LQPYDMEVGAGTFH +T LRAL P  W AAYVQ
Sbjct: 1   MDSGETLTFQALILTLQNYWASRGCVVLQPYDMEVGAGTFHTATFLRALTPERWNAAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY +NPNRLQHYYQFQV++KPNP N+Q LY+ SLKA+GID L HDVRFVEDN
Sbjct: 61  PSRRPTDGRYGDNPNRLQHYYQFQVVLKPNPANIQELYLGSLKAIGIDTLTHDVRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WESPTLGAWGLGWE W +GME++QFTYFQQV GIEC P++GEITYGLERLAMY+Q V+SV
Sbjct: 121 WESPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGIECFPVTGEITYGLERLAMYIQGVDSV 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V+   E   V YGD+F Q+E E S YNFE+A+   L   F   E++   L+   +P 
Sbjct: 181 YDLVWADGEFGRVTYGDVFHQNEVEQSTYNFEHADVAKLFELFDFYEEQADKLVAVNLP- 239

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY+  +KASH FNLLDARG IS TERQR+ILR+R+LA+    ++     
Sbjct: 240 ---------LPAYEMVLKASHAFNLLDARGAISVTERQRFILRVRTLARKVAISYTEARA 290


>gi|165977237|ref|YP_001652830.1| glycyl-tRNA synthetase subunit alpha [Actinobacillus
           pleuropneumoniae serovar 3 str. JL03]
 gi|303250053|ref|ZP_07336255.1| glycyl-tRNA synthetase subunit alpha [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|307248871|ref|ZP_07530884.1| Glycyl-tRNA synthetase alpha subunit [Actinobacillus
           pleuropneumoniae serovar 2 str. S1536]
 gi|307251099|ref|ZP_07533023.1| Glycyl-tRNA synthetase alpha subunit [Actinobacillus
           pleuropneumoniae serovar 4 str. M62]
 gi|307253485|ref|ZP_07535356.1| Glycyl-tRNA synthetase alpha subunit [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|307255715|ref|ZP_07537519.1| Glycyl-tRNA synthetase alpha subunit [Actinobacillus
           pleuropneumoniae serovar 9 str. CVJ13261]
 gi|307257899|ref|ZP_07539655.1| Glycyl-tRNA synthetase alpha subunit [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
 gi|307260167|ref|ZP_07541877.1| Glycyl-tRNA synthetase alpha subunit [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
 gi|238687521|sp|B0BSX2|SYGA_ACTPJ RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|165877338|gb|ABY70386.1| glycyl-tRNA synthetase alpha subunit [Actinobacillus
           pleuropneumoniae serovar 3 str. JL03]
 gi|302651116|gb|EFL81270.1| glycyl-tRNA synthetase subunit alpha [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|306854798|gb|EFM86988.1| Glycyl-tRNA synthetase alpha subunit [Actinobacillus
           pleuropneumoniae serovar 2 str. S1536]
 gi|306856929|gb|EFM89061.1| Glycyl-tRNA synthetase alpha subunit [Actinobacillus
           pleuropneumoniae serovar 4 str. M62]
 gi|306859164|gb|EFM91206.1| Glycyl-tRNA synthetase alpha subunit [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|306861392|gb|EFM93382.1| Glycyl-tRNA synthetase alpha subunit [Actinobacillus
           pleuropneumoniae serovar 9 str. CVJ13261]
 gi|306863629|gb|EFM95556.1| Glycyl-tRNA synthetase alpha subunit [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
 gi|306865813|gb|EFM97691.1| Glycyl-tRNA synthetase alpha subunit [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
          Length = 304

 Score =  556 bits (1434), Expect = e-156,   Method: Composition-based stats.
 Identities = 181/302 (59%), Positives = 218/302 (72%), Gaps = 8/302 (2%)

Query: 4   IHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYV 63
           +  K N  +FQ +IL L  YWA  GCTI+QP+DMEVGAGT HP T LRALGP     AYV
Sbjct: 1   MTTKFNVKTFQGMILALQDYWANVGCTIVQPFDMEVGAGTSHPMTALRALGPEPMAFAYV 60

Query: 64  QPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVED 123
           QPSRRP DGRY ENPNRLQHYYQFQV+IKP+P N+Q LY+ SLK +G DP  HD+RFVED
Sbjct: 61  QPSRRPTDGRYGENPNRLQHYYQFQVVIKPSPDNIQELYLGSLKMLGFDPTQHDIRFVED 120

Query: 124 NWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNS 183
           NWE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GE+TYGLERLAMY+Q V+S
Sbjct: 121 NWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEVTYGLERLAMYIQGVDS 180

Query: 184 VYDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIP 243
           VYD+V++        YGD+F Q+E E S YNFEYA+ + L   F   EKE  +LL    P
Sbjct: 181 VYDLVWSDGPLGKTTYGDVFHQNEVEQSTYNFEYADVDFLFKAFEQYEKEATELLALEKP 240

Query: 244 NEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTP 303
                      PAY++ +KA+H FN+LDAR  IS TERQRYILRIR+L K   EA+  + 
Sbjct: 241 --------LPLPAYERILKAAHSFNMLDARKAISVTERQRYILRIRTLTKGVAEAYYASR 292

Query: 304 NG 305
             
Sbjct: 293 EA 294


>gi|16762653|ref|NP_458270.1| glycyl-tRNA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Typhi str. CT18]
 gi|29144140|ref|NP_807482.1| glycyl-tRNA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
 gi|213428106|ref|ZP_03360856.1| glycyl-tRNA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Typhi str. E02-1180]
 gi|213649465|ref|ZP_03379518.1| glycyl-tRNA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Typhi str. J185]
 gi|289828318|ref|ZP_06546243.1| glycyl-tRNA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-3139]
 gi|25009308|sp|Q8Z2B4|SYGA_SALTI RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|25293182|pir||AH0980 glycine-tRNA ligase (EC 6.1.1.14) - Salmonella enterica subsp.
           enterica serovar Typhi (strain CT18)
 gi|16504959|emb|CAD07972.1| glycine-tRNA synthetase, alpha subunit [Salmonella enterica subsp.
           enterica serovar Typhi]
 gi|29139777|gb|AAO71342.1| glycine-tRNA synthetase, alpha subunit [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
          Length = 303

 Score =  556 bits (1434), Expect = e-156,   Method: Composition-based stats.
 Identities = 185/301 (61%), Positives = 220/301 (73%), Gaps = 8/301 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +ILTL  YWA+QGCTI+QP DMEVGAGT HP T LRALGP     AYVQ
Sbjct: 1   MQKFDTRTFQGLILTLQDYWARQGCTIVQPLDMEVGAGTSHPMTCLRALGPEPMATAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQV+IKP+P N+Q LY+ SLK +G+DP IHD+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVVIKPSPENIQELYLGSLKELGMDPTIHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC  ++GEITYGLERLAMY+Q V+SV
Sbjct: 121 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKLVTGEITYGLERLAMYIQGVDSV 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V++        YGD+F Q+E E S YNFEYA+ + L   F   EKE   LL    P 
Sbjct: 181 YDLVWSDGPLGKTTYGDVFHQNEVEQSTYNFEYADVDFLFTCFEQYEKEAQQLLALENP- 239

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY++ +KA+H FNLLDAR  IS TERQRYILRIR+L KA  EA+  +  
Sbjct: 240 -------LPLPAYERILKAAHSFNLLDARKAISVTERQRYILRIRTLTKAVAEAYYASRE 292

Query: 305 G 305
            
Sbjct: 293 A 293


>gi|308535180|ref|YP_002137465.2| glycyl-tRNA synthetase subunit alpha [Geobacter bemidjiensis Bem]
 gi|308052525|gb|ACH37669.2| glycyl-tRNA synthetase, alpha subunit [Geobacter bemidjiensis Bem]
          Length = 292

 Score =  556 bits (1434), Expect = e-156,   Method: Composition-based stats.
 Identities = 176/295 (59%), Positives = 218/295 (73%), Gaps = 14/295 (4%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ +IL+L  YWA QGC I QPYD E GAGTF+P+T LR LGP  WK AYV+PSRRP
Sbjct: 1   MLTFQELILSLQGYWAGQGCVIQQPYDTEKGAGTFNPATFLRVLGPEPWKVAYVEPSRRP 60

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNRLQHYYQFQVI+KP+P+N+ +LY++SL+A GIDP  HD+RFVED+WESPT
Sbjct: 61  TDGRYGENPNRLQHYYQFQVIMKPSPMNILDLYLDSLRAFGIDPGKHDIRFVEDDWESPT 120

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W DGMEI+QFTYFQQ  GI+  P+S EITYG ER+AMY+Q V++VYD+ +
Sbjct: 121 LGAWGLGWEVWLDGMEITQFTYFQQAGGIDLKPVSSEITYGCERIAMYLQGVDNVYDLEW 180

Query: 190 NAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRH 249
                + V YGDI  +SE E+S YNFE A+ ++L   F   EKEC+ L++KG+       
Sbjct: 181 V----KGVRYGDIHHESEVEFSTYNFEEADVDMLLQLFKMYEKECVRLVEKGL------- 229

Query: 250 HLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
              V PAYD  +K SH FNLLDARG IS TER  YI ++R++A+ C E +L    
Sbjct: 230 ---VLPAYDYVMKCSHTFNLLDARGAISVTERASYIGKVRNVARLCAEGYLQMRE 281


>gi|52426008|ref|YP_089145.1| glycyl-tRNA synthetase subunit alpha [Mannheimia succiniciproducens
           MBEL55E]
 gi|81609407|sp|Q65R50|SYGA_MANSM RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|52308060|gb|AAU38560.1| GlyQ protein [Mannheimia succiniciproducens MBEL55E]
          Length = 313

 Score =  556 bits (1434), Expect = e-156,   Method: Composition-based stats.
 Identities = 184/306 (60%), Positives = 223/306 (72%), Gaps = 4/306 (1%)

Query: 4   IHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYV 63
           +  K N  +FQ +IL L  YWAQQGCTI+QP+DMEVGAGT HP T LRALGP     AYV
Sbjct: 1   MSAKFNVKTFQGMILALQDYWAQQGCTIVQPFDMEVGAGTSHPMTALRALGPEPMAFAYV 60

Query: 64  QPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVED 123
           QPSRRP DGRY ENPNRLQHYYQFQV+IKP+P N+Q LY+ SLK +G DP  HD+RFVED
Sbjct: 61  QPSRRPTDGRYGENPNRLQHYYQFQVVIKPSPDNIQELYLGSLKMLGFDPTQHDIRFVED 120

Query: 124 NWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNS 183
           NWE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GE+TYGLERLAMY+Q V+S
Sbjct: 121 NWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEVTYGLERLAMYIQGVDS 180

Query: 184 VYDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIP 243
           VYD+V++        YGD+F Q+E E S YNFEYA+ + L   F   E+E   LLK+   
Sbjct: 181 VYDLVYSDGPLGKTTYGDVFHQNEVEQSTYNFEYADVDFLFECFNKYEQEAKFLLKQEPR 240

Query: 244 NEHHRHH----LCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAF 299
            E+ +          PAY++ +KA+H FNLLDAR  IS TERQRYILRIR+L K   EA+
Sbjct: 241 MENDKEIWVETALPLPAYERILKAAHSFNLLDARKAISVTERQRYILRIRALTKGVAEAY 300

Query: 300 LMTPNG 305
             +   
Sbjct: 301 YASREA 306


>gi|56476158|ref|YP_157747.1| glycyl-tRNA synthetase subunit alpha [Aromatoleum aromaticum EbN1]
 gi|56312201|emb|CAI06846.1| glycyl-tRNA synthetase alpha chain [Aromatoleum aromaticum EbN1]
          Length = 315

 Score =  556 bits (1434), Expect = e-156,   Method: Composition-based stats.
 Identities = 173/297 (58%), Positives = 223/297 (75%), Gaps = 11/297 (3%)

Query: 9   NDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRR 68
           +  +FQ +ILTL QYW ++GC +LQPYD+EVGAGT H +T LRA+GP  W AAYVQPSRR
Sbjct: 13  HKPTFQQVILTLQQYWGERGCVLLQPYDLEVGAGTSHTATFLRAIGPEPWNAAYVQPSRR 72

Query: 69  PLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESP 128
           P DGRY ENPNRLQHYYQFQV++KP+PLN+Q LY++SL+A+GID   HD+RFVED+WE+P
Sbjct: 73  PKDGRYGENPNRLQHYYQFQVVLKPSPLNIQELYLDSLRALGIDTNAHDIRFVEDDWENP 132

Query: 129 TLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIV 188
           TLGAWGLGWE W DGME++QFTYFQQV G++C P+ GEITYGLERLAMY+Q V +VYD+V
Sbjct: 133 TLGAWGLGWEVWLDGMEVTQFTYFQQVGGLDCKPVLGEITYGLERLAMYLQGVENVYDLV 192

Query: 189 FN-AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHH 247
           +    +G  V YGD+F Q+E E S YNFE++N +   + F + E E   L++ G+     
Sbjct: 193 WAVYPDGSKVTYGDVFHQNEVEQSTYNFEHSNVDFFFSLFGNYEAEAKRLMEAGL----- 247

Query: 248 RHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                  PAY+  +KA+H FN+LDARG IS TER  YI RIR+L++A  +A+  +  
Sbjct: 248 -----ALPAYEMVLKAAHSFNMLDARGAISVTERAAYIGRIRNLSRAVAQAYSASRE 299


>gi|332288861|ref|YP_004419713.1| glycyl-tRNA synthetase subunit alpha [Gallibacterium anatis UMN179]
 gi|330431757|gb|AEC16816.1| glycyl-tRNA synthetase subunit alpha [Gallibacterium anatis UMN179]
          Length = 303

 Score =  556 bits (1434), Expect = e-156,   Method: Composition-based stats.
 Identities = 182/302 (60%), Positives = 220/302 (72%), Gaps = 8/302 (2%)

Query: 4   IHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYV 63
           +  + N  +FQ +IL L  YWA+QGCTI+QP+DMEVGAGT HP T LRALGP     AYV
Sbjct: 1   MTTQFNIKTFQGMILALQAYWAEQGCTIVQPFDMEVGAGTSHPMTALRALGPEPMAFAYV 60

Query: 64  QPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVED 123
           QPSRRP DGRY ENPNRLQHYYQFQV+IKP+P N+Q LY+ SLK +G DP  +D+RFVED
Sbjct: 61  QPSRRPTDGRYGENPNRLQHYYQFQVVIKPSPDNIQELYLGSLKMLGFDPTQNDIRFVED 120

Query: 124 NWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNS 183
           NWE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLERLAMY+Q V+S
Sbjct: 121 NWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECRPVTGEITYGLERLAMYIQGVDS 180

Query: 184 VYDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIP 243
           VYD+V++        YGD+F Q+E E S YNFEYA+ + L   F   EKE  +LL    P
Sbjct: 181 VYDLVWSDGPLGKTTYGDVFHQNEVEQSTYNFEYADVDFLFKCFEQYEKEAQELLALEKP 240

Query: 244 NEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTP 303
                      PAY++ +KA+H FNLLDAR  IS TERQRYILRIR+L K   EA+  + 
Sbjct: 241 --------LPLPAYERILKAAHSFNLLDARKAISVTERQRYILRIRALTKGVAEAYYASR 292

Query: 304 NG 305
             
Sbjct: 293 EA 294


>gi|145634103|ref|ZP_01789814.1| glycyl-tRNA synthetase alpha subunit [Haemophilus influenzae
           PittAA]
 gi|145268547|gb|EDK08540.1| glycyl-tRNA synthetase alpha subunit [Haemophilus influenzae
           PittAA]
          Length = 302

 Score =  556 bits (1434), Expect = e-156,   Method: Composition-based stats.
 Identities = 180/302 (59%), Positives = 219/302 (72%), Gaps = 8/302 (2%)

Query: 4   IHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYV 63
           +  K N  +FQ +IL L +YWA QGCTI+QP+DMEVGAGT HP T LRALGP     AYV
Sbjct: 1   MSTKFNVKTFQGMILALQEYWANQGCTIVQPFDMEVGAGTSHPMTALRALGPEPMAFAYV 60

Query: 64  QPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVED 123
           QPSRRP DGRY ENPNRLQHYYQFQV+IKP+P N+Q LY+ SL+ +G DP  +D+RFVED
Sbjct: 61  QPSRRPTDGRYGENPNRLQHYYQFQVVIKPSPDNIQELYLGSLEMLGFDPTQNDIRFVED 120

Query: 124 NWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNS 183
           NWE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GE+TYGLERLAMY+Q V+S
Sbjct: 121 NWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEVTYGLERLAMYIQGVDS 180

Query: 184 VYDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIP 243
           VYD+ ++        YGD+F Q+E E S YNFE+AN + L   F   EKE  +LL    P
Sbjct: 181 VYDLAWSDGPLGKTTYGDVFHQNEVEQSTYNFEHANTDFLFYCFDQYEKEAQELLALEKP 240

Query: 244 NEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTP 303
                      PAY++ +KA+H FNLLDAR  IS TERQRYILRIR+L K   EA+  + 
Sbjct: 241 --------LPLPAYERILKAAHSFNLLDARKAISVTERQRYILRIRALTKGVAEAYYASR 292

Query: 304 NG 305
             
Sbjct: 293 EA 294


>gi|296113854|ref|YP_003627792.1| glycyl-tRNA synthetase alpha subunit [Moraxella catarrhalis RH4]
 gi|295921548|gb|ADG61899.1| glycyl-tRNA synthetase alpha subunit [Moraxella catarrhalis RH4]
          Length = 318

 Score =  556 bits (1434), Expect = e-156,   Method: Composition-based stats.
 Identities = 184/300 (61%), Positives = 221/300 (73%), Gaps = 10/300 (3%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
            +    L+FQ +ILTL  YWA +GC +LQPYDMEVGAGTFH +T LRAL P  W AAYVQ
Sbjct: 1   MDSGETLTFQALILTLQNYWASRGCVVLQPYDMEVGAGTFHTATFLRALTPERWNAAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY +NPNRLQHYYQFQV++KPNP N+Q LY+ SLKA+GID L HDVRFVEDN
Sbjct: 61  PSRRPTDGRYGDNPNRLQHYYQFQVVLKPNPANIQELYLGSLKAIGIDTLTHDVRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WESPTLGAWGLGWE W +GME++QFTYFQQV GIEC P++GEITYGLERLAMY+Q V+SV
Sbjct: 121 WESPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGIECFPVTGEITYGLERLAMYIQGVDSV 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V+   E   V YGD+F Q+E E S YNFE+A+   L   F   E++   L+   +P 
Sbjct: 181 YDLVWADGEFGRVTYGDVFHQNEVEQSAYNFEHADVAKLFELFDFYEEQADKLVAVNLP- 239

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY+  +KASH FNLLDARG IS TERQR+ILR+R+LA+    ++     
Sbjct: 240 ---------LPAYEMVLKASHAFNLLDARGAISVTERQRFILRVRTLARKVAISYTEARA 290


>gi|326568417|gb|EGE18497.1| glycyl-tRNA synthetase subunit alpha [Moraxella catarrhalis BC7]
          Length = 318

 Score =  556 bits (1434), Expect = e-156,   Method: Composition-based stats.
 Identities = 184/300 (61%), Positives = 221/300 (73%), Gaps = 10/300 (3%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
            +    L+FQ +ILTL  YWA +GC +LQPYDMEVGAGTFH +T LRAL P  W AAYVQ
Sbjct: 1   MDSGETLTFQALILTLQNYWASRGCVVLQPYDMEVGAGTFHTATFLRALTPERWNAAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY +NPNRLQHYYQFQV++KPNP N+Q LY+ SLKA+GID L HDVRFVEDN
Sbjct: 61  PSRRPTDGRYGDNPNRLQHYYQFQVVLKPNPANIQELYLGSLKAIGIDTLTHDVRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WESPTLGAWGLGWE W +GME++QFTYFQQV GIEC P++GEITYGLERLAMY+Q V+SV
Sbjct: 121 WESPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGIECFPVTGEITYGLERLAMYIQGVDSV 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V+   E   V YGD+F Q+E E S YNFE+A+   L   F   E++   L+   +P 
Sbjct: 181 YDLVWADGEFGRVTYGDVFHQNEVEQSAYNFEHADVAKLFELFDFYEEQADKLVAVNLP- 239

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY+  +KASH FNLLDARG IS TERQR+ILR+R+LA+    ++     
Sbjct: 240 ---------LPAYEMVLKASHAFNLLDARGAISVTERQRFILRVRTLARKVAISYTEARA 290


>gi|307246730|ref|ZP_07528800.1| Glycyl-tRNA synthetase alpha subunit [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|306852430|gb|EFM84665.1| Glycyl-tRNA synthetase alpha subunit [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
          Length = 313

 Score =  556 bits (1434), Expect = e-156,   Method: Composition-based stats.
 Identities = 181/303 (59%), Positives = 218/303 (71%), Gaps = 8/303 (2%)

Query: 3   PIHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAY 62
            +  K N  +FQ +IL L  YWA  GCTI+QP+DMEVGAGT HP T LRALGP     AY
Sbjct: 9   KMTTKFNVKTFQGMILALQDYWANVGCTIVQPFDMEVGAGTSHPMTALRALGPEPMAFAY 68

Query: 63  VQPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVE 122
           VQPSRRP DGRY ENPNRLQHYYQFQV+IKP+P N+Q LY+ SLK +G DP  HD+RFVE
Sbjct: 69  VQPSRRPTDGRYGENPNRLQHYYQFQVVIKPSPDNIQELYLGSLKMLGFDPTQHDIRFVE 128

Query: 123 DNWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVN 182
           DNWE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GE+TYGLERLAMY+Q V+
Sbjct: 129 DNWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEVTYGLERLAMYIQGVD 188

Query: 183 SVYDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGI 242
           SVYD+V++        YGD+F Q+E E S YNFEYA+ + L   F   EKE  +LL    
Sbjct: 189 SVYDLVWSDGPLGKTTYGDVFHQNEVEQSTYNFEYADVDFLFKAFEQYEKEATELLALEK 248

Query: 243 PNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMT 302
           P           PAY++ +KA+H FN+LDAR  IS TERQRYILRIR+L K   EA+  +
Sbjct: 249 P--------LPLPAYERILKAAHSFNMLDARKAISVTERQRYILRIRTLTKGVAEAYYAS 300

Query: 303 PNG 305
              
Sbjct: 301 REA 303


>gi|145640591|ref|ZP_01796174.1| glycyl-tRNA synthetase alpha subunit [Haemophilus influenzae R3021]
 gi|145274517|gb|EDK14380.1| glycyl-tRNA synthetase alpha subunit [Haemophilus influenzae
           22.4-21]
          Length = 304

 Score =  556 bits (1434), Expect = e-156,   Method: Composition-based stats.
 Identities = 180/302 (59%), Positives = 219/302 (72%), Gaps = 8/302 (2%)

Query: 4   IHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYV 63
           +  K N  +FQ +IL L +YWA QGCTI+QP+DMEVGAGT HP T LRALGP     AYV
Sbjct: 1   MSTKFNVKTFQGMILALQEYWANQGCTIVQPFDMEVGAGTSHPMTALRALGPEPMAFAYV 60

Query: 64  QPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVED 123
           QPSRRP DGRY ENPNRLQHYYQFQV+IKP+P N+Q LY+ SL+ +G DP  +D+RFVED
Sbjct: 61  QPSRRPTDGRYGENPNRLQHYYQFQVVIKPSPDNIQELYLGSLEMLGFDPTQNDIRFVED 120

Query: 124 NWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNS 183
           NWE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GE+TYGLERLAMY+Q V+S
Sbjct: 121 NWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEVTYGLERLAMYIQGVDS 180

Query: 184 VYDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIP 243
           VYD+ ++        YGD+F Q+E E S YNFE+AN + L   F   EKE  +LL    P
Sbjct: 181 VYDLAWSDGPLGKTTYGDVFHQNEVEQSTYNFEHANTDFLFYCFDQYEKEAQELLALEKP 240

Query: 244 NEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTP 303
                      PAY++ +KA+H FNLLDAR  IS TERQRYILRIR+L K   EA+  + 
Sbjct: 241 --------LPLPAYERILKAAHSFNLLDARKAISVTERQRYILRIRALTKGVAEAYYASR 292

Query: 304 NG 305
             
Sbjct: 293 EA 294


>gi|309973571|gb|ADO96772.1| Glycyl-tRNA synthetase, alpha subunit [Haemophilus influenzae
           R2846]
          Length = 302

 Score =  556 bits (1434), Expect = e-156,   Method: Composition-based stats.
 Identities = 180/302 (59%), Positives = 219/302 (72%), Gaps = 8/302 (2%)

Query: 4   IHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYV 63
           +  K N  +FQ +IL L +YW  QGCTI+QP+DMEVGAGT HP T LRALGP     AYV
Sbjct: 1   MSTKFNVKTFQGMILALQEYWTNQGCTIVQPFDMEVGAGTSHPMTALRALGPEPMAFAYV 60

Query: 64  QPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVED 123
           QPSRRP DGRY ENPNRLQHYYQFQV+IKP+P N+Q LY+ SL+ +G DP  +D+RFVED
Sbjct: 61  QPSRRPTDGRYGENPNRLQHYYQFQVVIKPSPDNIQELYLGSLEMLGFDPTQNDIRFVED 120

Query: 124 NWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNS 183
           NWE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GE+TYGLERLAMY+Q V+S
Sbjct: 121 NWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEVTYGLERLAMYIQGVDS 180

Query: 184 VYDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIP 243
           VYD+V++        YGD+F Q+E E S YNFE+AN + L   F   EKE  +LL    P
Sbjct: 181 VYDLVWSDGPLGKTTYGDVFHQNEVEQSTYNFEHANTDFLFYCFDQYEKEAQELLALEKP 240

Query: 244 NEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTP 303
                      PAY++ +KA+H FNLLDAR  IS TERQRYILRIR+L K   EA+  + 
Sbjct: 241 --------LPLPAYERILKAAHSFNLLDARKAISVTERQRYILRIRALTKGVAEAYYASR 292

Query: 304 NG 305
             
Sbjct: 293 EA 294


>gi|254362725|ref|ZP_04978809.1| glycine--tRNA ligase [Mannheimia haemolytica PHL213]
 gi|261491866|ref|ZP_05988445.1| glycine--tRNA ligase [Mannheimia haemolytica serotype A2 str.
           BOVINE]
 gi|153094350|gb|EDN75205.1| glycine--tRNA ligase [Mannheimia haemolytica PHL213]
 gi|261312521|gb|EEY13645.1| glycine--tRNA ligase [Mannheimia haemolytica serotype A2 str.
           BOVINE]
          Length = 302

 Score =  556 bits (1434), Expect = e-156,   Method: Composition-based stats.
 Identities = 181/302 (59%), Positives = 219/302 (72%), Gaps = 8/302 (2%)

Query: 4   IHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYV 63
           +  K N  +FQ +IL L  YWA +GCTI+QP+D+EVGAGT HP T LRALGP     AYV
Sbjct: 1   MSTKFNVKTFQGMILALQDYWASKGCTIVQPFDLEVGAGTSHPMTCLRALGPEPMAFAYV 60

Query: 64  QPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVED 123
           QPSRRP DGRY ENPNRLQHYYQFQV+IKP+P N+Q LY++SLK +G DP  +D+RFVED
Sbjct: 61  QPSRRPTDGRYGENPNRLQHYYQFQVVIKPSPDNIQELYLDSLKMLGFDPTQNDIRFVED 120

Query: 124 NWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNS 183
           NWE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLERLAMY+Q V+S
Sbjct: 121 NWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGLERLAMYIQGVDS 180

Query: 184 VYDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIP 243
           VYD+V++  E     YGD+F Q+E E S YNFEYA+ + L   F   EKE   LL     
Sbjct: 181 VYDLVWSDGELGKTTYGDVFHQNEVEQSTYNFEYADVDFLFQCFEQYEKEAQYLL----- 235

Query: 244 NEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTP 303
                      PAY++ +KA+H FNLLDAR  IS TERQRYILRIR+L K   EA+  + 
Sbjct: 236 ---GLEKPLPLPAYERILKAAHSFNLLDARKAISVTERQRYILRIRALTKGVAEAYYASR 292

Query: 304 NG 305
             
Sbjct: 293 EA 294


>gi|326562180|gb|EGE12508.1| glycyl-tRNA synthetase subunit alpha [Moraxella catarrhalis 7169]
          Length = 318

 Score =  556 bits (1433), Expect = e-156,   Method: Composition-based stats.
 Identities = 184/300 (61%), Positives = 221/300 (73%), Gaps = 10/300 (3%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
            +    L+FQ +ILTL  YWA +GC +LQPYDMEVGAGTFH +T LRAL P  W AAYVQ
Sbjct: 1   MDSGETLTFQALILTLQNYWASRGCVVLQPYDMEVGAGTFHTATFLRALTPERWNAAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY +NPNRLQHYYQFQV++KPNP N+Q LY+ SLKA+GID L HDVRFVEDN
Sbjct: 61  PSRRPTDGRYGDNPNRLQHYYQFQVVLKPNPANIQELYLGSLKAIGIDTLTHDVRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WESPTLGAWGLGWE W +GME++QFTYFQQV GIEC P++GEITYGLERLAMY+Q V+SV
Sbjct: 121 WESPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGIECFPVTGEITYGLERLAMYIQGVDSV 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V+   E   V YGD+F Q+E E S YNFE+A+   L   F   E++   L+   +P 
Sbjct: 181 YDLVWADGEFGRVTYGDVFHQNEVEQSAYNFEHADVAKLFELFDFYEEQADKLVAVNLP- 239

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY+  +KASH FNLLDARG IS TERQR+ILR+R+LA+    ++     
Sbjct: 240 ---------LPAYEMVLKASHAFNLLDARGAISVTERQRFILRVRTLARKVAISYTEARA 290


>gi|229844010|ref|ZP_04464151.1| glycyl-tRNA synthetase subunit alpha [Haemophilus influenzae
           6P18H1]
 gi|229813004|gb|EEP48692.1| glycyl-tRNA synthetase subunit alpha [Haemophilus influenzae
           6P18H1]
          Length = 302

 Score =  556 bits (1433), Expect = e-156,   Method: Composition-based stats.
 Identities = 180/302 (59%), Positives = 219/302 (72%), Gaps = 8/302 (2%)

Query: 4   IHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYV 63
           +  K N  +FQ +IL L +YWA QGCTI+QP+DMEVGAGT HP T LRALGP     AYV
Sbjct: 1   MSTKFNLKTFQGMILALQEYWANQGCTIVQPFDMEVGAGTSHPMTALRALGPEPMAFAYV 60

Query: 64  QPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVED 123
           QPSRRP DGRY ENPNRLQHYYQFQV+IKP+P N+Q LY+ SL+ +G DP  +D+RFVED
Sbjct: 61  QPSRRPTDGRYGENPNRLQHYYQFQVVIKPSPDNIQELYLGSLEMLGFDPTQNDIRFVED 120

Query: 124 NWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNS 183
           NWE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GE+TYGLERLAMY+Q V+S
Sbjct: 121 NWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEVTYGLERLAMYIQGVDS 180

Query: 184 VYDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIP 243
           VYD+ ++        YGD+F Q+E E S YNFE+AN + L   F   EKE  +LL    P
Sbjct: 181 VYDLAWSDGPLGKTTYGDVFHQNEVEQSTYNFEHANTDFLFYCFDQYEKEAQELLALEKP 240

Query: 244 NEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTP 303
                      PAY++ +KA+H FNLLDAR  IS TERQRYILRIR+L K   EA+  + 
Sbjct: 241 --------LPLPAYERILKAAHSFNLLDARKAISVTERQRYILRIRALTKGVAEAYYASR 292

Query: 304 NG 305
             
Sbjct: 293 EA 294


>gi|294138813|ref|YP_003554791.1| glycyl-tRNA synthetase subunit alpha [Shewanella violacea DSS12]
 gi|293325282|dbj|BAJ00013.1| glycyl-tRNA synthetase, alpha subunit [Shewanella violacea DSS12]
          Length = 301

 Score =  556 bits (1433), Expect = e-156,   Method: Composition-based stats.
 Identities = 184/302 (60%), Positives = 225/302 (74%), Gaps = 8/302 (2%)

Query: 4   IHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYV 63
           +  K +  +FQ  I+TL +YWAQQGC I+QP D+EVGAGTFHP T LR+LGP    +AYV
Sbjct: 1   MTTKHDVKTFQGFIMTLQEYWAQQGCAIVQPLDIEVGAGTFHPQTFLRSLGPEPMSSAYV 60

Query: 64  QPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVED 123
           QP RRP DGRY +NPNRLQHYYQFQV++KP+P N+Q LY+ SL+AVG+D  +HDVRFVED
Sbjct: 61  QPCRRPTDGRYGDNPNRLQHYYQFQVVLKPSPSNIQELYLGSLEAVGVDMSVHDVRFVED 120

Query: 124 NWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNS 183
           NWESPTLGAWGLGWE W +GME+SQFTYFQQV GIECSP++GEITYGLERLAMY+Q V+S
Sbjct: 121 NWESPTLGAWGLGWEIWLNGMEVSQFTYFQQVGGIECSPVTGEITYGLERLAMYIQEVDS 180

Query: 184 VYDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIP 243
           VYD+V+       ++YGDIF Q+E E S YNFE+A+ ++L   F D EK C  LL    P
Sbjct: 181 VYDLVWTDGPMGKIMYGDIFHQNEVEQSTYNFEHADVDVLFRLFDDCEKACERLLALEKP 240

Query: 244 NEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTP 303
                      PAY+Q +KASH FN+LDAR  IS TERQRYILR+R+LAK   +++    
Sbjct: 241 --------LPLPAYEQVMKASHAFNMLDARHAISVTERQRYILRVRTLAKGVAQSYYQAR 292

Query: 304 NG 305
             
Sbjct: 293 EA 294


>gi|85703627|ref|ZP_01034731.1| glycyl-tRNA synthetase alpha subunit [Roseovarius sp. 217]
 gi|85672555|gb|EAQ27412.1| glycyl-tRNA synthetase alpha subunit [Roseovarius sp. 217]
          Length = 309

 Score =  556 bits (1433), Expect = e-156,   Method: Composition-based stats.
 Identities = 193/304 (63%), Positives = 238/304 (78%), Gaps = 2/304 (0%)

Query: 6   NKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQP 65
             +   SFQ IIL L  YWA QGC ++QPYDMEVGAGTFHP+TTLR+LG   W AAYVQP
Sbjct: 4   TTEKPRSFQEIILRLQAYWAAQGCAMMQPYDMEVGAGTFHPATTLRSLGSKPWTAAYVQP 63

Query: 66  SRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNW 125
           SRRP DGRY ENPNRLQHYYQ+QV+IKP+P NLQ+LY+ SL+A+GID  +HD+RFVED+W
Sbjct: 64  SRRPTDGRYGENPNRLQHYYQYQVLIKPSPPNLQDLYLGSLRAIGIDMALHDIRFVEDDW 123

Query: 126 ESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVY 185
           ESPTLGAWGLGWE WCDGME+SQFTYFQQV G +C+P+SGE+TYGLERLAMYV  ++ V 
Sbjct: 124 ESPTLGAWGLGWEVWCDGMEVSQFTYFQQVGGHDCAPVSGELTYGLERLAMYVLGIDHVM 183

Query: 186 DIVFNAIEGQ-NVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLL-KKGIP 243
           D+ FN       + YGD+F Q+E+EYSR+NF+ AN ++L  HF ++E EC  +L ++ + 
Sbjct: 184 DMPFNDPAAPIPLKYGDVFRQTEEEYSRWNFDVANTDVLLRHFEEAEAECQAILAQEAVD 243

Query: 244 NEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTP 303
            +  +  +   PAYDQCIKASH+FNLLDARGVIS TERQ YI R+R+LAK C +AF+ T 
Sbjct: 244 PKTGKRIIMAHPAYDQCIKASHLFNLLDARGVISVTERQAYIGRVRALAKQCADAFVQTN 303

Query: 304 NGGH 307
            GG 
Sbjct: 304 AGGQ 307


>gi|213968432|ref|ZP_03396575.1| glycyl-tRNA synthetase subunit alpha [Pseudomonas syringae pv.
           tomato T1]
 gi|213926720|gb|EEB60272.1| glycyl-tRNA synthetase subunit alpha [Pseudomonas syringae pv.
           tomato T1]
          Length = 355

 Score =  556 bits (1433), Expect = e-156,   Method: Composition-based stats.
 Identities = 186/293 (63%), Positives = 222/293 (75%), Gaps = 10/293 (3%)

Query: 12  SFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPLD 71
           +FQ++IL L QYWA+QGC +LQPYDMEVGAGTFH +T LRA+GP +W AAYVQPSRRP D
Sbjct: 50  TFQDLILALQQYWAEQGCVVLQPYDMEVGAGTFHTATFLRAVGPETWNAAYVQPSRRPTD 109

Query: 72  GRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTLG 131
           GRY ENPNRLQHYYQFQVI+KPNP N Q LY+ SLK +G+DPL+HDVRFVEDNWESPTLG
Sbjct: 110 GRYGENPNRLQHYYQFQVILKPNPDNFQELYLGSLKHIGLDPLVHDVRFVEDNWESPTLG 169

Query: 132 AWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFNA 191
           AWGLGWE W +GME+SQFTYFQQV GIEC P++GEITYGLERLAMY Q V+SVYD+V+  
Sbjct: 170 AWGLGWEIWLNGMEVSQFTYFQQVGGIECYPVTGEITYGLERLAMYQQGVDSVYDLVWAD 229

Query: 192 IEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHHL 251
                V YGD+F Q+E E S YNFE+AN + L   F   E E   L++  +P        
Sbjct: 230 GPFGKVTYGDVFHQNEVEQSTYNFEHANVDKLFELFDFYESEAARLIELELP-------- 281

Query: 252 CVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
              P Y+  +KASH FNLLDAR  IS T RQ+YILR+R+LA++  +A+L    
Sbjct: 282 --LPGYEMVLKASHTFNLLDARRAISVTARQQYILRVRTLARSVAQAYLQARA 332


>gi|75676771|ref|YP_319192.1| glycyl-tRNA synthetase subunit alpha [Nitrobacter winogradskyi
           Nb-255]
 gi|74421641|gb|ABA05840.1| glycyl-tRNA synthetase alpha chain [Nitrobacter winogradskyi
           Nb-255]
          Length = 314

 Score =  556 bits (1433), Expect = e-156,   Method: Composition-based stats.
 Identities = 204/308 (66%), Positives = 247/308 (80%), Gaps = 6/308 (1%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
            + + + SFQ +ILTL +YWA  GC ILQPYDMEVGAGTFHP+TTLRALGP  W AAYVQ
Sbjct: 6   PHMRPERSFQGLILTLQRYWADYGCVILQPYDMEVGAGTFHPATTLRALGPKHWNAAYVQ 65

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQVI+KP+P ++Q+LY++SL A+G+D  +HD+RFVED+
Sbjct: 66  PSRRPKDGRYGENPNRLQHYYQFQVILKPSPPDIQDLYLKSLAAIGVDSALHDIRFVEDD 125

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WESPTLGAWGLGWECWCDGME+SQFTYFQQV G+EC+P++GE+TYGLERLAM+VQ V+ V
Sbjct: 126 WESPTLGAWGLGWECWCDGMEVSQFTYFQQVAGVECAPVAGELTYGLERLAMFVQGVDRV 185

Query: 185 YDIVFNAIEG-QNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIP 243
           YD+ FN  EG + V YGD+F Q+EQEYSR+NFE+++  +L   F  +E  C   L  G  
Sbjct: 186 YDLNFNGREGAEKVTYGDVFLQAEQEYSRHNFEHSDTAMLFEQFRMAENACKTYLDAGWR 245

Query: 244 NEHHRH-----HLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEA 298
           ++  +      HL   PAYDQCIKASH+FNLLDARGVIS TERQ YILR+R LAKACG+A
Sbjct: 246 DDPKQPGQRAAHLMALPAYDQCIKASHVFNLLDARGVISVTERQSYILRVRELAKACGDA 305

Query: 299 FLMTPNGG 306
           +L T  GG
Sbjct: 306 WLHTDAGG 313


>gi|114319178|ref|YP_740861.1| glycyl-tRNA synthetase subunit alpha [Alkalilimnicola ehrlichii
           MLHE-1]
 gi|114225572|gb|ABI55371.1| glycyl-tRNA synthetase alpha chain [Alkalilimnicola ehrlichii
           MLHE-1]
          Length = 317

 Score =  556 bits (1433), Expect = e-156,   Method: Composition-based stats.
 Identities = 174/293 (59%), Positives = 219/293 (74%), Gaps = 10/293 (3%)

Query: 12  SFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPLD 71
           +FQ +IL L ++WA++GC +LQP D EVGAGTFHP+T LRA+GP  W +AYVQPSRRP D
Sbjct: 18  TFQGLILALQRFWAERGCVVLQPLDQEVGAGTFHPATFLRAIGPEPWHSAYVQPSRRPTD 77

Query: 72  GRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTLG 131
           GRY ENPNRLQHYYQFQV++KP+P ++Q  Y++SL+ +G+DPL HD+RFVEDNWESPTLG
Sbjct: 78  GRYGENPNRLQHYYQFQVVLKPSPADIQEQYLDSLRFLGLDPLTHDIRFVEDNWESPTLG 137

Query: 132 AWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFNA 191
           AWGLGWE W +GMEI+QFTYFQQV G++C P+ GEITYGLER+AMY+Q V SVYD+++  
Sbjct: 138 AWGLGWEVWLNGMEITQFTYFQQVGGLDCHPVMGEITYGLERIAMYLQGVESVYDLLWAD 197

Query: 192 IEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHHL 251
                V YGD+F Q+E+E S YNFE A  E L   F   E+EC  L++  +P        
Sbjct: 198 SPEGPVTYGDVFLQNEREMSAYNFEQAPVEALFQAFETYERECERLIEGDLP-------- 249

Query: 252 CVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
              PAY+  +KASH FNLLDAR  IS TERQ YILR+RS+A+A  +A+     
Sbjct: 250 --LPAYEMTLKASHTFNLLDARHAISVTERQGYILRVRSMARAVAQAYYDRRE 300


>gi|71909146|ref|YP_286733.1| glycyl-tRNA synthetase subunit alpha [Dechloromonas aromatica RCB]
 gi|71848767|gb|AAZ48263.1| glycyl-tRNA synthetase alpha chain [Dechloromonas aromatica RCB]
          Length = 327

 Score =  555 bits (1432), Expect = e-156,   Method: Composition-based stats.
 Identities = 172/302 (56%), Positives = 219/302 (72%), Gaps = 15/302 (4%)

Query: 3   PIHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAY 62
           P+   K   +FQ IIL L QYW+ +GC +LQPYDMEVGAGT H +T LRA+GP  WKAAY
Sbjct: 17  PMTTSKKP-TFQEIILRLQQYWSDKGCALLQPYDMEVGAGTSHTATFLRAIGPEPWKAAY 75

Query: 63  VQPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVE 122
           VQPSRRP DGRY ENPNR+QHYYQFQV++KP P N+  LY+ SL+A+G D   +DVRFVE
Sbjct: 76  VQPSRRPKDGRYGENPNRMQHYYQFQVVLKPAPDNILELYLGSLEALGFDLKKNDVRFVE 135

Query: 123 DNWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVN 182
           D+WE+PTLGAWGLGWE W +GME++QFTYFQQV GI+C PI+GEITYGLERLAMY+Q V 
Sbjct: 136 DDWENPTLGAWGLGWEVWMNGMEVTQFTYFQQVGGIDCKPITGEITYGLERLAMYLQGVE 195

Query: 183 SVYDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGI 242
           +V+D+ +     + + YGD++ Q+E E S YNFE+++ + L   F   EK+   L+   +
Sbjct: 196 NVFDLTWT----EGLTYGDVYHQNEVEQSTYNFEHSDADFLFTAFGAHEKQAQHLMGAQL 251

Query: 243 PNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMT 302
                       PAY+Q +KA+H FNLLDARG IS TER  YI RIR+LA+A  +A+L +
Sbjct: 252 ----------ALPAYEQVLKAAHTFNLLDARGAISVTERAAYIGRIRNLARAVAQAYLDS 301

Query: 303 PN 304
             
Sbjct: 302 RA 303


>gi|319899205|ref|YP_004159298.1| glycyl-tRNA synthetase alpha chain [Bartonella clarridgeiae 73]
 gi|319403169|emb|CBI76728.1| glycyl-tRNA synthetase alpha chain [Bartonella clarridgeiae 73]
          Length = 316

 Score =  555 bits (1432), Expect = e-156,   Method: Composition-based stats.
 Identities = 221/306 (72%), Positives = 257/306 (83%), Gaps = 1/306 (0%)

Query: 1   MAPIHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKA 60
           M    N     SFQ +IL+L  YWAQ GCTILQPYD+EVGAGTFHP+TTLR+LGP  WK 
Sbjct: 1   MNLPSNLNPTRSFQGLILSLQNYWAQHGCTILQPYDIEVGAGTFHPATTLRSLGPRPWKV 60

Query: 61  AYVQPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRF 120
           AYVQP+RRP DGRY +NPNRLQHYYQFQV+ KP+P NLQ LYI SLKA+G+D  +HD+RF
Sbjct: 61  AYVQPTRRPTDGRYGKNPNRLQHYYQFQVLFKPSPPNLQELYIGSLKAIGLDMKLHDIRF 120

Query: 121 VEDNWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQN 180
           VED+WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIEC+P+SGEITYGLERLAMY+Q+
Sbjct: 121 VEDDWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECAPVSGEITYGLERLAMYIQD 180

Query: 181 VNSVYDIVFNAIEG-QNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLK 239
           V++VYD+ FN ++G + + YGD+F Q+EQEYS YNFE+AN ++L  HFID+E+EC  LL 
Sbjct: 181 VSNVYDLNFNGLDGAERISYGDVFLQAEQEYSHYNFEFANIDLLQQHFIDAERECNALLD 240

Query: 240 KGIPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAF 299
            G PN+ +  HLCVFPAYDQCIKASHIFNLL ARGVIS TERQ YILRIR LA+ CGEAF
Sbjct: 241 SGKPNKENSSHLCVFPAYDQCIKASHIFNLLQARGVISVTERQSYILRIRDLARRCGEAF 300

Query: 300 LMTPNG 305
           L+T  G
Sbjct: 301 LLTEAG 306


>gi|2500992|sp|P77892|SYGA_MORCA RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|1657862|gb|AAB18211.1| glycyl-tRNA synthetase alpha subunit [Moraxella catarrhalis]
          Length = 318

 Score =  555 bits (1432), Expect = e-156,   Method: Composition-based stats.
 Identities = 183/300 (61%), Positives = 220/300 (73%), Gaps = 10/300 (3%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
            +    L+FQ +ILTL  YWA +GC +LQPYDMEVGAGTFH +T LRAL P  W  AYVQ
Sbjct: 1   MDSGETLTFQALILTLQNYWASRGCVVLQPYDMEVGAGTFHTATFLRALTPERWNTAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY +NPNRLQHYYQFQV++KPNP N+Q LY+ SLKA+GID L HDVRFVEDN
Sbjct: 61  PSRRPTDGRYGDNPNRLQHYYQFQVVLKPNPANIQELYLGSLKAIGIDTLTHDVRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WESPTLGAWGLGWE W +GME++QFTYFQQV GIEC P++GEITYGLERLAMY+Q V+SV
Sbjct: 121 WESPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGIECFPVTGEITYGLERLAMYIQGVDSV 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V+   E   V YGD+F Q+E E S YNFE+A+   L   F   E++   L+   +P 
Sbjct: 181 YDLVWADGEFGRVTYGDVFHQNEVEQSAYNFEHADVAKLFELFDFYEEQADKLVAVNLP- 239

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY+  +KASH FNLLDARG IS TERQR+ILR+R+LA+    ++     
Sbjct: 240 ---------LPAYEMVLKASHAFNLLDARGAISVTERQRFILRVRTLARKVAISYTEARA 290


>gi|317051557|ref|YP_004112673.1| glycyl-tRNA synthetase subunit alpha [Desulfurispirillum indicum
           S5]
 gi|316946641|gb|ADU66117.1| glycyl-tRNA synthetase, alpha subunit [Desulfurispirillum indicum
           S5]
          Length = 293

 Score =  555 bits (1432), Expect = e-156,   Method: Composition-based stats.
 Identities = 174/294 (59%), Positives = 220/294 (74%), Gaps = 14/294 (4%)

Query: 11  LSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPL 70
           ++FQ +IL L  YW++QGC ++QPYD+EVGAGTF+P+T LR+LGP  W  AYV+PSRRP 
Sbjct: 1   MTFQELILALQDYWSKQGCLVVQPYDIEVGAGTFNPATFLRSLGPEPWNVAYVEPSRRPT 60

Query: 71  DGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTL 130
           DGRY ENPNRLQHYYQFQV++KP+P N+  LY+ESLKA GIDPL HD+RFVED+WESPTL
Sbjct: 61  DGRYGENPNRLQHYYQFQVLLKPSPDNIVELYLESLKAFGIDPLKHDIRFVEDDWESPTL 120

Query: 131 GAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFN 190
           GAWGLGWE W DGMEI+QFTYFQQ  GI+ SP+SGEITYG+ER+AMY+Q V++VYD+ ++
Sbjct: 121 GAWGLGWEVWLDGMEITQFTYFQQCGGIDLSPVSGEITYGIERIAMYIQQVDNVYDLEWS 180

Query: 191 AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHH 250
               + V YGD++ ++E E+SRYNFE A+  +  + F   EKE L L+   +        
Sbjct: 181 ----RGVTYGDVYHRNEVEFSRYNFEQADVNMQFSLFDMYEKEALRLMDAQL-------- 228

Query: 251 LCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
             V PAYD  +K SH FN+LDARG IS TER  YI R+R LAK C E ++    
Sbjct: 229 --VLPAYDYTLKCSHAFNMLDARGAISVTERTSYIARVRHLAKLCAEGYVKLRA 280


>gi|159184400|ref|NP_353661.2| glycyl-tRNA synthetase subunit alpha [Agrobacterium tumefaciens
           str. C58]
 gi|30316250|sp|Q8UHP1|SYGA_AGRT5 RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|159139713|gb|AAK86446.2| glycyl-tRNA synthetase, alpha subunit [Agrobacterium tumefaciens
           str. C58]
          Length = 310

 Score =  555 bits (1432), Expect = e-156,   Method: Composition-based stats.
 Identities = 228/303 (75%), Positives = 261/303 (86%), Gaps = 3/303 (0%)

Query: 7   KKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPS 66
                SFQ +ILTL  YWA +GC +LQPYDMEVGAGTFHP+TTLRALGP  WKAAYVQPS
Sbjct: 1   MNPKRSFQALILTLHNYWADKGCAVLQPYDMEVGAGTFHPATTLRALGPKPWKAAYVQPS 60

Query: 67  RRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWE 126
           RRP DGRY ENPNRLQHYYQ+QVI+KPNP NLQ LY+ SLKA+G+DPL+HDVRFVED+WE
Sbjct: 61  RRPSDGRYGENPNRLQHYYQYQVILKPNPSNLQELYLGSLKAIGLDPLLHDVRFVEDDWE 120

Query: 127 SPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYD 186
           SPTLGAWGLGWECWCDGME+SQFTYFQQVCGIECSP++GE+TYGLERLAMYVQ V++VYD
Sbjct: 121 SPTLGAWGLGWECWCDGMEVSQFTYFQQVCGIECSPVAGELTYGLERLAMYVQGVDNVYD 180

Query: 187 IVFNAIEG-QNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIP-- 243
           + FN  EG + + YGD+F Q+EQEYSR+NFE+A+  +LH HFID+EKECL LL  G P  
Sbjct: 181 LNFNGREGEEKISYGDVFLQAEQEYSRHNFEFADTSMLHRHFIDAEKECLALLAAGAPGD 240

Query: 244 NEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTP 303
           N++ R H CVFPAYDQCIKASHIFNLL+ARGVIS TER+RYI R+R LAKACGEAFL+T 
Sbjct: 241 NDNQRLHKCVFPAYDQCIKASHIFNLLNARGVISVTERERYIARVRDLAKACGEAFLLTD 300

Query: 304 NGG 306
            GG
Sbjct: 301 AGG 303


>gi|261867205|ref|YP_003255127.1| glycyl-tRNA synthetase subunit alpha [Aggregatibacter
           actinomycetemcomitans D11S-1]
 gi|261412537|gb|ACX81908.1| glycyl-tRNA synthetase subunit alpha [Aggregatibacter
           actinomycetemcomitans D11S-1]
          Length = 301

 Score =  555 bits (1432), Expect = e-156,   Method: Composition-based stats.
 Identities = 181/297 (60%), Positives = 218/297 (73%), Gaps = 8/297 (2%)

Query: 9   NDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRR 68
           N  +FQ +IL L +YWA QGCT++QP+DMEVGAGT HP T LRALGP     AYVQPSRR
Sbjct: 5   NVKTFQGMILALQEYWANQGCTVVQPFDMEVGAGTSHPMTALRALGPEPMAFAYVQPSRR 64

Query: 69  PLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESP 128
           P DGRY ENPNRLQHYYQFQV+IKP+P N+Q LY++SLK +G DP  +D+RFVEDNWE+P
Sbjct: 65  PTDGRYGENPNRLQHYYQFQVVIKPSPDNIQELYLDSLKMLGFDPTQNDIRFVEDNWENP 124

Query: 129 TLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIV 188
           TLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLERLAMY+Q V+SVYD+V
Sbjct: 125 TLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGLERLAMYIQGVDSVYDLV 184

Query: 189 FNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHR 248
           ++        YGD+F Q+E E S YNFEYA+ + L   F   EKE   LL    P     
Sbjct: 185 WSDGPLGKTTYGDVFHQNEVEQSTYNFEYADTDFLFYCFDQYEKEAQSLLALEKP----- 239

Query: 249 HHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNG 305
                 PAY++ +KA+H FNLLDAR  IS TERQRYILRIR+L K   EA+  +   
Sbjct: 240 ---LPLPAYERILKAAHSFNLLDARKAISVTERQRYILRIRALTKGVAEAYYASREA 293


>gi|46143627|ref|ZP_00134816.2| COG0752: Glycyl-tRNA synthetase, alpha subunit [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|126209264|ref|YP_001054489.1| glycyl-tRNA synthetase subunit alpha [Actinobacillus
           pleuropneumoniae L20]
 gi|307262295|ref|ZP_07543944.1| Glycyl-tRNA synthetase alpha subunit [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
 gi|166200186|sp|A3N398|SYGA_ACTP2 RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|126098056|gb|ABN74884.1| Glycyl-tRNA synthetase alpha chain [Actinobacillus pleuropneumoniae
           serovar 5b str. L20]
 gi|306868058|gb|EFM99885.1| Glycyl-tRNA synthetase alpha subunit [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
          Length = 301

 Score =  555 bits (1432), Expect = e-156,   Method: Composition-based stats.
 Identities = 181/302 (59%), Positives = 219/302 (72%), Gaps = 8/302 (2%)

Query: 4   IHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYV 63
           +  K N  +FQ +IL L  YWA  GCTI+QP+DMEVGAGT HP T LRALGP     AYV
Sbjct: 1   MTTKFNVKTFQGMILALQDYWANVGCTIVQPFDMEVGAGTSHPMTALRALGPEPMAFAYV 60

Query: 64  QPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVED 123
           QPSRRP DGRY ENPNRLQHYYQFQV+IKP+P N+Q LY+ SLK +G DP  HD+RFVED
Sbjct: 61  QPSRRPTDGRYGENPNRLQHYYQFQVVIKPSPDNIQELYLGSLKMLGFDPTQHDIRFVED 120

Query: 124 NWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNS 183
           NWE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GE+TYGLERLAMY+Q V+S
Sbjct: 121 NWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEVTYGLERLAMYIQGVDS 180

Query: 184 VYDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIP 243
           VYD+V++        YGD+F Q+E E S YNFEYA+ + L   F   EKE  +LL    P
Sbjct: 181 VYDLVWSDGPLGKTTYGDVFHQNEVEQSTYNFEYADVDFLFKAFEQYEKEATELLALEKP 240

Query: 244 NEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTP 303
                      PAY++ +KA+H FN+LDAR  IS TERQRYILRIR+L K   EA+ ++ 
Sbjct: 241 --------LPLPAYERILKAAHSFNMLDARKAISVTERQRYILRIRTLTKGVAEAYYVSR 292

Query: 304 NG 305
             
Sbjct: 293 EA 294


>gi|118581463|ref|YP_902713.1| glycyl-tRNA synthetase subunit alpha [Pelobacter propionicus DSM
           2379]
 gi|166200233|sp|A1ATI5|SYGA_PELPD RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|118504173|gb|ABL00656.1| glycyl-tRNA synthetase alpha chain [Pelobacter propionicus DSM
           2379]
          Length = 292

 Score =  555 bits (1432), Expect = e-156,   Method: Composition-based stats.
 Identities = 172/294 (58%), Positives = 218/294 (74%), Gaps = 14/294 (4%)

Query: 11  LSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPL 70
           ++FQ++IL+L  YWA+QGC I QPYD E GAGTF+P+T LR LGP  W  AYV+PSRRP 
Sbjct: 1   MTFQDLILSLQGYWAKQGCIIQQPYDTEKGAGTFNPATFLRVLGPEPWNVAYVEPSRRPT 60

Query: 71  DGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTL 130
           DGRY ENPNRLQHYYQFQVI+KP+PLN+ + Y++SL+A G+DP  HD+RFVED+WESPTL
Sbjct: 61  DGRYGENPNRLQHYYQFQVIMKPSPLNILDRYLDSLRAFGLDPCKHDIRFVEDDWESPTL 120

Query: 131 GAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFN 190
           GAWGLGWE W DGMEI+QFTYFQQ  GI+  P+S EITYG ER+AMY+Q V++VYD+ + 
Sbjct: 121 GAWGLGWEVWLDGMEITQFTYFQQAGGIDLKPVSSEITYGCERIAMYLQGVDNVYDLEWV 180

Query: 191 AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHH 250
               + + YGDI  +SE E+S+YNFE A+ ++L   F   EKECL L+++ +        
Sbjct: 181 ----KGIKYGDIHHESEVEFSKYNFEEADVDMLLKLFGMYEKECLRLVERDL-------- 228

Query: 251 LCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
             V PAYD  +K SH FNLLDARG IS TER  YI R+R++A+ C E +L    
Sbjct: 229 --VLPAYDYVMKCSHAFNLLDARGAISVTERASYIGRVRNVARVCAEGYLRMRE 280


>gi|190151155|ref|YP_001969680.1| glycyl-tRNA synthetase subunit alpha [Actinobacillus
           pleuropneumoniae serovar 7 str. AP76]
 gi|307264504|ref|ZP_07546089.1| Glycyl-tRNA synthetase alpha subunit [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
 gi|238692360|sp|B3GZ52|SYGA_ACTP7 RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|189916286|gb|ACE62538.1| Glycyl-tRNA synthetase alpha chain [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
 gi|306870201|gb|EFN01960.1| Glycyl-tRNA synthetase alpha subunit [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
          Length = 304

 Score =  555 bits (1431), Expect = e-156,   Method: Composition-based stats.
 Identities = 181/302 (59%), Positives = 219/302 (72%), Gaps = 8/302 (2%)

Query: 4   IHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYV 63
           +  K N  +FQ +IL L  YWA  GCTI+QP+DMEVGAGT HP T LRALGP     AYV
Sbjct: 1   MTTKFNVKTFQGMILALQDYWANVGCTIVQPFDMEVGAGTSHPMTALRALGPEPMAFAYV 60

Query: 64  QPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVED 123
           QPSRRP DGRY ENPNRLQHYYQFQV+IKP+P N+Q LY+ SLK +G DP  HD+RFVED
Sbjct: 61  QPSRRPTDGRYGENPNRLQHYYQFQVVIKPSPDNIQELYLGSLKMLGFDPTQHDIRFVED 120

Query: 124 NWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNS 183
           NWE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GE+TYGLERLAMY+Q V+S
Sbjct: 121 NWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEVTYGLERLAMYIQGVDS 180

Query: 184 VYDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIP 243
           VYD+V++        YGD+F Q+E E S YNFEYA+ + L   F   EKE  +LL    P
Sbjct: 181 VYDLVWSDGPLGKTTYGDVFHQNEVEQSTYNFEYADVDFLFKAFEQYEKEATELLALEKP 240

Query: 244 NEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTP 303
                      PAY++ +KA+H FN+LDAR  IS TERQRYILRIR+L K   EA+ ++ 
Sbjct: 241 --------LPLPAYERILKAAHSFNMLDARKAISVTERQRYILRIRTLTKGVAEAYYVSR 292

Query: 304 NG 305
             
Sbjct: 293 EA 294


>gi|77358987|ref|YP_338562.1| glycyl-tRNA synthetase subunit alpha [Pseudoalteromonas
           haloplanktis TAC125]
 gi|123587077|sp|Q3IDE6|SYGA_PSEHT RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|76873898|emb|CAI85119.1| glycyl-tRNA synthetase, alpha subunit [Pseudoalteromonas
           haloplanktis TAC125]
          Length = 300

 Score =  555 bits (1431), Expect = e-156,   Method: Composition-based stats.
 Identities = 183/301 (60%), Positives = 221/301 (73%), Gaps = 10/301 (3%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +IL L  YWAQQGC I+QP DMEVGAGTFHP T L+++GP    +AYVQ
Sbjct: 1   MQKYDVKTFQGLILALQDYWAQQGCVIIQPLDMEVGAGTFHPQTFLKSIGPEPMSSAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           P RRP DGRY ENPNRLQHYYQFQV++KP+P N+Q LY+ SL AVGID L  +VRFVEDN
Sbjct: 61  PCRRPTDGRYGENPNRLQHYYQFQVVLKPSPDNIQELYLGSLAAVGIDTLTDEVRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WESPTLGAWGLGWE W +GME++QFTYFQQV GIECSP++GEITYGLERLAMY+Q V+S+
Sbjct: 121 WESPTLGAWGLGWEIWLNGMEVTQFTYFQQVGGIECSPVTGEITYGLERLAMYIQGVDSI 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V+       V YGD+F Q+E E S YNFE+AN E L   F   E E   L++  +P 
Sbjct: 181 YDLVWADGPLGRVTYGDVFHQNEVEQSTYNFEHANVEDLFAQFDKCEAESQKLIEANLP- 239

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY+Q +KASH FNLLDAR  IS TERQRYILR+R+L+KAC +++     
Sbjct: 240 ---------LPAYEQVMKASHAFNLLDARHAISVTERQRYILRVRALSKACAQSYYDKRE 290

Query: 305 G 305
            
Sbjct: 291 A 291


>gi|260575525|ref|ZP_05843523.1| glycyl-tRNA synthetase, alpha subunit [Rhodobacter sp. SW2]
 gi|259022168|gb|EEW25466.1| glycyl-tRNA synthetase, alpha subunit [Rhodobacter sp. SW2]
          Length = 307

 Score =  555 bits (1431), Expect = e-156,   Method: Composition-based stats.
 Identities = 196/303 (64%), Positives = 235/303 (77%), Gaps = 1/303 (0%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
                  SFQ IIL L  YW+ +GC +LQPYDMEVGAGTFHP+TTLRALG   W AAYVQ
Sbjct: 3   SKAAAPRSFQEIILRLMTYWSAKGCAVLQPYDMEVGAGTFHPATTLRALGSRPWAAAYVQ 62

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQ+QV+IKP+P +LQ LY+ SL+A+GID  +HD+RFVED+
Sbjct: 63  PSRRPTDGRYGENPNRLQHYYQYQVLIKPSPPDLQALYLGSLQAIGIDADLHDIRFVEDD 122

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WESPTLGAWGLGWE WCDGME+SQFTYFQQV G +C P++GE+TYGLERLAMYV  V+ V
Sbjct: 123 WESPTLGAWGLGWEVWCDGMEVSQFTYFQQVGGHDCRPVAGELTYGLERLAMYVLGVDHV 182

Query: 185 YDIVFNAIEGQ-NVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIP 243
            D+ FN  +    + YGDIF Q+EQEYSR+NF+ A+  +L  HF D+E EC  +L     
Sbjct: 183 MDMPFNDPDAPIPLKYGDIFRQTEQEYSRWNFDQADTAMLLQHFQDAEAECARILNAPGL 242

Query: 244 NEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTP 303
           ++  R  +   PAYDQCIKASH+FNLLDARGVIS TERQ YI R+R+LAKAC +AF++T 
Sbjct: 243 DKAGRLIVMAHPAYDQCIKASHLFNLLDARGVISVTERQAYIGRVRALAKACADAFVLTE 302

Query: 304 NGG 306
            GG
Sbjct: 303 AGG 305


>gi|226939675|ref|YP_002794748.1| glycyl-tRNA synthetase subunit alpha [Laribacter hongkongensis
           HLHK9]
 gi|254781827|sp|C1D4E5|SYGA_LARHH RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|226714601|gb|ACO73739.1| SygA [Laribacter hongkongensis HLHK9]
          Length = 299

 Score =  555 bits (1431), Expect = e-156,   Method: Composition-based stats.
 Identities = 178/297 (59%), Positives = 212/297 (71%), Gaps = 11/297 (3%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ IIL L  YW QQGC ILQP+DMEVGAGT HP+T LRA+GP  W AAYVQPSRRP
Sbjct: 1   MLTFQEIILKLQTYWGQQGCAILQPFDMEVGAGTSHPATCLRAIGPEPWNAAYVQPSRRP 60

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNRLQHYYQFQV +KPNP N+Q LY+ SL+ +GIDP +HD+RFVED+WE+PT
Sbjct: 61  KDGRYGENPNRLQHYYQFQVALKPNPDNIQELYLGSLRELGIDPTVHDIRFVEDDWENPT 120

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQQV GI+C P+ GEITYG+ERLAMY+Q V +VYD+V+
Sbjct: 121 LGAWGLGWEVWLNGMEVTQFTYFQQVGGIDCKPVLGEITYGIERLAMYLQGVENVYDLVW 180

Query: 190 N-AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHR 248
                GQ V YGD++ Q+E E S YNFEYAN   L   F   E E   LL          
Sbjct: 181 TVYPSGQVVTYGDVYHQNEVEQSTYNFEYANVPKLFELFSYYESEARRLLD--------- 231

Query: 249 HHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNG 305
                 PAY+  +KA H FNLLDARG IS TER  YI R+R+L++   +A+      
Sbjct: 232 -VPLALPAYEMVLKAGHTFNLLDARGAISVTERAAYIGRVRTLSRGVAQAYYNAREA 287


>gi|254486763|ref|ZP_05099968.1| glycyl-tRNA synthetase, alpha subunit [Roseobacter sp. GAI101]
 gi|214043632|gb|EEB84270.1| glycyl-tRNA synthetase, alpha subunit [Roseobacter sp. GAI101]
          Length = 312

 Score =  555 bits (1431), Expect = e-156,   Method: Composition-based stats.
 Identities = 199/301 (66%), Positives = 239/301 (79%), Gaps = 2/301 (0%)

Query: 8   KNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSR 67
           +   SFQ IIL L  YWA+QGC ILQPYDMEVGAGTFHP+TTLRALG   W AAYVQPSR
Sbjct: 6   QRPRSFQEIILALQTYWARQGCAILQPYDMEVGAGTFHPATTLRALGTNPWAAAYVQPSR 65

Query: 68  RPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWES 127
           RP DGRY ENPNRLQHYYQ+QV+IKP+P NLQ LY+ SL+A+GID  +HD+RFVED+WES
Sbjct: 66  RPTDGRYGENPNRLQHYYQYQVLIKPSPSNLQELYLGSLQAIGIDMALHDIRFVEDDWES 125

Query: 128 PTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDI 187
           PTLGAWGLGWE WCDGME+SQFTYFQQV G +C P+SGE+TYGLERLAMYV  V+ V D+
Sbjct: 126 PTLGAWGLGWEVWCDGMEVSQFTYFQQVGGHDCHPVSGELTYGLERLAMYVLGVDHVMDM 185

Query: 188 VFNAIEGQ-NVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKK-GIPNE 245
            FN  +    + YGD+F Q+E+EY+R+NF+ AN E+L +HF+++E EC  +L +     +
Sbjct: 186 PFNDPDAPIPLSYGDVFKQTEEEYARWNFDVANTEVLLDHFVEAENECQSILSQGATDPK 245

Query: 246 HHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNG 305
             +  +   PAYDQCIKASHIFNLLDARGVIS TERQ YI R+R+LAKAC +AF+ T  G
Sbjct: 246 TGKRIIMAHPAYDQCIKASHIFNLLDARGVISVTERQAYIGRVRTLAKACADAFVQTRAG 305

Query: 306 G 306
           G
Sbjct: 306 G 306


>gi|326573919|gb|EGE23869.1| glycyl-tRNA synthetase subunit alpha [Moraxella catarrhalis O35E]
          Length = 312

 Score =  555 bits (1431), Expect = e-156,   Method: Composition-based stats.
 Identities = 185/300 (61%), Positives = 221/300 (73%), Gaps = 10/300 (3%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
            +    L+FQ +ILTL  YWA +GC +LQPYDMEVGAGTFH +T LRAL P  W AAYVQ
Sbjct: 1   MDSGETLTFQALILTLQNYWASRGCVVLQPYDMEVGAGTFHTATFLRALTPERWNAAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY +NPNRLQHYYQFQV++KPNP N+Q LY+ SLKA+GID L HDVRFVEDN
Sbjct: 61  PSRRPTDGRYGDNPNRLQHYYQFQVVLKPNPANIQELYLGSLKAIGIDTLTHDVRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WESPTLGAWGLGWE W +GME++QFTYFQQV GIEC P++GEITYGLERLAMY+Q V+SV
Sbjct: 121 WESPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGIECFPVTGEITYGLERLAMYIQGVDSV 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V+   E   V YGD+F Q+E E S YNFE+AN   L   F   E++   L+   +P 
Sbjct: 181 YDLVWADGEFGRVTYGDVFHQNEVEQSAYNFEHANVAKLFELFDFYEEQADKLVAVNLP- 239

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY+  +KASH FNLLDARG IS TERQR+ILR+R+LA+    ++     
Sbjct: 240 ---------LPAYEMVLKASHAFNLLDARGAISVTERQRFILRVRTLARKVAISYTEARA 290


>gi|326561408|gb|EGE11758.1| glycyl-tRNA synthetase subunit alpha [Moraxella catarrhalis
           46P47B1]
 gi|326572305|gb|EGE22300.1| glycyl-tRNA synthetase subunit alpha [Moraxella catarrhalis BC8]
          Length = 318

 Score =  555 bits (1430), Expect = e-156,   Method: Composition-based stats.
 Identities = 184/300 (61%), Positives = 221/300 (73%), Gaps = 10/300 (3%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
            +    L+FQ +ILTL  YWA +GC +LQPYDMEVGAGTFH +T LRAL P  W AAYVQ
Sbjct: 1   MDSGETLTFQALILTLQNYWASRGCVVLQPYDMEVGAGTFHTATFLRALTPERWNAAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY +NPNRLQHYYQFQV++KPNP N+Q LY+ SLKA+GID L HDVRFVEDN
Sbjct: 61  PSRRPTDGRYGDNPNRLQHYYQFQVVLKPNPANIQELYLGSLKAIGIDTLTHDVRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WESPTLGAWGLGWE W +GME++QFTYFQQV GIEC P++GEITYGLERLAMY+Q V+SV
Sbjct: 121 WESPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGIECFPVTGEITYGLERLAMYIQGVDSV 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V+   E   V YGD+F Q+E E S YNFE+A+   L   F   E++   L+   +P 
Sbjct: 181 YDLVWADGEFGRVTYGDVFHQNEVEQSTYNFEHADVAKLFELFDFYEEQADKLVVVNLP- 239

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY+  +KASH FNLLDARG IS TERQR+ILR+R+LA+    ++     
Sbjct: 240 ---------LPAYEMVLKASHAFNLLDARGAISVTERQRFILRVRTLARKVAISYTEARA 290


>gi|113461375|ref|YP_719444.1| glycyl-tRNA synthetase subunit alpha [Haemophilus somnus 129PT]
 gi|112823418|gb|ABI25507.1| glycyl-tRNA synthetase alpha chain [Haemophilus somnus 129PT]
          Length = 303

 Score =  555 bits (1430), Expect = e-156,   Method: Composition-based stats.
 Identities = 180/302 (59%), Positives = 221/302 (73%), Gaps = 8/302 (2%)

Query: 4   IHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYV 63
           I+ K N  +FQ +IL L  +WA +GC+++QP+DMEVGAGT HP T LRALGP     AYV
Sbjct: 2   INTKFNVKTFQGMILALQDFWASKGCSVVQPFDMEVGAGTSHPMTCLRALGPEPMAFAYV 61

Query: 64  QPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVED 123
           QPSRRP DGRY ENPNRLQHYYQFQV+IKP+P N+Q LY++SLK +G DP  +D+RFVED
Sbjct: 62  QPSRRPTDGRYGENPNRLQHYYQFQVVIKPSPDNIQELYLDSLKMLGFDPTQNDIRFVED 121

Query: 124 NWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNS 183
           NWE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLERLAMY+Q V+S
Sbjct: 122 NWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGLERLAMYIQGVDS 181

Query: 184 VYDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIP 243
           VYD+V++  E     YGD+F Q+E E S YNFEYA+   L + F   EKE   L+    P
Sbjct: 182 VYDLVWSDGEFGKTTYGDVFHQNEVEQSTYNFEYADVNFLFHCFEQYEKEAQYLIDLEKP 241

Query: 244 NEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTP 303
                      PAY++ +KA+H FNLLDAR  IS TERQRYILRIR+L K   EA+  + 
Sbjct: 242 --------LPLPAYERILKAAHSFNLLDARKAISVTERQRYILRIRALTKGVAEAYYASR 293

Query: 304 NG 305
             
Sbjct: 294 EA 295


>gi|148265693|ref|YP_001232399.1| glycyl-tRNA synthetase subunit alpha [Geobacter uraniireducens Rf4]
 gi|189082253|sp|A5G7Q8|SYGA_GEOUR RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|146399193|gb|ABQ27826.1| glycyl-tRNA synthetase alpha chain [Geobacter uraniireducens Rf4]
          Length = 291

 Score =  555 bits (1430), Expect = e-156,   Method: Composition-based stats.
 Identities = 174/294 (59%), Positives = 219/294 (74%), Gaps = 14/294 (4%)

Query: 11  LSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPL 70
           ++FQ++IL+L  YWA+QGC I QPYD E GAGTF+P+T LR LGP  W  AYV+PSRRP 
Sbjct: 1   MTFQDLILSLQGYWAKQGCVIQQPYDCEKGAGTFNPATFLRVLGPEPWNVAYVEPSRRPT 60

Query: 71  DGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTL 130
           DGRY ENPNRLQHYYQFQVI+KP+P+N+ +LY++SL++ GI+P  HD+RFVED+WESPTL
Sbjct: 61  DGRYGENPNRLQHYYQFQVIMKPSPMNILDLYLDSLRSFGINPNQHDIRFVEDDWESPTL 120

Query: 131 GAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFN 190
           GAWGLGWE W DGMEI+QFTYFQQ  GI+  P+S EITYG ER+AMY+Q V++VYD+ + 
Sbjct: 121 GAWGLGWEVWLDGMEITQFTYFQQAGGIDLKPVSSEITYGCERIAMYLQGVDNVYDLEWV 180

Query: 191 AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHH 250
               + V YGDI  +SE E+S YNFE A+ E+L   F   EKEC+ L++KG+        
Sbjct: 181 ----KGVRYGDIHHESEVEFSTYNFEEADVEMLLQLFGMYEKECVRLVEKGL-------- 228

Query: 251 LCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
             V PAYD  +K SH FNLLDARG IS TER  YI ++R++AK C E +L    
Sbjct: 229 --VLPAYDYVMKCSHTFNLLDARGAISVTERASYIGKVRNVAKLCAEGYLQMRE 280


>gi|119383290|ref|YP_914346.1| glycyl-tRNA synthetase subunit alpha [Paracoccus denitrificans
           PD1222]
 gi|166980032|sp|A1AZF6|SYGA_PARDP RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|119373057|gb|ABL68650.1| glycyl-tRNA synthetase alpha chain [Paracoccus denitrificans
           PD1222]
          Length = 316

 Score =  555 bits (1430), Expect = e-156,   Method: Composition-based stats.
 Identities = 194/302 (64%), Positives = 228/302 (75%), Gaps = 1/302 (0%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
           +     + FQ++IL L  YWA QGC +LQPYDMEVGAGTFHP+TTLR+LG   W AAYVQ
Sbjct: 7   NQTAKPVCFQDVILRLQSYWAAQGCAVLQPYDMEVGAGTFHPATTLRSLGARPWAAAYVQ 66

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQ+QVIIKP+P NLQ LY+ SL A+G+DP+IHDVRFVED+
Sbjct: 67  PSRRPTDGRYGENPNRLQHYYQYQVIIKPSPPNLQELYLGSLAAIGLDPMIHDVRFVEDD 126

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WESPTLGAWGLGWE WCDGME+SQFTYFQQV G +C P+SGE+TYGLERLAMYV  V  V
Sbjct: 127 WESPTLGAWGLGWEVWCDGMEVSQFTYFQQVGGHDCRPVSGELTYGLERLAMYVLGVEHV 186

Query: 185 YDIVFNAIEGQ-NVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIP 243
            D+ FN       + YGD+F Q+E+EYSR+NFE A+  +L  HF D+E EC  +L     
Sbjct: 187 MDMPFNPPGSPIPLSYGDVFRQAEREYSRWNFEQADTGMLLQHFKDAEAECDRILTAAET 246

Query: 244 NEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTP 303
           +   R      PAYDQ IKASH+FNLLDARGVIS TERQ YI R+R+LAK C + F+ T 
Sbjct: 247 DSAGRRIPMAHPAYDQAIKASHLFNLLDARGVISVTERQAYIGRVRALAKRCADLFVTTE 306

Query: 304 NG 305
             
Sbjct: 307 AA 308


>gi|294669046|ref|ZP_06734132.1| glycyl-tRNA synthetase, alpha subunit [Neisseria elongata subsp.
           glycolytica ATCC 29315]
 gi|291309038|gb|EFE50281.1| glycyl-tRNA synthetase, alpha subunit [Neisseria elongata subsp.
           glycolytica ATCC 29315]
          Length = 311

 Score =  555 bits (1430), Expect = e-156,   Method: Composition-based stats.
 Identities = 170/298 (57%), Positives = 219/298 (73%), Gaps = 8/298 (2%)

Query: 9   NDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRR 68
             L+FQ II  L  +WA +GCT++QP+DMEVGAGT HP+T LRALGP  W AAYVQPSRR
Sbjct: 11  TMLTFQEIIFKLQTFWADKGCTVIQPFDMEVGAGTSHPATCLRALGPEPWFAAYVQPSRR 70

Query: 69  PLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESP 128
           P DGRY +NPNRLQHYYQFQV +KP P N+Q+LY++SL+ +GIDP +HD+RFVED+WE+P
Sbjct: 71  PKDGRYGDNPNRLQHYYQFQVALKPAPANIQDLYLDSLRELGIDPKVHDIRFVEDDWENP 130

Query: 129 TLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIV 188
           TLGAWGLGWE W +GME++QFTYFQQV GI+C+P+ GEITYG+ERLAMY+Q V +VYD+V
Sbjct: 131 TLGAWGLGWEVWLNGMEVTQFTYFQQVGGIDCTPVLGEITYGIERLAMYLQGVENVYDLV 190

Query: 189 FNAI-EGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHH 247
           +    +G  V YGD++ Q+E E S YNFEY++ + L   F D E +   LL +       
Sbjct: 191 WAKTLDGNTVTYGDVYHQNEVEQSTYNFEYSDADWLLRQFNDYEAQAKRLLAE------- 243

Query: 248 RHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNG 305
            +     PAY+  +KA H FNLLDARG IS TER  YI RIR+L++   + ++ +   
Sbjct: 244 ENASLALPAYELVLKAGHTFNLLDARGAISVTERATYIGRIRALSRIVAQKYVESREA 301


>gi|37222171|gb|AAP70374.1| GlyQ [uncultured bacterium]
          Length = 316

 Score =  555 bits (1430), Expect = e-156,   Method: Composition-based stats.
 Identities = 176/302 (58%), Positives = 225/302 (74%), Gaps = 11/302 (3%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             + +  +FQ +IL L  YWA+QGC ILQP D+EVGAGTFHP+T LRA+GP +W  AYVQ
Sbjct: 3   EKRYDVSTFQGLILALQDYWARQGCVILQPLDLEVGAGTFHPATFLRAIGPETWNTAYVQ 62

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           P RRP DGRY ENPNRLQHYYQFQV +KP+P N+Q+LY+ SL+ +GID  +HD+RFVEDN
Sbjct: 63  PCRRPKDGRYGENPNRLQHYYQFQVALKPSPANIQDLYLGSLREMGIDTSVHDIRFVEDN 122

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WESPTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYG+ER+AMY+Q V+S+
Sbjct: 123 WESPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECFPVTGEITYGIERIAMYLQGVDSI 182

Query: 185 YDIVFN-AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIP 243
           +D+V+     G  V YGD+F Q+E E S YNFE A+ E   N F   E+E   L++KG+P
Sbjct: 183 FDLVWTINPNGDKVTYGDVFHQNEVEMSTYNFEEADTEFFFNSFDVYERESQRLMEKGLP 242

Query: 244 NEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTP 303
                      PAY+  +KASH FNLLDAR  IS TERQR+ILR+R+L++A  +A+  + 
Sbjct: 243 ----------LPAYEMVMKASHAFNLLDARHAISVTERQRFILRVRTLSRAVAQAYYDSR 292

Query: 304 NG 305
             
Sbjct: 293 KA 294


>gi|147677234|ref|YP_001211449.1| glycyl-tRNA synthetase subunit alpha [Pelotomaculum
           thermopropionicum SI]
 gi|189082256|sp|A5D3W9|SYGA_PELTS RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|146273331|dbj|BAF59080.1| glycyl-tRNA synthetase, alpha subunit [Pelotomaculum
           thermopropionicum SI]
          Length = 292

 Score =  555 bits (1430), Expect = e-156,   Method: Composition-based stats.
 Identities = 169/295 (57%), Positives = 217/295 (73%), Gaps = 14/295 (4%)

Query: 11  LSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPL 70
           ++FQ +ILTL  +WA+Q C I QPYD+E GAGT +P+T LRALGP  W+ AYV+PSRRP 
Sbjct: 1   MNFQELILTLDNFWARQNCIIQQPYDVEKGAGTMNPATFLRALGPEPWRVAYVEPSRRPT 60

Query: 71  DGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTL 130
           DGRY ENPNRLQHYYQ+QVI+KP+P ++  +Y++SLKA+GIDP  HD+RFVEDNWESPTL
Sbjct: 61  DGRYGENPNRLQHYYQYQVILKPSPDDVLEVYLDSLKAIGIDPDEHDIRFVEDNWESPTL 120

Query: 131 GAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFN 190
           GAWGLGWE W DGME++QFTYFQQ  GI+C P+S EITYGLERLAM++Q V++V+DI + 
Sbjct: 121 GAWGLGWEVWLDGMEVTQFTYFQQCGGIDCRPVSAEITYGLERLAMFIQGVDNVFDITWV 180

Query: 191 AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHH 250
                 + YGD+  + E E+S YNFE A+ E+L   F   E+E L +++KG         
Sbjct: 181 ----DGITYGDVHHRGEVEHSHYNFELADTEMLFKLFDMYEREALRVVEKGF-------- 228

Query: 251 LCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNG 305
             V PAYD  +K SH FNLLDARG IS TER  +I R+R+LA+ C +A++     
Sbjct: 229 --VLPAYDYVLKCSHTFNLLDARGAISVTERTGFIGRVRNLARTCAQAYIEQRQA 281


>gi|163855084|ref|YP_001629382.1| glycyl-tRNA synthetase subunit alpha [Bordetella petrii DSM 12804]
 gi|163258812|emb|CAP41111.1| glycyl-tRNA synthetase alpha chain [Bordetella petrii]
          Length = 328

 Score =  554 bits (1429), Expect = e-156,   Method: Composition-based stats.
 Identities = 179/301 (59%), Positives = 222/301 (73%), Gaps = 11/301 (3%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
           ++K   L+FQ IILTL  YW +QGC +LQPYDMEVGAGT H +T LRA+GP  W+AAYVQ
Sbjct: 22  NSKNPMLTFQQIILTLQDYWDKQGCALLQPYDMEVGAGTSHTATFLRAIGPEPWRAAYVQ 81

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQ+QV++KP P  + +LYI SLKA+GIDP  HD+RFVED+
Sbjct: 82  PSRRPKDGRYGENPNRLQHYYQYQVVLKPAPPEILDLYIGSLKALGIDPTRHDIRFVEDD 141

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G++C+P +GEITYGLERLAMY+Q V SV
Sbjct: 142 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLDCTPTTGEITYGLERLAMYLQGVESV 201

Query: 185 YDIVFN-AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIP 243
           YD+V+     G  VLY D+F Q+E E S YNFE+A+ ++L  HF D E E   L+     
Sbjct: 202 YDLVWTEGAHGNRVLYRDVFHQNEVEQSTYNFEHASADMLFAHFNDYETEAKRLMD---- 257

Query: 244 NEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTP 303
                      PAY+  +KA+H FNLLDARG IS TER  YI RIR+L++A  +A+  + 
Sbjct: 258 ------VPLALPAYEATLKAAHTFNLLDARGAISVTERAAYIGRIRNLSRAVAQAYYDSR 311

Query: 304 N 304
            
Sbjct: 312 E 312


>gi|149201984|ref|ZP_01878958.1| glycyl-tRNA synthetase subunit alpha [Roseovarius sp. TM1035]
 gi|149145032|gb|EDM33061.1| glycyl-tRNA synthetase subunit alpha [Roseovarius sp. TM1035]
          Length = 309

 Score =  554 bits (1429), Expect = e-156,   Method: Composition-based stats.
 Identities = 192/301 (63%), Positives = 236/301 (78%), Gaps = 2/301 (0%)

Query: 9   NDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRR 68
              SFQ IIL L  YWA QGC ++QPYDMEVGAGTFHP+TTLR+LG   W AAYVQPSRR
Sbjct: 7   KPRSFQEIILRLQSYWAAQGCAMMQPYDMEVGAGTFHPATTLRSLGSKPWAAAYVQPSRR 66

Query: 69  PLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESP 128
           P DGRY ENPNRLQHYYQ+QV+IKP+P ++Q+LY+ SL+A+GID  +HD+RFVED+WESP
Sbjct: 67  PTDGRYGENPNRLQHYYQYQVLIKPSPPDMQDLYLGSLRAIGIDMGLHDIRFVEDDWESP 126

Query: 129 TLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIV 188
           TLGAWGLGWE WCDGME+SQFTYFQQV G +C+P+SGE+TYGLERLAMYV  ++ V D+ 
Sbjct: 127 TLGAWGLGWEVWCDGMEVSQFTYFQQVGGHDCAPVSGELTYGLERLAMYVLGIDHVMDMP 186

Query: 189 FNAIEGQ-NVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLD-LLKKGIPNEH 246
           FN       + YGD+F Q+E+EYSR+NF+ AN E+L  HF ++E EC   L ++ +  + 
Sbjct: 187 FNDPAAPIPLNYGDVFRQTEEEYSRWNFDVANTEVLLRHFEEAEAECQATLAQEAVDPKT 246

Query: 247 HRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNGG 306
            +  +   PAYDQCIKASH+FNLLDARGVIS TERQ YI R+R+LAK C +AF+ T  GG
Sbjct: 247 GKRIIMAHPAYDQCIKASHLFNLLDARGVISVTERQAYIGRVRALAKQCADAFVQTEAGG 306

Query: 307 H 307
            
Sbjct: 307 Q 307


>gi|319408197|emb|CBI81850.1| glycyl-tRNA synthetase alpha chain [Bartonella schoenbuchensis R1]
          Length = 314

 Score =  554 bits (1429), Expect = e-156,   Method: Composition-based stats.
 Identities = 217/299 (72%), Positives = 252/299 (84%), Gaps = 1/299 (0%)

Query: 8   KNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSR 67
               SFQ +ILTL  YWAQ GC ILQPYDMEVGAGTFHP+TTLR+LGP  WK AYVQPSR
Sbjct: 8   NPARSFQGLILTLQNYWAQYGCAILQPYDMEVGAGTFHPATTLRSLGPRPWKVAYVQPSR 67

Query: 68  RPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWES 127
           RP DGRY +NPNRLQHYYQFQV++KP+P +LQ LYI SL+A+G+D  +HD+RFVED+WES
Sbjct: 68  RPADGRYGKNPNRLQHYYQFQVLLKPSPPDLQELYINSLQAIGLDTKLHDIRFVEDDWES 127

Query: 128 PTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDI 187
           PTLGAWGLGWECWCDGMEISQFTYFQQVCGIEC P+SGEITYGLERLAMY+Q V++VYD+
Sbjct: 128 PTLGAWGLGWECWCDGMEISQFTYFQQVCGIECMPVSGEITYGLERLAMYIQGVDNVYDL 187

Query: 188 VFNAIEG-QNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEH 246
            FN ++G   + Y DIF Q+EQEYS YNFE+A+ ++LH HFID+E+EC+ LL+ G PN+ 
Sbjct: 188 NFNGLDGANKISYRDIFLQAEQEYSHYNFEFADTKLLHQHFIDAERECIALLEVGKPNKE 247

Query: 247 HRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNG 305
           + +H CV PAYDQCIKASHIFNLL ARGVIS TERQ YILRIR LA+ CGEAFL T  G
Sbjct: 248 NSYHQCVLPAYDQCIKASHIFNLLQARGVISVTERQSYILRIRDLARRCGEAFLSTEAG 306


>gi|327478622|gb|AEA81932.1| glycyl-tRNA synthetase subunit alpha [Pseudomonas stutzeri DSM
           4166]
          Length = 315

 Score =  554 bits (1429), Expect = e-156,   Method: Composition-based stats.
 Identities = 179/293 (61%), Positives = 223/293 (76%), Gaps = 10/293 (3%)

Query: 12  SFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPLD 71
           +FQ++IL L  YWA+QGC +LQPYDME+GAGTFH +T LRA+GP +W AAYVQPSRRP D
Sbjct: 10  TFQDLILALQSYWAEQGCVVLQPYDMEMGAGTFHTATFLRAIGPETWNAAYVQPSRRPAD 69

Query: 72  GRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTLG 131
           GRY ENPNRLQHYYQFQV++KPNP N+Q+LY+ESL+ +G+D  +HDVRFVEDNWESPTLG
Sbjct: 70  GRYGENPNRLQHYYQFQVVLKPNPDNIQDLYLESLRRIGVDTSVHDVRFVEDNWESPTLG 129

Query: 132 AWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFNA 191
           AWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLERLAMY+Q V+SVYD+++  
Sbjct: 130 AWGLGWEVWLNGMEVTQFTYFQQVGGVECYPVTGEITYGLERLAMYLQGVDSVYDLIWAD 189

Query: 192 IEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHHL 251
                V YGD+F Q+E E S YNFE+AN   L   F   E E   L+   +P        
Sbjct: 190 GPFGTVTYGDVFHQNEVEQSTYNFEHANVPKLFELFDFYESEANRLMAAELP-------- 241

Query: 252 CVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
              PAY+  +KASH FNLLDAR  IS T RQ+YILR+RSLA++  +++L+   
Sbjct: 242 --LPAYEMVVKASHTFNLLDARRAISVTARQQYILRVRSLARSIAQSYLLARA 292


>gi|213585397|ref|ZP_03367223.1| glycyl-tRNA synthetase subunit alpha [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-0664]
          Length = 295

 Score =  554 bits (1429), Expect = e-156,   Method: Composition-based stats.
 Identities = 184/293 (62%), Positives = 217/293 (74%), Gaps = 8/293 (2%)

Query: 13  FQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPLDG 72
           FQ +ILTL  YWA+QGCTI+QP DMEVGAGT HP T LRALGP     AYVQPSRRP DG
Sbjct: 1   FQGLILTLQDYWARQGCTIVQPLDMEVGAGTSHPMTCLRALGPEPMATAYVQPSRRPTDG 60

Query: 73  RYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTLGA 132
           RY ENPNRLQHYYQFQV+IKP+P N+Q LY+ SLK +G+DP IHD+RFVEDNWE+PTLGA
Sbjct: 61  RYGENPNRLQHYYQFQVVIKPSPENIQELYLGSLKELGMDPTIHDIRFVEDNWENPTLGA 120

Query: 133 WGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFNAI 192
           WGLGWE W +GME++QFTYFQQV G+EC  ++GEITYGLERLAMY+Q V+SVYD+V++  
Sbjct: 121 WGLGWEVWLNGMEVTQFTYFQQVGGLECKLVTGEITYGLERLAMYIQGVDSVYDLVWSDG 180

Query: 193 EGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHHLC 252
                 YGD+F Q+E E S YNFEYA+ + L   F   EKE   LL    P         
Sbjct: 181 PLGKTTYGDVFHQNEVEQSTYNFEYADVDFLFTCFEQYEKEAQQLLALENP--------L 232

Query: 253 VFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNG 305
             PAY++ +KA+H FNLLDAR  IS TERQRYILRIR+L KA  EA+  +   
Sbjct: 233 PLPAYERILKAAHSFNLLDARKAISVTERQRYILRIRTLTKAVAEAYYASREA 285


>gi|119947320|ref|YP_945000.1| glycyl-tRNA synthetase subunit alpha [Psychromonas ingrahamii 37]
 gi|166200565|sp|A1T0Y6|SYGA_PSYIN RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|119865924|gb|ABM05401.1| glycyl-tRNA synthetase alpha subunit [Psychromonas ingrahamii 37]
          Length = 302

 Score =  554 bits (1429), Expect = e-156,   Method: Composition-based stats.
 Identities = 179/301 (59%), Positives = 223/301 (74%), Gaps = 10/301 (3%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +IL L  +WA+QGC I+QP DMEVGAGTFHP T LR++GP    +AYVQ
Sbjct: 1   MQKFDTKTFQGLILALQDFWARQGCAIVQPLDMEVGAGTFHPQTFLRSIGPEPMNSAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           P RRP DGRY ENPNRLQ YYQFQV++KP+P N+Q+LY++SL+ +GID  IHD+RFVEDN
Sbjct: 61  PCRRPTDGRYGENPNRLQQYYQFQVVLKPSPKNIQDLYLKSLEEIGIDTSIHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WESPTLGAWGLGWE W +GME++QFTYFQQV G+ECSP++GEITYGLER+AMYVQ V S+
Sbjct: 121 WESPTLGAWGLGWEIWLNGMEVTQFTYFQQVGGLECSPVTGEITYGLERIAMYVQGVESI 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V+       + YGDIF Q+E E S YNFE+A+ + L N F   EK+   L++ G+  
Sbjct: 181 YDLVWTDGPMGKLTYGDIFHQNEVEQSSYNFEHADVDALFNQFNQCEKDSQKLIEAGL-- 238

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY+Q +KASH FNLLDAR  IS TERQRYILR+R+L+KA  EA+     
Sbjct: 239 --------ALPAYEQVMKASHAFNLLDARHAISVTERQRYILRVRALSKAVAEAYYGKRE 290

Query: 305 G 305
            
Sbjct: 291 A 291


>gi|49475214|ref|YP_033255.1| glycyl-tRNA synthetase subunit alpha [Bartonella henselae str.
           Houston-1]
 gi|49238019|emb|CAF27225.1| Glycyl-tRNA synthetase alpha chain [Bartonella henselae str.
           Houston-1]
          Length = 317

 Score =  554 bits (1429), Expect = e-156,   Method: Composition-based stats.
 Identities = 219/299 (73%), Positives = 256/299 (85%), Gaps = 1/299 (0%)

Query: 8   KNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSR 67
               SFQ +ILTL  YWA  GC ILQPYDMEVGAGTFHP+TTLR+LGP  WK AYVQPSR
Sbjct: 8   NPTRSFQGLILTLQNYWAHYGCAILQPYDMEVGAGTFHPATTLRSLGPRPWKVAYVQPSR 67

Query: 68  RPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWES 127
           RP DGRY +NPNRLQHYYQFQV++KP+P NLQ+LYI+SL+A+G+D ++HD+RFVED+WES
Sbjct: 68  RPTDGRYGQNPNRLQHYYQFQVLLKPSPPNLQDLYIKSLQAIGLDTMLHDIRFVEDDWES 127

Query: 128 PTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDI 187
           PTLGAWGLGWECWCDGMEISQFTYFQQVCGIEC P+SGEITYGLERLAMY+Q V++VYD+
Sbjct: 128 PTLGAWGLGWECWCDGMEISQFTYFQQVCGIECVPVSGEITYGLERLAMYIQGVDNVYDL 187

Query: 188 VFNAIEGQN-VLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEH 246
            FN +E +N + Y DIF Q+EQEYS YNFE+A+ ++LH HFID+E+EC+ LL  G PN+ 
Sbjct: 188 NFNGLEEENQISYRDIFLQAEQEYSHYNFEFADTKLLHQHFIDAERECIALLGAGKPNKE 247

Query: 247 HRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNG 305
           +  HLCVFPAYDQCIKASHIFNLL ARGVIS TERQ YILR+R LA+ CGEAFL+T  G
Sbjct: 248 NSSHLCVFPAYDQCIKASHIFNLLQARGVISVTERQSYILRVRDLARRCGEAFLLTEAG 306


>gi|261494662|ref|ZP_05991142.1| glycine--tRNA ligase [Mannheimia haemolytica serotype A2 str.
           OVINE]
 gi|261309627|gb|EEY10850.1| glycine--tRNA ligase [Mannheimia haemolytica serotype A2 str.
           OVINE]
          Length = 302

 Score =  554 bits (1429), Expect = e-156,   Method: Composition-based stats.
 Identities = 181/302 (59%), Positives = 219/302 (72%), Gaps = 8/302 (2%)

Query: 4   IHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYV 63
           +  K N  +FQ +IL L  YWA +GCTI+QP+D+EVGAGT HP T LRALGP     AYV
Sbjct: 1   MSTKFNVKTFQGMILALQDYWASKGCTIVQPFDLEVGAGTSHPMTCLRALGPEPMAFAYV 60

Query: 64  QPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVED 123
           QPSRRP DGRY ENPNRLQHYYQFQV+IKP+P N+Q LY++SLK +G DP  +D+RFVED
Sbjct: 61  QPSRRPTDGRYGENPNRLQHYYQFQVVIKPSPDNIQELYLDSLKMLGFDPTQNDIRFVED 120

Query: 124 NWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNS 183
           NWE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLERLAMY+Q V+S
Sbjct: 121 NWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGLERLAMYIQGVDS 180

Query: 184 VYDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIP 243
           VYD+V++  E     YGD+F Q+E E S YNFEYA+ + L   F   EKE   LL     
Sbjct: 181 VYDLVWSDGELGKTTYGDVFHQNEVEQSTYNFEYADVDFLFQCFEQYEKEVQYLL----- 235

Query: 244 NEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTP 303
                      PAY++ +KA+H FNLLDAR  IS TERQRYILRIR+L K   EA+  + 
Sbjct: 236 ---GLEKPLPLPAYERILKAAHSFNLLDARKAISVTERQRYILRIRALTKGVAEAYYASR 292

Query: 304 NG 305
             
Sbjct: 293 EA 294


>gi|326567138|gb|EGE17260.1| glycyl-tRNA synthetase subunit alpha [Moraxella catarrhalis BC1]
          Length = 312

 Score =  554 bits (1429), Expect = e-156,   Method: Composition-based stats.
 Identities = 184/300 (61%), Positives = 221/300 (73%), Gaps = 10/300 (3%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
            +    L+FQ +ILTL  YWA +GC +LQPYDMEVGAGTFH +T LRAL P  W AAYVQ
Sbjct: 1   MDSGETLTFQALILTLQNYWASRGCVVLQPYDMEVGAGTFHTATFLRALTPERWNAAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY +NPNRLQHYYQFQV++KPNP N+Q LY+ SLKA+GID L HDVRFVEDN
Sbjct: 61  PSRRPTDGRYGDNPNRLQHYYQFQVVLKPNPANIQELYLGSLKAIGIDTLTHDVRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WESPTLGAWGLGWE W +GME++QFTYFQQV GIEC P++GEITYGLERLAMY+Q V+SV
Sbjct: 121 WESPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGIECFPVTGEITYGLERLAMYIQGVDSV 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V+   E   V YGD+F Q+E E S YNFE+A+   L   F   E++   L+   +P 
Sbjct: 181 YDLVWADGEFGRVTYGDVFHQNEVEQSTYNFEHADVAKLFELFDFYEEQADKLVVVNLP- 239

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY+  +KASH FNLLDARG IS TERQR+ILR+R+LA+    ++     
Sbjct: 240 ---------LPAYEMVLKASHAFNLLDARGAISVTERQRFILRVRTLARKVAISYTEARA 290


>gi|95929741|ref|ZP_01312482.1| Glycine--tRNA ligase [Desulfuromonas acetoxidans DSM 684]
 gi|95134037|gb|EAT15695.1| Glycine--tRNA ligase [Desulfuromonas acetoxidans DSM 684]
          Length = 289

 Score =  554 bits (1428), Expect = e-156,   Method: Composition-based stats.
 Identities = 179/294 (60%), Positives = 217/294 (73%), Gaps = 14/294 (4%)

Query: 11  LSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPL 70
           ++FQ++IL+L  YWAQQGC I QPYD+E GAGTF+P+T LR+LGP  W  AYV+PSRRP 
Sbjct: 1   MTFQDLILSLQNYWAQQGCVIQQPYDIEKGAGTFNPATFLRSLGPEPWNVAYVEPSRRPT 60

Query: 71  DGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTL 130
           DGRY ENPNRLQHYYQFQVI+KP PLN+Q LY++SLK+ GID   HD+RFVED+WESPTL
Sbjct: 61  DGRYGENPNRLQHYYQFQVILKPAPLNIQELYLDSLKSFGIDSASHDIRFVEDDWESPTL 120

Query: 131 GAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFN 190
           GAWGLGWE W DGMEI+QFTYFQQV GI+  PI GEITYG ER+AMY+Q V++VYD+ + 
Sbjct: 121 GAWGLGWEVWLDGMEITQFTYFQQVGGIDLKPIPGEITYGCERIAMYLQGVDNVYDLEW- 179

Query: 191 AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHH 250
                 V YGDI  Q+E E+S YNFE A+  +L   F   EKEC  L +K +        
Sbjct: 180 ---IDGVKYGDIHHQTEVEFSAYNFEEADTGMLFQLFDMYEKECTKLAQKDL-------- 228

Query: 251 LCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
             VFPAYD  +KASH FNLLDARG IS TER  YI R+R+L++ C E ++    
Sbjct: 229 --VFPAYDFVMKASHAFNLLDARGAISVTERAHYIGRVRNLSRLCAEGYVAQRE 280


>gi|293391265|ref|ZP_06635599.1| glycyl-tRNA synthetase subunit alpha [Aggregatibacter
           actinomycetemcomitans D7S-1]
 gi|290951799|gb|EFE01918.1| glycyl-tRNA synthetase subunit alpha [Aggregatibacter
           actinomycetemcomitans D7S-1]
          Length = 301

 Score =  554 bits (1428), Expect = e-156,   Method: Composition-based stats.
 Identities = 181/297 (60%), Positives = 218/297 (73%), Gaps = 8/297 (2%)

Query: 9   NDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRR 68
           N  +FQ +IL L +YWA QGCT++QP+DMEVGAGT HP T LRALGP     AYVQPSRR
Sbjct: 5   NVKTFQGMILALQEYWANQGCTVVQPFDMEVGAGTSHPMTALRALGPEPMAFAYVQPSRR 64

Query: 69  PLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESP 128
           P DGRY ENPNRLQHYYQFQV+IKP+P N+Q LY++SLK +G DP  +D+RFVEDNWE+P
Sbjct: 65  PTDGRYGENPNRLQHYYQFQVVIKPSPDNIQELYLDSLKMLGFDPTQNDIRFVEDNWENP 124

Query: 129 TLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIV 188
           TLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLERLAMY+Q V+SVYD+V
Sbjct: 125 TLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGLERLAMYIQGVDSVYDLV 184

Query: 189 FNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHR 248
           ++        YGD+F Q+E E S YNFEYA+ + L   F   EKE   LL    P     
Sbjct: 185 WSDGPLGKTTYGDVFHQNEVEQSTYNFEYADTDFLFYCFDQYEKEAQSLLALEKP----- 239

Query: 249 HHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNG 305
                 PAY++ +KA+H FNLLDAR  IS TERQRYILRIR+L K   EA+  +   
Sbjct: 240 ---LPLPAYERILKAAHSFNLLDARKAISVTERQRYILRIRALTKGVAEAYYASRKA 293


>gi|66043283|ref|YP_233124.1| glycyl-tRNA synthetase subunit alpha [Pseudomonas syringae pv.
           syringae B728a]
 gi|71735874|ref|YP_272326.1| glycyl-tRNA synthetase subunit alpha [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|63253990|gb|AAY35086.1| Glycyl-tRNA synthetase, alpha subunit [Pseudomonas syringae pv.
           syringae B728a]
 gi|71556427|gb|AAZ35638.1| glycyl-tRNA synthetase, alpha subunit [Pseudomonas syringae pv.
           phaseolicola 1448A]
          Length = 335

 Score =  554 bits (1428), Expect = e-156,   Method: Composition-based stats.
 Identities = 185/293 (63%), Positives = 222/293 (75%), Gaps = 10/293 (3%)

Query: 12  SFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPLD 71
           +FQ++IL L QYWA+QGC +LQPYDMEVGAGTFH +T LRA+GP +W AAYVQPSRRP D
Sbjct: 30  TFQDLILALQQYWAEQGCVVLQPYDMEVGAGTFHTATFLRAVGPETWNAAYVQPSRRPTD 89

Query: 72  GRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTLG 131
           GRY ENPNRLQHYYQFQVI+KPNP N Q LY+ SLK +G+DPL+HDVRFVEDNWESPTLG
Sbjct: 90  GRYGENPNRLQHYYQFQVILKPNPDNFQELYLGSLKHIGLDPLVHDVRFVEDNWESPTLG 149

Query: 132 AWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFNA 191
           AWGLGWE W +GME+SQFTYFQQV G+EC P++GEITYGLERLAMY Q V+SVYD+V+  
Sbjct: 150 AWGLGWEIWLNGMEVSQFTYFQQVGGLECYPVTGEITYGLERLAMYQQGVDSVYDLVWAD 209

Query: 192 IEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHHL 251
                V YGD+F Q+E E S YNFE+AN + L   F   E E   L++  +P        
Sbjct: 210 GPFGKVTYGDVFHQNEVEQSTYNFEHANVDKLFELFDFYESEAARLIELELP-------- 261

Query: 252 CVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
              P Y+  +KASH FNLLDAR  IS T RQ+YILR+R+LA++  +A+L    
Sbjct: 262 --LPGYEMVLKASHTFNLLDARRAISVTARQQYILRVRTLARSVAQAYLQARA 312


>gi|262273137|ref|ZP_06050954.1| glycyl-tRNA synthetase alpha chain [Grimontia hollisae CIP 101886]
 gi|262222893|gb|EEY74201.1| glycyl-tRNA synthetase alpha chain [Grimontia hollisae CIP 101886]
          Length = 305

 Score =  554 bits (1428), Expect = e-156,   Method: Composition-based stats.
 Identities = 181/301 (60%), Positives = 219/301 (72%), Gaps = 8/301 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +IL L  YWAQQGCTI+QP DMEVGAGT HP T LRA+GP    AAYVQ
Sbjct: 1   MQKFDVKTFQGMILALQDYWAQQGCTIVQPLDMEVGAGTSHPMTCLRAIGPEPIAAAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQ I+KP+P N+Q LY+ SL+ +GIDP +HD+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQTILKPSPDNIQELYLGSLRVLGIDPEVHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYG+ERLAMY+Q V+SV
Sbjct: 121 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGIERLAMYIQGVDSV 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V+       V YGDIF Q+E E S YNFE+A+ + L  +F   EKEC          
Sbjct: 181 YDLVWTDGPFGKVTYGDIFHQNEVEQSTYNFEHADVDFLFTYFDQCEKECK--------T 232

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY++ +KA+H FNLLDAR  IS TERQRYILRIR+L K+  EA+  +  
Sbjct: 233 LLELEKPLPLPAYERILKAAHAFNLLDARKAISVTERQRYILRIRNLTKSVAEAYYASRE 292

Query: 305 G 305
            
Sbjct: 293 A 293


>gi|296448092|ref|ZP_06889994.1| glycyl-tRNA synthetase, alpha subunit [Methylosinus trichosporium
           OB3b]
 gi|296254406|gb|EFH01531.1| glycyl-tRNA synthetase, alpha subunit [Methylosinus trichosporium
           OB3b]
          Length = 307

 Score =  554 bits (1428), Expect = e-156,   Method: Composition-based stats.
 Identities = 201/307 (65%), Positives = 240/307 (78%), Gaps = 3/307 (0%)

Query: 1   MAPIHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKA 60
           M          SFQ +ILTL  +WA+QGC ILQPYDME+GAGTFHP+TTLRALGP  WKA
Sbjct: 1   MTAAARLSPKNSFQGLILTLQNFWAEQGCVILQPYDMEMGAGTFHPATTLRALGPKPWKA 60

Query: 61  AYVQPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRF 120
           AYVQPSRRP DGRY ENPNRLQH+YQ+QVI+KP+P +LQ+LY+ SL A+G+D  +HD+RF
Sbjct: 61  AYVQPSRRPKDGRYGENPNRLQHFYQYQVILKPSPPDLQSLYLASLAAIGVDATLHDIRF 120

Query: 121 VEDNWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQN 180
           VED+WESPTLGAWGLGWECWCDGME+SQFTYFQQV G +C+P++GE+TYGLERLA Y+Q 
Sbjct: 121 VEDDWESPTLGAWGLGWECWCDGMEVSQFTYFQQVAGFDCAPVAGELTYGLERLACYLQG 180

Query: 181 VNSVYDIVFNAIEG-QNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLK 239
           V+S+ ++ FN  EG   V YGD+F Q+EQEYSR+NFE A+   L + F  +E EC  LL 
Sbjct: 181 VDSIMELNFNGGEGADKVTYGDVFLQAEQEYSRHNFEAADTAKLFSDFRAAEAECRALL- 239

Query: 240 KGIPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAF 299
            G  +     HL   PAYDQC+KASH FNLLDARGVIS TERQ YILR+R LA+ACG A+
Sbjct: 240 -GFGDRGEGRHLMALPAYDQCVKASHAFNLLDARGVISVTERQSYILRVRELARACGAAW 298

Query: 300 LMTPNGG 306
           L T  GG
Sbjct: 299 LRTEGGG 305


>gi|288942695|ref|YP_003444935.1| glycyl-tRNA synthetase subunit alpha [Allochromatium vinosum DSM
           180]
 gi|288898067|gb|ADC63903.1| glycyl-tRNA synthetase, alpha subunit [Allochromatium vinosum DSM
           180]
          Length = 301

 Score =  554 bits (1428), Expect = e-156,   Method: Composition-based stats.
 Identities = 175/294 (59%), Positives = 226/294 (76%), Gaps = 10/294 (3%)

Query: 12  SFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPLD 71
           +FQ +I  L +YWA  GC ++QP+DMEVGAGTFHPST LR++GP  W++AYVQPSRRP D
Sbjct: 10  TFQGLIFALERYWADLGCVVVQPFDMEVGAGTFHPSTFLRSIGPEPWRSAYVQPSRRPTD 69

Query: 72  GRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTLG 131
           GRY ENPNRLQHYYQFQV++KP+PL++Q LY+ SL+ +GIDPL+HD+RFVEDNWESPTLG
Sbjct: 70  GRYGENPNRLQHYYQFQVVLKPSPLDIQELYLNSLRRLGIDPLVHDIRFVEDNWESPTLG 129

Query: 132 AWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFNA 191
           AWGLGWE W +GME++QFTYFQQV G++C P++GEITYGLER+AMY+Q V SVYD+V++ 
Sbjct: 130 AWGLGWEVWLNGMEVTQFTYFQQVGGLDCRPVTGEITYGLERIAMYLQEVESVYDLVWSR 189

Query: 192 IEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHHL 251
                V YGD++ Q+E E S YNFE A+   L   F   E+   +L+++G+P        
Sbjct: 190 SPAGVVTYGDVYHQNEVEQSTYNFELADTAALFAQFDTHERISTELIERGLP-------- 241

Query: 252 CVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNG 305
              PAY+Q +KASH FNLLDARG IS TERQR+ILR+R+L++A  +A+      
Sbjct: 242 --LPAYEQVLKASHTFNLLDARGAISVTERQRFILRVRTLSRAVAQAYYDKREA 293


>gi|240850064|ref|YP_002971457.1| glycyl-tRNA synthetase subunit alpha [Bartonella grahamii as4aup]
 gi|240267187|gb|ACS50775.1| glycyl-tRNA synthetase subunit alpha [Bartonella grahamii as4aup]
          Length = 313

 Score =  554 bits (1428), Expect = e-156,   Method: Composition-based stats.
 Identities = 218/306 (71%), Positives = 256/306 (83%), Gaps = 1/306 (0%)

Query: 1   MAPIHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKA 60
           M    +     SFQ +ILTL  YWA  GC ILQPYDMEVGAGTFHP+TTLR+LGP  WK 
Sbjct: 1   MKLPEHLNPKRSFQGLILTLQNYWAHYGCAILQPYDMEVGAGTFHPATTLRSLGPRPWKV 60

Query: 61  AYVQPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRF 120
           AYVQPSRRP DGRY +NPNRLQHYYQFQV++KP+PLNLQ LYI+SL+A+G+D  +HD+RF
Sbjct: 61  AYVQPSRRPTDGRYGKNPNRLQHYYQFQVLLKPSPLNLQELYIKSLQAIGLDTKLHDIRF 120

Query: 121 VEDNWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQN 180
           VED+WESPTLGAWGLGWECWCDGME+SQFTYFQQVCGIEC+P+SGE+TYGLERLAMY+Q 
Sbjct: 121 VEDDWESPTLGAWGLGWECWCDGMEVSQFTYFQQVCGIECAPVSGELTYGLERLAMYIQG 180

Query: 181 VNSVYDIVFNAIEGQ-NVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLK 239
           V++VYD+ FN +EG+  + Y DIF Q+EQEYS YNFE+A+ ++LH HFID+E+EC  LL 
Sbjct: 181 VDNVYDLNFNGLEGENKISYRDIFLQTEQEYSYYNFEFADTKLLHQHFIDAERECSALLD 240

Query: 240 KGIPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAF 299
            G PN+ +  H CVFPAYDQCIKASHIFNLL ARGVIS TERQ YILR+R LA+ CGEAF
Sbjct: 241 AGKPNKENILHRCVFPAYDQCIKASHIFNLLQARGVISVTERQNYILRVRDLARRCGEAF 300

Query: 300 LMTPNG 305
           L+T  G
Sbjct: 301 LLTEAG 306


>gi|33152921|ref|NP_874274.1| glycyl-tRNA synthetase subunit alpha [Haemophilus ducreyi 35000HP]
 gi|71153557|sp|Q7VKG5|SYGA_HAEDU RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|33149146|gb|AAP96663.1| glycyl-tRNA synthetase alpha subunit [Haemophilus ducreyi 35000HP]
          Length = 302

 Score =  554 bits (1428), Expect = e-156,   Method: Composition-based stats.
 Identities = 181/302 (59%), Positives = 219/302 (72%), Gaps = 8/302 (2%)

Query: 4   IHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYV 63
           +  K N  +FQ +IL L +YWA  GCTI+QP+DMEVGAGT HP T LRALGP     AYV
Sbjct: 1   MSTKFNVKTFQGMILALQEYWANVGCTIVQPFDMEVGAGTSHPMTALRALGPEPMAFAYV 60

Query: 64  QPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVED 123
           QPSRRP DGRY ENPNRLQHYYQFQV+IKP+P N+Q LY+ SLK +G DP  HD+RFVED
Sbjct: 61  QPSRRPTDGRYGENPNRLQHYYQFQVVIKPSPDNIQELYLGSLKMLGFDPTQHDIRFVED 120

Query: 124 NWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNS 183
           NWE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GE+TYGLERLAMY+Q V+S
Sbjct: 121 NWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEVTYGLERLAMYIQGVDS 180

Query: 184 VYDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIP 243
           VYD+V++        YGD+F Q+E E S YNFEYA+ + L   F   EKE  +LL    P
Sbjct: 181 VYDLVYSDGPLGKTTYGDVFHQNEVEQSTYNFEYADVDFLFKAFEQYEKEAQELLALEKP 240

Query: 244 NEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTP 303
                      PAY++ +KA+H FN+LDAR  IS TERQRYILRIR+L K   EA+  + 
Sbjct: 241 --------LPLPAYERVLKAAHSFNMLDARKAISVTERQRYILRIRALTKGVAEAYYASR 292

Query: 304 NG 305
             
Sbjct: 293 EA 294


>gi|163746091|ref|ZP_02153450.1| glycyl-tRNA synthetase subunit alpha [Oceanibulbus indolifex
           HEL-45]
 gi|161380836|gb|EDQ05246.1| glycyl-tRNA synthetase subunit alpha [Oceanibulbus indolifex
           HEL-45]
          Length = 315

 Score =  553 bits (1427), Expect = e-156,   Method: Composition-based stats.
 Identities = 195/301 (64%), Positives = 236/301 (78%), Gaps = 2/301 (0%)

Query: 8   KNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSR 67
           +   SFQ IIL L  YWA+ GC ILQPYDMEVGAGTFHP+TTLR+LG   W AAYVQPSR
Sbjct: 6   QKPRSFQEIILALQSYWARHGCAILQPYDMEVGAGTFHPATTLRSLGSQPWAAAYVQPSR 65

Query: 68  RPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWES 127
           RP DGRY ENPNRLQHYYQFQV+IKP+P NLQ LY+ SL+A+GID  +HD+RFVED+WES
Sbjct: 66  RPTDGRYGENPNRLQHYYQFQVLIKPSPPNLQELYLGSLEAIGIDMALHDIRFVEDDWES 125

Query: 128 PTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDI 187
           PTLGAWGLGWE WCDGME+SQFTYFQQV G +C P+SGE+TYGLERLAMYV  V+ V D+
Sbjct: 126 PTLGAWGLGWEVWCDGMEVSQFTYFQQVGGHDCHPVSGELTYGLERLAMYVLGVDHVMDM 185

Query: 188 VFNAIEGQ-NVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEH 246
            FN+ +    + YGDIF Q+E+E++R+NF+ AN E+L + F ++E  C  +L++   +  
Sbjct: 186 PFNSPDAPIPLTYGDIFKQTEEEFARWNFDTANTEVLLDQFNEAEAHCQFILEQPAEDPK 245

Query: 247 -HRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNG 305
             +  +   PAYDQCIKASHIFNLLDARGVIS TERQ YI R+R+LAK C +AF+ T  G
Sbjct: 246 TGKRIVMAHPAYDQCIKASHIFNLLDARGVISVTERQAYIGRVRALAKQCADAFVQTRAG 305

Query: 306 G 306
           G
Sbjct: 306 G 306


>gi|218674028|ref|ZP_03523697.1| glycyl-tRNA synthetase subunit alpha [Rhizobium etli GR56]
          Length = 299

 Score =  553 bits (1427), Expect = e-156,   Method: Composition-based stats.
 Identities = 220/291 (75%), Positives = 254/291 (87%), Gaps = 3/291 (1%)

Query: 19  TLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPLDGRYAENP 78
           TL  YWA +GC +LQPYDMEVGAGTFHP+TTLRALGP  WKAAYVQPSRRP DGRY ENP
Sbjct: 1   TLHSYWADKGCAVLQPYDMEVGAGTFHPATTLRALGPKPWKAAYVQPSRRPSDGRYGENP 60

Query: 79  NRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTLGAWGLGWE 138
           NRLQHYYQ+QVI+KPNP NLQ LY+ SL A+G+DPL+HD+RFVED+WESPTLGAWGLGWE
Sbjct: 61  NRLQHYYQYQVILKPNPPNLQELYLGSLAAIGLDPLLHDIRFVEDDWESPTLGAWGLGWE 120

Query: 139 CWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFNAIEGQ-NV 197
           CWCDGME+SQFTYFQQVCGIEC+P++GE+TYGLERLAMYVQ V++VYD+ FN  EG   +
Sbjct: 121 CWCDGMEVSQFTYFQQVCGIECAPVAGELTYGLERLAMYVQGVDNVYDLNFNGREGDEKI 180

Query: 198 LYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNE--HHRHHLCVFP 255
            YGD+F Q+EQEYSR+NFE+AN E+LH HF+D+EKEC  LL  G P++  + R H CVFP
Sbjct: 181 SYGDVFLQAEQEYSRHNFEFANTEMLHRHFVDAEKECRALLDAGAPDDSANQRLHKCVFP 240

Query: 256 AYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNGG 306
           AYDQCIKASH+FNLLDARGVIS TERQ YILR+R+LAKACGEAFL+T  GG
Sbjct: 241 AYDQCIKASHVFNLLDARGVISVTERQSYILRVRTLAKACGEAFLLTDAGG 291


>gi|149927714|ref|ZP_01915966.1| glycyl-tRNA synthetase subunit alpha [Limnobacter sp. MED105]
 gi|149823540|gb|EDM82770.1| glycyl-tRNA synthetase subunit alpha [Limnobacter sp. MED105]
          Length = 308

 Score =  553 bits (1427), Expect = e-156,   Method: Composition-based stats.
 Identities = 174/302 (57%), Positives = 220/302 (72%), Gaps = 14/302 (4%)

Query: 7   KKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPS 66
           +K  L+FQ  ILTL  YW QQGC +LQP+DMEVGAGT H +T LRALGP  W AAYVQPS
Sbjct: 2   QKKPLTFQQAILTLQNYWDQQGCALLQPFDMEVGAGTSHTATFLRALGPEPWNAAYVQPS 61

Query: 67  RRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWE 126
           RRP DGRY ENPNR+QHYYQFQV++KP+P N+ +LY+ SL+A+GID   +D+RFVEDNWE
Sbjct: 62  RRPKDGRYGENPNRMQHYYQFQVVLKPSPENIIDLYLGSLEALGIDTQQNDIRFVEDNWE 121

Query: 127 SPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYD 186
           +PTLGAWGLGWE W +GME++QFTYFQQV G++CSPI GEITYG+ERL MY+Q   +VYD
Sbjct: 122 NPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLDCSPILGEITYGIERLTMYLQGKENVYD 181

Query: 187 IVFNAIEGQNV----LYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGI 242
           +V+   E + V     YGD+F Q+E E S YNFE++N ++L  HF + E E   L++   
Sbjct: 182 LVWTEREEKGVKKVLTYGDVFHQNEVEQSTYNFEHSNADMLFRHFGEYETEAKHLIE--- 238

Query: 243 PNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMT 302
                       PAY+  +KA+H FNLLDARG IS TER  YI RIR+L++A  +A+  +
Sbjct: 239 -------VGLALPAYEMILKAAHTFNLLDARGAISVTERAAYIGRIRNLSRAVAQAYFDS 291

Query: 303 PN 304
             
Sbjct: 292 RE 293


>gi|332970991|gb|EGK09964.1| glycyl-tRNA synthetase alpha subunit [Kingella kingae ATCC 23330]
          Length = 310

 Score =  553 bits (1427), Expect = e-156,   Method: Composition-based stats.
 Identities = 172/297 (57%), Positives = 218/297 (73%), Gaps = 8/297 (2%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ+II  L QYWA QGC I+QP+DMEVGAGT HP+T LRALGP  W  AYVQPSRRP
Sbjct: 12  MLTFQDIIFKLQQYWANQGCAIIQPFDMEVGAGTSHPATCLRALGPEPWNVAYVQPSRRP 71

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY +NPNRLQHYYQFQV +KP P ++Q+LY+ SLK +GIDP +HD+RFVED+WE+PT
Sbjct: 72  KDGRYGDNPNRLQHYYQFQVALKPAPDDIQDLYLGSLKVLGIDPTVHDIRFVEDDWENPT 131

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQQV GI+C+P+ GEITYG+ERLAMY+Q V +VYD+V+
Sbjct: 132 LGAWGLGWEVWLNGMEVTQFTYFQQVGGIDCTPVLGEITYGIERLAMYLQGVENVYDLVW 191

Query: 190 N-AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHR 248
               +G N+ YGD++ Q+E E S YNFE+++   L   F   E +   LL++        
Sbjct: 192 TVTPDGTNLTYGDVYHQNEVEQSTYNFEHSDAAWLLEQFNGFEAQAKRLLEQ-------E 244

Query: 249 HHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNG 305
               V PAY+  +KA H FNLLDARG IS TER  YI RIR+L++   + F+ +   
Sbjct: 245 DAQLVLPAYELVLKAGHTFNLLDARGAISVTERATYIGRIRALSRQVAQKFVASREA 301


>gi|90408449|ref|ZP_01216609.1| glycyl-tRNA synthetase alpha subunit [Psychromonas sp. CNPT3]
 gi|90310433|gb|EAS38558.1| glycyl-tRNA synthetase alpha subunit [Psychromonas sp. CNPT3]
          Length = 302

 Score =  553 bits (1427), Expect = e-156,   Method: Composition-based stats.
 Identities = 181/299 (60%), Positives = 220/299 (73%), Gaps = 10/299 (3%)

Query: 7   KKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPS 66
           K +  +FQ +IL L  +WA+QGC I+QP DMEVGAGTFHP T LR++GP    +AYVQP 
Sbjct: 3   KFDTKTFQGLILALQDFWARQGCAIVQPLDMEVGAGTFHPQTFLRSIGPEPMCSAYVQPC 62

Query: 67  RRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWE 126
           RRP DGRY ENPNRLQ YYQFQV++KP+P N+Q LY+ SLK +GID  +HD+RFVEDNWE
Sbjct: 63  RRPTDGRYGENPNRLQQYYQFQVVLKPSPDNIQELYLLSLKEIGIDTSVHDIRFVEDNWE 122

Query: 127 SPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYD 186
           SPTLGAWGLGWE W +GME+SQFTYFQQV G+ECSP++GEITYGLERLAMYVQ V+S+YD
Sbjct: 123 SPTLGAWGLGWEIWLNGMEVSQFTYFQQVGGLECSPVTGEITYGLERLAMYVQGVDSIYD 182

Query: 187 IVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEH 246
           +V+       + YGDIF Q+E E S YNFE+AN E L   F   EKE   L++  +P   
Sbjct: 183 LVWADGPMGRITYGDIFHQNEVEQSTYNFEHANVEALFAQFDLCEKESQKLIEANLP--- 239

Query: 247 HRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNG 305
                   PAY+Q +KASH+FNLLDAR  IS TERQRYILR+R+L+KA    +      
Sbjct: 240 -------LPAYEQVMKASHVFNLLDARHAISVTERQRYILRVRTLSKAVAVTYYAKREA 291


>gi|182678945|ref|YP_001833091.1| glycyl-tRNA synthetase subunit alpha [Beijerinckia indica subsp.
           indica ATCC 9039]
 gi|182634828|gb|ACB95602.1| glycyl-tRNA synthetase, alpha subunit [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 319

 Score =  553 bits (1427), Expect = e-156,   Method: Composition-based stats.
 Identities = 210/296 (70%), Positives = 242/296 (81%), Gaps = 5/296 (1%)

Query: 12  SFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPLD 71
           SFQ +ILTL ++WA QGC ILQPYDMEVGAGTFHP+TTLR+LGP  WKAAYVQP RRP D
Sbjct: 26  SFQGLILTLQRFWASQGCVILQPYDMEVGAGTFHPATTLRSLGPKPWKAAYVQPCRRPKD 85

Query: 72  GRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTLG 131
           GRY ENPNRLQHYYQFQV++KP+P +LQ+LY+ SL+A+GID  +HDVRFVED+WESPTLG
Sbjct: 86  GRYGENPNRLQHYYQFQVVLKPSPPDLQDLYLRSLQAIGIDTRLHDVRFVEDDWESPTLG 145

Query: 132 AWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFNA 191
           AWGLGWECWCDGME+SQFTYFQQV G+EC+P+SGE+TYGLERLA Y+QNV+ + D+ +N 
Sbjct: 146 AWGLGWECWCDGMEVSQFTYFQQVAGVECAPVSGELTYGLERLACYLQNVDRIMDLNYNG 205

Query: 192 IEG-QNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHH 250
            EG + V YGDIF Q+EQEYSRYNFE +NPEIL  HF D+E  C  LL            
Sbjct: 206 REGEEKVTYGDIFLQAEQEYSRYNFEASNPEILFQHFKDAEATCRLLL----IEAEKTGK 261

Query: 251 LCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNGG 306
             V PAYDQCIKASH+FNLLDARGVIS TERQ YILR+R LAKACG A+L T  GG
Sbjct: 262 GLVLPAYDQCIKASHLFNLLDARGVISVTERQSYILRVRDLAKACGAAWLKTAGGG 317


>gi|170719019|ref|YP_001784178.1| glycyl-tRNA synthetase subunit alpha [Haemophilus somnus 2336]
 gi|168827148|gb|ACA32519.1| glycyl-tRNA synthetase, alpha subunit [Haemophilus somnus 2336]
          Length = 303

 Score =  553 bits (1427), Expect = e-156,   Method: Composition-based stats.
 Identities = 179/302 (59%), Positives = 220/302 (72%), Gaps = 8/302 (2%)

Query: 4   IHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYV 63
           I+ K N  +FQ +IL L  +WA +GC+++QP+DMEVGAGT HP T LRALGP     AYV
Sbjct: 2   INTKFNVRTFQGMILALQDFWASKGCSVVQPFDMEVGAGTSHPMTCLRALGPEPMAFAYV 61

Query: 64  QPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVED 123
           QPSRRP DGRY ENPNRLQHYYQFQV+IKP+P N+Q LY++SLK +G DP  +D+RFVED
Sbjct: 62  QPSRRPTDGRYGENPNRLQHYYQFQVVIKPSPDNIQELYLDSLKMLGFDPTQNDIRFVED 121

Query: 124 NWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNS 183
           NWE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLERLAMY+Q V+S
Sbjct: 122 NWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGLERLAMYIQGVDS 181

Query: 184 VYDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIP 243
           VYD+V++  E     YGD+F Q+E E S YNFEYA+   L + F   EKE   L+     
Sbjct: 182 VYDLVWSDGEFGKTTYGDVFHQNEVEQSTYNFEYADVNFLFHCFEQYEKEAQYLI----- 236

Query: 244 NEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTP 303
                      PAY++ +KA+H FNLLDAR  IS TERQRYILRIR+L K   EA+  + 
Sbjct: 237 ---GLEKPLPLPAYERILKAAHSFNLLDARKAISVTERQRYILRIRALTKGVAEAYYASR 293

Query: 304 NG 305
             
Sbjct: 294 EA 295


>gi|189424089|ref|YP_001951266.1| glycyl-tRNA synthetase subunit alpha [Geobacter lovleyi SZ]
 gi|238692125|sp|B3E622|SYGA_GEOLS RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|189420348|gb|ACD94746.1| glycyl-tRNA synthetase, alpha subunit [Geobacter lovleyi SZ]
          Length = 291

 Score =  553 bits (1427), Expect = e-155,   Method: Composition-based stats.
 Identities = 174/294 (59%), Positives = 215/294 (73%), Gaps = 14/294 (4%)

Query: 11  LSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPL 70
           ++FQN+IL+L  YWA QGC I QPYD E GAGTF+P+T LR LGP  W  AYV+PSRRP 
Sbjct: 1   MTFQNLILSLQNYWANQGCVIQQPYDTEKGAGTFNPATFLRVLGPEPWNVAYVEPSRRPT 60

Query: 71  DGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTL 130
           DGRY ENPNRLQHYYQFQVI+KP+P N+ +LY++SL+A GI+P  HD+RFVED+WESPTL
Sbjct: 61  DGRYGENPNRLQHYYQFQVIMKPSPANILDLYLDSLRAFGINPSQHDIRFVEDDWESPTL 120

Query: 131 GAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFN 190
           GAWGLGWE W DGMEI+QFTYFQQ  GI+  P+S EITYG ER+AMY+Q V++VYD+ + 
Sbjct: 121 GAWGLGWEVWLDGMEITQFTYFQQAGGIDLKPVSSEITYGCERIAMYLQGVDNVYDLEWV 180

Query: 191 AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHH 250
               + V YGDI  Q+E E+S YNFE A+  +L   F   EKEC+ L +K +        
Sbjct: 181 ----KGVKYGDIHHQTEVEFSTYNFEEADVALLLELFGKYEKECIRLAEKDL-------- 228

Query: 251 LCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
             VFPAYD  +K SH FNLLDARG IS TER  YI R+R++A+ C E ++    
Sbjct: 229 --VFPAYDFVMKCSHTFNLLDARGAISVTERASYIGRVRNVARLCAEGYVRQRE 280


>gi|319406069|emb|CBI79699.1| glycyl-tRNA synthetase alpha chain [Bartonella sp. AR 15-3]
          Length = 314

 Score =  553 bits (1427), Expect = e-155,   Method: Composition-based stats.
 Identities = 217/306 (70%), Positives = 255/306 (83%), Gaps = 1/306 (0%)

Query: 1   MAPIHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKA 60
           M    N     SFQ +IL+L  YWAQ GC ILQPYDMEVGAGTFHP+TTLR+LGP  WKA
Sbjct: 1   MNLPSNLNPRYSFQGLILSLQNYWAQHGCAILQPYDMEVGAGTFHPATTLRSLGPRPWKA 60

Query: 61  AYVQPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRF 120
           AYVQP+RRP DGRY  NPNRLQHYYQFQV++KP+P NLQ LYI SL+ +G+D  +HD+RF
Sbjct: 61  AYVQPTRRPTDGRYGTNPNRLQHYYQFQVLLKPSPPNLQELYIGSLQTIGLDTKLHDIRF 120

Query: 121 VEDNWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQN 180
           VED+WESPTLGAWGLGWECWCDGME+SQFTYFQQ+CGIEC+P+SGEITYGLERLAMY+Q+
Sbjct: 121 VEDDWESPTLGAWGLGWECWCDGMEVSQFTYFQQICGIECAPVSGEITYGLERLAMYIQD 180

Query: 181 VNSVYDIVFNAIEG-QNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLK 239
           V++VYD+ FN ++G   + YGDIF Q+EQEYS YNFE+AN  +L  HFID+E EC+ LL 
Sbjct: 181 VSNVYDLNFNGLDGTDRISYGDIFLQAEQEYSYYNFEFANSNLLLQHFIDAECECIALLD 240

Query: 240 KGIPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAF 299
            G P++ +  HLCVFPAYDQCIKASHIFNLL ARGVIS TERQ YILR+R+LA+ CGEAF
Sbjct: 241 AGKPDKKNSSHLCVFPAYDQCIKASHIFNLLQARGVISVTERQNYILRVRNLARRCGEAF 300

Query: 300 LMTPNG 305
           L+T  G
Sbjct: 301 LLTEAG 306


>gi|84516924|ref|ZP_01004282.1| glycyl-tRNA synthetase alpha subunit [Loktanella vestfoldensis
           SKA53]
 gi|84509392|gb|EAQ05851.1| glycyl-tRNA synthetase alpha subunit [Loktanella vestfoldensis
           SKA53]
          Length = 306

 Score =  553 bits (1426), Expect = e-155,   Method: Composition-based stats.
 Identities = 195/302 (64%), Positives = 231/302 (76%), Gaps = 2/302 (0%)

Query: 7   KKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPS 66
                SFQ IIL L  YWA +GC ILQPYD+EVGAGTFHP+TTLRALG   W AAYVQPS
Sbjct: 2   SDKPRSFQEIILRLQSYWAAKGCAILQPYDIEVGAGTFHPATTLRALGSKPWAAAYVQPS 61

Query: 67  RRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWE 126
           RRP DGRY ENPNRLQHYYQ+QV+IKP+P +LQ LY+ SL A+GID  +HD+RFVED+WE
Sbjct: 62  RRPTDGRYGENPNRLQHYYQYQVLIKPSPPDLQELYLGSLAAIGIDAHLHDIRFVEDDWE 121

Query: 127 SPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYD 186
           SPTLGAWGLGWE WCDGME+SQFTYFQQV G +C P+SGE+TYGLERLAMYV  V+ V D
Sbjct: 122 SPTLGAWGLGWEVWCDGMEVSQFTYFQQVGGHDCRPVSGELTYGLERLAMYVLGVDHVMD 181

Query: 187 IVFNAIEGQN-VLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKG-IPN 244
           + FN  +    + YGDIF Q+EQEY+R+NF+ A+ ++L  HF D+E EC  +L       
Sbjct: 182 MPFNDPDAPIALRYGDIFCQTEQEYARWNFDVADTDMLLQHFKDAEAECHRILSTPAHDP 241

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
           +     +   PAYDQCIKASH+FNLLDARGVIS TERQ YI R+R+LAKAC +AF+ T  
Sbjct: 242 KKDMAIIMAHPAYDQCIKASHLFNLLDARGVISVTERQAYIGRVRALAKACADAFMQTEA 301

Query: 305 GG 306
            G
Sbjct: 302 AG 303


>gi|323136707|ref|ZP_08071788.1| glycyl-tRNA synthetase, alpha subunit [Methylocystis sp. ATCC
           49242]
 gi|322398024|gb|EFY00545.1| glycyl-tRNA synthetase, alpha subunit [Methylocystis sp. ATCC
           49242]
          Length = 311

 Score =  553 bits (1426), Expect = e-155,   Method: Composition-based stats.
 Identities = 201/296 (67%), Positives = 235/296 (79%), Gaps = 2/296 (0%)

Query: 12  SFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPLD 71
           SFQ +ILTL  +WA QGC I+QPYDME+GA TFHP+TTLRALGP  W+AAY QP RRP D
Sbjct: 14  SFQGLILTLQNFWAAQGCVIVQPYDMEMGAATFHPATTLRALGPKPWRAAYAQPCRRPKD 73

Query: 72  GRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTLG 131
           GRY ENPNR+QHYYQFQVI+KP+P +LQ LY+ SL A+G+D  +HD+RFVED+WESPTLG
Sbjct: 74  GRYGENPNRVQHYYQFQVILKPSPPDLQELYLASLAAIGLDSRLHDIRFVEDDWESPTLG 133

Query: 132 AWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFNA 191
           AWGLGWECWCDGME+SQFTYFQQV G EC+P++GE+TYGLERLA Y+Q V+S+ D+ FN 
Sbjct: 134 AWGLGWECWCDGMEVSQFTYFQQVAGFECAPVAGELTYGLERLACYLQGVDSIMDLNFNG 193

Query: 192 IEG-QNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHH 250
            EG + V YGD+F Q+EQEYSR+NFE A+   L   F D+E EC  LL+ G        H
Sbjct: 194 REGAEKVTYGDVFLQAEQEYSRHNFEAADTSKLFEDFRDAEAECARLLEFG-AGSGDEKH 252

Query: 251 LCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNGG 306
           L   PAYDQCIKASH FNLLDARGVIS TERQ YILR+R LAKACG A+L T  GG
Sbjct: 253 LMALPAYDQCIKASHAFNLLDARGVISVTERQSYILRVRELAKACGAAWLRTAGGG 308


>gi|254804253|ref|YP_003082474.1| glycyl-tRNA synthetase alpha chain [Neisseria meningitidis alpha14]
 gi|261378161|ref|ZP_05982734.1| glycyl-tRNA synthetase, alpha subunit [Neisseria cinerea ATCC
           14685]
 gi|254667795|emb|CBA03759.1| glycyl-tRNA synthetase alpha chain [Neisseria meningitidis alpha14]
 gi|261393262|emb|CAX50888.1| glycyl-tRNA synthetase alpha chain (glycine--tRNA ligase alpha
           chain; GlyRS) [Neisseria meningitidis 8013]
 gi|269145625|gb|EEZ72043.1| glycyl-tRNA synthetase, alpha subunit [Neisseria cinerea ATCC
           14685]
 gi|325135525|gb|EGC58143.1| glycyl-tRNA synthetase, alpha subunit [Neisseria meningitidis
           M0579]
 gi|325143643|gb|EGC65962.1| glycyl-tRNA synthetase, alpha subunit [Neisseria meningitidis
           M01-240013]
 gi|325206839|gb|ADZ02292.1| glycyl-tRNA synthetase, alpha subunit [Neisseria meningitidis
           M04-240196]
          Length = 301

 Score =  553 bits (1426), Expect = e-155,   Method: Composition-based stats.
 Identities = 171/296 (57%), Positives = 219/296 (73%), Gaps = 8/296 (2%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ II  L  +WA +GCT++QP+DMEVGAGT HP+T LRALGP  W AAYVQPSRRP
Sbjct: 1   MLTFQQIIFKLQTFWADKGCTVIQPFDMEVGAGTSHPATCLRALGPEPWFAAYVQPSRRP 60

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY +NPNRLQHYYQFQV +KP P N+Q+LY++SL+ +GIDP +HD+RFVED+WE+PT
Sbjct: 61  KDGRYGDNPNRLQHYYQFQVALKPAPANIQDLYLDSLRELGIDPKVHDIRFVEDDWENPT 120

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQQV GI+C+P+ GEITYG+ERLAMY+Q V +VYD+V+
Sbjct: 121 LGAWGLGWEVWLNGMEVTQFTYFQQVGGIDCTPVLGEITYGIERLAMYLQGVENVYDLVW 180

Query: 190 NAI-EGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHR 248
               +G  V YGD++ Q+E E S YNFEY++ + L   F D E +   LL          
Sbjct: 181 AKTLDGNTVTYGDVYHQNEVEQSTYNFEYSDADWLLRQFNDYEAQAKRLLA-------EE 233

Query: 249 HHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
           +     PAY+  +KA H FNLLDARG IS TER  YI RIR+L++A  + ++ +  
Sbjct: 234 NASLALPAYELVLKAGHTFNLLDARGAISVTERATYIGRIRALSRAVAQKYVESRE 289


>gi|15677762|ref|NP_274926.1| glycyl-tRNA synthetase subunit alpha [Neisseria meningitidis MC58]
 gi|161869281|ref|YP_001598448.1| glycyl-tRNA synthetase subunit alpha [Neisseria meningitidis
           053442]
 gi|218767497|ref|YP_002342009.1| glycyl-tRNA synthetase subunit alpha [Neisseria meningitidis Z2491]
 gi|54039661|sp|P67029|SYGA_NEIMB RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|54042276|sp|P67028|SYGA_NEIMA RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|189082255|sp|A9M125|SYGA_NEIM0 RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|7227190|gb|AAF42261.1| glycyl-tRNA synthetase, alpha chain [Neisseria meningitidis MC58]
 gi|121051505|emb|CAM07798.1| glycyl-tRNA synthetase alpha chain [Neisseria meningitidis Z2491]
 gi|161594834|gb|ABX72494.1| glycyl-tRNA synthetase alpha chain [Neisseria meningitidis 053442]
 gi|308390030|gb|ADO32350.1| glycyl-tRNA synthetase alpha chain [Neisseria meningitidis
           alpha710]
 gi|316985554|gb|EFV64501.1| glycyl-tRNA synthetase alpha subunit [Neisseria meningitidis
           H44/76]
 gi|319409759|emb|CBY90065.1| glycyl-tRNA synthetase alpha chain (glycine-tRNA ligase alpha
           chain; GlyRS) [Neisseria meningitidis WUE 2594]
 gi|325127447|gb|EGC50377.1| glycyl-tRNA synthetase, alpha subunit [Neisseria meningitidis
           N1568]
 gi|325129470|gb|EGC52300.1| glycyl-tRNA synthetase, alpha subunit [Neisseria meningitidis
           OX99.30304]
 gi|325131655|gb|EGC54361.1| glycyl-tRNA synthetase, alpha subunit [Neisseria meningitidis
           M6190]
 gi|325137518|gb|EGC60101.1| glycyl-tRNA synthetase, alpha subunit [Neisseria meningitidis
           ES14902]
 gi|325139585|gb|EGC62125.1| glycyl-tRNA synthetase, alpha subunit [Neisseria meningitidis
           CU385]
 gi|325200983|gb|ADY96438.1| glycyl-tRNA synthetase, alpha subunit [Neisseria meningitidis
           H44/76]
 gi|325201429|gb|ADY96883.1| glycyl-tRNA synthetase, alpha subunit [Neisseria meningitidis
           M01-240149]
 gi|325204884|gb|ADZ00338.1| glycyl-tRNA synthetase, alpha subunit [Neisseria meningitidis
           M01-240355]
 gi|325207410|gb|ADZ02862.1| glycyl-tRNA synthetase, alpha subunit [Neisseria meningitidis
           NZ-05/33]
          Length = 301

 Score =  553 bits (1426), Expect = e-155,   Method: Composition-based stats.
 Identities = 171/296 (57%), Positives = 219/296 (73%), Gaps = 8/296 (2%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ II  L  +WA +GCT++QP+DMEVGAGT HP+T LRALGP  W AAYVQPSRRP
Sbjct: 1   MLTFQQIIFKLQTFWADKGCTVIQPFDMEVGAGTSHPATCLRALGPEPWFAAYVQPSRRP 60

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY +NPNRLQHYYQFQV +KP P N+Q+LY++SL+ +GIDP +HD+RFVED+WE+PT
Sbjct: 61  KDGRYGDNPNRLQHYYQFQVALKPAPANIQDLYLDSLRELGIDPKVHDIRFVEDDWENPT 120

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQQV GI+C+P+ GEITYG+ERLAMY+Q V +VYD+V+
Sbjct: 121 LGAWGLGWEVWLNGMEVTQFTYFQQVGGIDCTPVLGEITYGIERLAMYLQGVENVYDLVW 180

Query: 190 NAI-EGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHR 248
               +G  V YGD++ Q+E E S YNFEY++ + L   F D E +   LL          
Sbjct: 181 AKTLDGNTVTYGDVYHQNEVEQSTYNFEYSDADWLLRQFNDYEAQAKRLLA-------EE 233

Query: 249 HHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
           +     PAY+  +KA H FNLLDARG IS TER  YI RIR+L++A  + ++ +  
Sbjct: 234 NAALALPAYELVLKAGHTFNLLDARGAISVTERATYIGRIRALSRAVAQKYVESRE 289


>gi|121592957|ref|YP_984853.1| glycyl-tRNA synthetase subunit alpha [Acidovorax sp. JS42]
 gi|222109759|ref|YP_002552023.1| glycyl-tRNA synthetase subunit alpha [Acidovorax ebreus TPSY]
 gi|166200185|sp|A1W3F2|SYGA_ACISJ RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|254781822|sp|B9MCM3|SYGA_DIAST RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|120605037|gb|ABM40777.1| glycyl-tRNA synthetase alpha chain [Acidovorax sp. JS42]
 gi|221729203|gb|ACM32023.1| glycyl-tRNA synthetase, alpha subunit [Acidovorax ebreus TPSY]
          Length = 317

 Score =  553 bits (1426), Expect = e-155,   Method: Composition-based stats.
 Identities = 172/296 (58%), Positives = 214/296 (72%), Gaps = 11/296 (3%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ IIL L  YWA QGC +LQPYDMEVGAGT H +T LRALGP  WKAAYVQPSRRP
Sbjct: 1   MLTFQQIILKLQSYWADQGCALLQPYDMEVGAGTSHTATFLRALGPEPWKAAYVQPSRRP 60

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNRLQHYYQ+QV++KP P N+  LY+ SL+A+G D   +D+RFVED+WE+PT
Sbjct: 61  KDGRYGENPNRLQHYYQYQVVLKPAPDNILELYLGSLEALGFDLKKNDIRFVEDDWENPT 120

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQQV GI+C P +GEITYGLERLAMY+Q V++VY++ +
Sbjct: 121 LGAWGLGWEVWLNGMEVTQFTYFQQVGGIDCKPATGEITYGLERLAMYLQGVDNVYNLTW 180

Query: 190 NAIEGQ-NVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHR 248
                   + YGD++ Q+E E S YNFE+++ E L   F   EK+   L+          
Sbjct: 181 TEGPNGAKLTYGDVYHQNEVEQSTYNFEHSDAEFLFTAFGAHEKQANHLM---------- 230

Query: 249 HHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                 PAY+Q +KA+H FNLLDARG IS TER  YI RIR+LA+A  +A+L +  
Sbjct: 231 GEQLALPAYEQVLKAAHTFNLLDARGAISVTERAAYIGRIRNLARAVAKAYLDSRA 286


>gi|304388484|ref|ZP_07370587.1| glycyl-tRNA synthetase alpha subunit [Neisseria meningitidis ATCC
           13091]
 gi|304337481|gb|EFM03647.1| glycyl-tRNA synthetase alpha subunit [Neisseria meningitidis ATCC
           13091]
 gi|325141526|gb|EGC63996.1| glycyl-tRNA synthetase alpha chain [Neisseria meningitidis
           961-5945]
 gi|325199023|gb|ADY94479.1| glycyl-tRNA synthetase alpha chain [Neisseria meningitidis G2136]
          Length = 298

 Score =  553 bits (1426), Expect = e-155,   Method: Composition-based stats.
 Identities = 171/296 (57%), Positives = 218/296 (73%), Gaps = 8/296 (2%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ II  L  +WA +GCT++QP+DMEVGAGT HP+T LRALGP  W AAYVQPSRRP
Sbjct: 1   MLTFQQIIFKLQTFWADKGCTVIQPFDMEVGAGTSHPATCLRALGPEPWFAAYVQPSRRP 60

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY +NPNRLQHYYQFQV +KP P N+Q+LY++SL+ +GIDP +HD+RFVED+WE+PT
Sbjct: 61  KDGRYGDNPNRLQHYYQFQVALKPAPANIQDLYLDSLRELGIDPKVHDIRFVEDDWENPT 120

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQQV GI+C+P+ GEITYG+ERLAMY+Q V +VYD+V+
Sbjct: 121 LGAWGLGWEVWLNGMEVTQFTYFQQVGGIDCTPVLGEITYGIERLAMYLQGVENVYDLVW 180

Query: 190 NAI-EGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHR 248
               +G  V YGD++ Q+E E S YNFEY++ + L   F D E +   LL          
Sbjct: 181 AKTLDGNTVTYGDVYHQNEVEQSTYNFEYSDADWLLRQFNDYEAQAKRLLA-------VE 233

Query: 249 HHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                 PAY+  +KA H FNLLDARG IS TER  YI RIR+L++A  + ++ +  
Sbjct: 234 EASLALPAYELVLKAGHTFNLLDARGAISVTERATYIGRIRALSRAVAQKYVESRE 289


>gi|313669150|ref|YP_004049434.1| glycyl-tRNA synthetase alpha chain [Neisseria lactamica ST-640]
 gi|309379541|emb|CBX21907.1| unnamed protein product [Neisseria lactamica Y92-1009]
 gi|313006612|emb|CBN88078.1| glycyl-tRNA synthetase alpha chain [Neisseria lactamica 020-06]
 gi|325133393|gb|EGC56057.1| glycyl-tRNA synthetase, alpha subunit [Neisseria meningitidis
           M13399]
          Length = 301

 Score =  553 bits (1426), Expect = e-155,   Method: Composition-based stats.
 Identities = 171/296 (57%), Positives = 218/296 (73%), Gaps = 8/296 (2%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ II  L  +WA +GCT++QP+DMEVGAGT HP+T LRALGP  W AAYVQPSRRP
Sbjct: 1   MLTFQQIIFKLQTFWADKGCTVIQPFDMEVGAGTSHPATCLRALGPEPWFAAYVQPSRRP 60

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY +NPNRLQHYYQFQV +KP P N+Q+LY++SL+ +GIDP +HD+RFVED+WE+PT
Sbjct: 61  KDGRYGDNPNRLQHYYQFQVALKPAPANIQDLYLDSLRELGIDPKVHDIRFVEDDWENPT 120

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQQV GI+C+P+ GEITYG+ERLAMY+Q V +VYD+V+
Sbjct: 121 LGAWGLGWEVWLNGMEVTQFTYFQQVGGIDCTPVLGEITYGIERLAMYLQGVENVYDLVW 180

Query: 190 NA-IEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHR 248
               +G  V YGD++ Q+E E S YNFEY++ + L   F D E +   LL          
Sbjct: 181 AKTPDGNTVSYGDVYHQNEVEQSTYNFEYSDADWLLRQFNDYEAQAKRLLA-------VE 233

Query: 249 HHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                 PAY+  +KA H FNLLDARG IS TER  YI RIR+L++A  + ++ +  
Sbjct: 234 GASLALPAYELVLKAGHTFNLLDARGAISVTERATYIGRIRALSRAVAQKYVESRE 289


>gi|85711016|ref|ZP_01042077.1| Glycyl-tRNA synthetase, alpha subunit [Idiomarina baltica OS145]
 gi|85695420|gb|EAQ33357.1| Glycyl-tRNA synthetase, alpha subunit [Idiomarina baltica OS145]
          Length = 306

 Score =  553 bits (1426), Expect = e-155,   Method: Composition-based stats.
 Identities = 182/299 (60%), Positives = 221/299 (73%), Gaps = 10/299 (3%)

Query: 7   KKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPS 66
           K +  +FQ +IL L  YWAQQGC ++QP DMEVGAGTFHP T LR+LGP     AYVQP 
Sbjct: 3   KYDVNTFQGLILALQDYWAQQGCAVVQPLDMEVGAGTFHPMTFLRSLGPEPASFAYVQPC 62

Query: 67  RRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWE 126
           RRP DGRY ENPNRLQHYYQFQVI+KP+P ++Q LY+ SLK +G DPL HD+RFVEDNWE
Sbjct: 63  RRPTDGRYGENPNRLQHYYQFQVIMKPSPKDIQELYLGSLKLLGFDPLTHDIRFVEDNWE 122

Query: 127 SPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYD 186
           SPTLGAWGLGWE W +GME++QFTYFQQV GIEC P++GEITYGLERLAMY+Q V+S+YD
Sbjct: 123 SPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGIECKPVAGEITYGLERLAMYIQGVDSIYD 182

Query: 187 IVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEH 246
           +V+       + Y D+F Q+E E S YNFE AN + L   F + E+EC  L+++G+    
Sbjct: 183 LVWADGPRGKIFYRDVFHQNEVEQSTYNFEIANTDTLFRRFDECEQECNVLIERGLS--- 239

Query: 247 HRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNG 305
                   PAY+Q +KASH FNLLDAR  IS TERQRYILR+R++AKAC E +      
Sbjct: 240 -------LPAYEQVMKASHAFNLLDARHAISVTERQRYILRVRTMAKACAEVYYQAREA 291


>gi|92112143|ref|YP_572071.1| glycyl-tRNA synthetase subunit alpha [Chromohalobacter salexigens
           DSM 3043]
 gi|91795233|gb|ABE57372.1| glycyl-tRNA synthetase alpha chain [Chromohalobacter salexigens DSM
           3043]
          Length = 323

 Score =  553 bits (1426), Expect = e-155,   Method: Composition-based stats.
 Identities = 183/303 (60%), Positives = 230/303 (75%), Gaps = 11/303 (3%)

Query: 4   IHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYV 63
             +  +  +FQ +IL L QYWA+QGC ILQP DMEVGAGTFHP+T LR++GP +W AAYV
Sbjct: 2   TQSTPDVKTFQGLILALQQYWAEQGCVILQPLDMEVGAGTFHPATFLRSIGPETWNAAYV 61

Query: 64  QPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVED 123
           QPSRRP DGRY ENPNRLQHYYQFQV++KP+P  LQ LY+ SL+ +GIDP +HD+RFVED
Sbjct: 62  QPSRRPTDGRYGENPNRLQHYYQFQVVMKPSPQALQALYLGSLERLGIDPQVHDIRFVED 121

Query: 124 NWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNS 183
           NWESPTLGAWGLGWE W +GME++QFTYFQQ  GIEC P++GE+TYGLER+AMY+Q+V+S
Sbjct: 122 NWESPTLGAWGLGWEVWLNGMEVTQFTYFQQAGGIECYPVTGELTYGLERIAMYLQDVDS 181

Query: 184 VYDIVFN-AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGI 242
           VYD+V+  A +G +V YGD++ Q+E+E S YNFE+A+ + L   F   E EC  LL  G+
Sbjct: 182 VYDLVWTYAPDGSSVSYGDVYLQNEREQSAYNFEHADVDYLFGAFDHCEGECRKLLDAGL 241

Query: 243 PNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMT 302
           P           PAY+Q +KASH FNLLDAR  IS TERQRYILR+R++A+    A+  +
Sbjct: 242 P----------LPAYEQVLKASHTFNLLDARHAISVTERQRYILRVRTMARDVAHAYFES 291

Query: 303 PNG 305
              
Sbjct: 292 RKA 294


>gi|329297819|ref|ZP_08255155.1| glycyl-tRNA synthetase subunit alpha [Plautia stali symbiont]
          Length = 301

 Score =  553 bits (1426), Expect = e-155,   Method: Composition-based stats.
 Identities = 187/301 (62%), Positives = 222/301 (73%), Gaps = 10/301 (3%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +ILTL  YWA+QGCTI+QP DMEVGAGT HP T LRALGP    +AYVQ
Sbjct: 1   MQKFDTKTFQGLILTLQDYWARQGCTIVQPLDMEVGAGTSHPMTCLRALGPEPMASAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQV+IKPNP NLQ LY+ SLK +GIDP +HD+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVVIKPNPDNLQELYLGSLKELGIDPGVHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLERLAMY+Q V+SV
Sbjct: 121 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGLERLAMYIQGVDSV 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+ ++        YGD+F Q+E E S YNFEYA+ + L + F   EKE   LL    P 
Sbjct: 181 YDLTWSDGAFGKTTYGDVFHQNEVEQSTYNFEYADVDFLFSCFEQYEKEAQQLLVLEKP- 239

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY++ +KA+H FNLLDAR  IS TERQRYILRIR+L KA  EA+  +  
Sbjct: 240 ---------LPAYERILKAAHSFNLLDARKAISVTERQRYILRIRTLTKAVAEAYYASRE 290

Query: 305 G 305
            
Sbjct: 291 A 291


>gi|330881828|gb|EGH15977.1| glycyl-tRNA synthetase subunit alpha [Pseudomonas syringae pv.
           glycinea str. race 4]
          Length = 315

 Score =  553 bits (1426), Expect = e-155,   Method: Composition-based stats.
 Identities = 186/293 (63%), Positives = 223/293 (76%), Gaps = 10/293 (3%)

Query: 12  SFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPLD 71
           +FQ++IL L QYWA+QGC +LQPYDMEVGAGTFH +T LRA+GP +W AAYVQPSRRP D
Sbjct: 10  TFQDLILALQQYWAEQGCVVLQPYDMEVGAGTFHTATFLRAVGPETWNAAYVQPSRRPTD 69

Query: 72  GRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTLG 131
           GRY ENPNRLQHYYQFQVI+KPNP N Q LY+ SLK +G+DPL+HDVRFVEDNWESPTLG
Sbjct: 70  GRYGENPNRLQHYYQFQVILKPNPDNFQELYLGSLKHIGLDPLVHDVRFVEDNWESPTLG 129

Query: 132 AWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFNA 191
           AWGLGWE W +GME+SQFTYFQQV G+EC P++GEITYGLERLAMY Q V+SVYD+V+  
Sbjct: 130 AWGLGWEIWLNGMEVSQFTYFQQVGGLECYPVTGEITYGLERLAMYQQGVDSVYDLVWAD 189

Query: 192 IEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHHL 251
                V YGD+F Q+E E S YNFE+AN + L   F   E E   L++ G+P        
Sbjct: 190 GPFGKVTYGDVFHQNEVEQSTYNFEHANVDKLFELFDFYESEAARLIELGLP-------- 241

Query: 252 CVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
              P Y+  +KASH FNLLDAR  IS T RQ+YILR+R+LA++  +A+L    
Sbjct: 242 --LPGYEMVLKASHTFNLLDARRAISVTARQQYILRVRTLARSVAQAYLQARA 292


>gi|319404560|emb|CBI78166.1| glycyl-tRNA synthetase alpha chain [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 314

 Score =  553 bits (1425), Expect = e-155,   Method: Composition-based stats.
 Identities = 218/306 (71%), Positives = 257/306 (83%), Gaps = 1/306 (0%)

Query: 1   MAPIHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKA 60
           M    N     SFQ +IL+L  YWAQ GC ILQPYDMEVGAGTFHP+TTLR+LGP  WKA
Sbjct: 1   MNLPSNLNPKHSFQGLILSLQNYWAQHGCAILQPYDMEVGAGTFHPATTLRSLGPRPWKA 60

Query: 61  AYVQPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRF 120
           AYVQP+RRP DGRY  NPNRLQHYYQFQV++KP+P NLQ LYI SL+A+G+D  +HD+RF
Sbjct: 61  AYVQPTRRPTDGRYGTNPNRLQHYYQFQVLLKPSPPNLQELYIGSLQAIGLDTKLHDIRF 120

Query: 121 VEDNWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQN 180
           VED+WESPTLGAWGLGWECWCDGME+SQFTYFQQVCGIEC+P+SGEITYGLERLAMY+Q+
Sbjct: 121 VEDDWESPTLGAWGLGWECWCDGMEVSQFTYFQQVCGIECAPVSGEITYGLERLAMYIQD 180

Query: 181 VNSVYDIVFNAIEG-QNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLK 239
           V++VY++ FN ++G   + YGDIF Q+EQEYS YNFE+AN ++L  HFID+E+EC+ LL 
Sbjct: 181 VSNVYNLNFNGLDGADRISYGDIFLQAEQEYSHYNFEFANIDLLQQHFIDAERECIALLD 240

Query: 240 KGIPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAF 299
            G PN+ +  HLCVFPAYDQCIKASHIFNLL ARG+IS TERQ YILR+R LA+ CGEAF
Sbjct: 241 AGKPNKENNFHLCVFPAYDQCIKASHIFNLLQARGIISVTERQNYILRVRDLARRCGEAF 300

Query: 300 LMTPNG 305
           L+T  G
Sbjct: 301 LLTEAG 306


>gi|254450510|ref|ZP_05063947.1| glycyl-tRNA synthetase, alpha subunit [Octadecabacter antarcticus
           238]
 gi|198264916|gb|EDY89186.1| glycyl-tRNA synthetase, alpha subunit [Octadecabacter antarcticus
           238]
          Length = 309

 Score =  553 bits (1425), Expect = e-155,   Method: Composition-based stats.
 Identities = 194/302 (64%), Positives = 235/302 (77%), Gaps = 2/302 (0%)

Query: 8   KNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSR 67
               SFQ IIL L  YWA +GC I+QPYD+EVGAGTFHP+TTLR+LG + W AAYVQPSR
Sbjct: 3   DTPRSFQEIILRLQAYWAAKGCAIMQPYDLEVGAGTFHPATTLRSLGSVPWAAAYVQPSR 62

Query: 68  RPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWES 127
           RP DGRY ENPNRLQHYYQFQV+IKP+P +LQ+LY+ SL+A+G+D  +HD+RFVED+WES
Sbjct: 63  RPTDGRYGENPNRLQHYYQFQVLIKPSPPDLQDLYLGSLRAIGVDMDLHDIRFVEDDWES 122

Query: 128 PTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDI 187
           PTLGAWGLGWE WCDGME+SQFTYFQQV G EC P+SGE+TYGLERLAMYV  V+ V D+
Sbjct: 123 PTLGAWGLGWEVWCDGMEVSQFTYFQQVGGHECHPVSGELTYGLERLAMYVLGVDHVMDM 182

Query: 188 VFNAIEGQ-NVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKK-GIPNE 245
            +N  +    + YGD+F Q+EQEYSR+NF+ A+ +IL  HF D+E+EC  +L    +  +
Sbjct: 183 PYNDPDAMIPLTYGDVFKQAEQEYSRFNFDIADTDILLKHFEDAERECAAILSNDHVDPK 242

Query: 246 HHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNG 305
                +   PAYDQ IKASH+FNLLDARGVIS TERQ YI R+R+L K C +AFL T  G
Sbjct: 243 TGHKIVMAQPAYDQAIKASHLFNLLDARGVISVTERQAYIGRVRTLTKLCADAFLQTAAG 302

Query: 306 GH 307
           GH
Sbjct: 303 GH 304


>gi|323703325|ref|ZP_08114975.1| glycyl-tRNA synthetase, alpha subunit [Desulfotomaculum nigrificans
           DSM 574]
 gi|323531688|gb|EGB21577.1| glycyl-tRNA synthetase, alpha subunit [Desulfotomaculum nigrificans
           DSM 574]
          Length = 295

 Score =  553 bits (1425), Expect = e-155,   Method: Composition-based stats.
 Identities = 171/294 (58%), Positives = 222/294 (75%), Gaps = 14/294 (4%)

Query: 11  LSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPL 70
           ++FQ +ILTL ++WA+Q C ILQPYD+E GAGT +P+T LRALGP  W+ AYV+PSRRP 
Sbjct: 1   MNFQELILTLNKFWAEQNCIILQPYDIEKGAGTMNPATFLRALGPEPWRVAYVEPSRRPT 60

Query: 71  DGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTL 130
           DGRY ENPNRLQHY+Q+QVI+KP+P ++  +Y++SL+A+GIDP  HD+RFVEDNWESPTL
Sbjct: 61  DGRYGENPNRLQHYFQYQVILKPSPDDVIPIYLDSLRAIGIDPDRHDIRFVEDNWESPTL 120

Query: 131 GAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFN 190
           GAWGLGWE W DGMEI+QFTYFQQ  GI+C P+S EITYGLERLAM++Q  +SV+DIV+ 
Sbjct: 121 GAWGLGWEVWLDGMEITQFTYFQQCGGIDCHPVSAEITYGLERLAMFIQQKDSVFDIVWV 180

Query: 191 AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHH 250
                ++ YGD++ Q+E E S YNFE AN ++L + F   E E   +L+KG+        
Sbjct: 181 ----DDITYGDVYHQNEVEQSGYNFEAANTDMLFDLFDMYETEANRILEKGL-------- 228

Query: 251 LCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
             V PAYD  +K SH FNLLDARG IS +ERQ +I R+R +A+AC +A++    
Sbjct: 229 --VLPAYDYVLKCSHTFNLLDARGAISVSERQGFIARVRQMARACAQAYVEQRE 280


>gi|322515588|ref|ZP_08068568.1| glycyl-tRNA synthetase alpha subunit [Actinobacillus ureae ATCC
           25976]
 gi|322118344|gb|EFX90614.1| glycyl-tRNA synthetase alpha subunit [Actinobacillus ureae ATCC
           25976]
          Length = 302

 Score =  553 bits (1425), Expect = e-155,   Method: Composition-based stats.
 Identities = 177/302 (58%), Positives = 217/302 (71%), Gaps = 8/302 (2%)

Query: 4   IHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYV 63
           +  K N  +FQ +IL L  YWA  GCTI+QP+DMEVGAGT HP T LRALG      AYV
Sbjct: 1   MTTKFNVKTFQGMILALQDYWANVGCTIVQPFDMEVGAGTSHPMTALRALGSEPMAFAYV 60

Query: 64  QPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVED 123
           QPSRRP DGRY +NPNRLQHYYQFQV+IKP+P N+Q LY+ SL+ +G DP  +D+RFVED
Sbjct: 61  QPSRRPTDGRYGKNPNRLQHYYQFQVVIKPSPDNIQELYLGSLEMLGFDPTKNDIRFVED 120

Query: 124 NWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNS 183
           NWE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GE+TYGLERLAMY+Q V+S
Sbjct: 121 NWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEVTYGLERLAMYIQGVDS 180

Query: 184 VYDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIP 243
           VYD+V++        YGD+F Q+E E S YNFEYA+ + L   F   EKE  +LL    P
Sbjct: 181 VYDLVWSDGPLGKTTYGDVFHQNEVEQSTYNFEYADVDFLFKAFEQYEKEATELLALEKP 240

Query: 244 NEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTP 303
                      PAY++ +KA+H FN+LDAR  IS TERQRYILRIR+L K   EA+  + 
Sbjct: 241 --------LPLPAYERILKAAHSFNMLDARKAISVTERQRYILRIRTLTKGVAEAYYASR 292

Query: 304 NG 305
             
Sbjct: 293 EA 294


>gi|218777904|ref|YP_002429222.1| glycyl-tRNA synthetase subunit alpha [Desulfatibacillum
           alkenivorans AK-01]
 gi|226737032|sp|B8FKD9|SYGA_DESAA RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|218759288|gb|ACL01754.1| Glycyl-tRNAsynthetase, alpha subunit [Desulfatibacillum
           alkenivorans AK-01]
          Length = 288

 Score =  553 bits (1425), Expect = e-155,   Method: Composition-based stats.
 Identities = 177/294 (60%), Positives = 219/294 (74%), Gaps = 14/294 (4%)

Query: 11  LSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPL 70
           ++FQ+IILTL +YWA++GC ++QPYDMEVGAGTFHP T LR+LGP  WK AYVQPSRRP 
Sbjct: 1   MTFQDIILTLQKYWAEKGCVLVQPYDMEVGAGTFHPETLLRSLGPEPWKTAYVQPSRRPT 60

Query: 71  DGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTL 130
           DGRY ENPNRLQHYYQFQVIIKP+P ++Q LY++SLKA+GIDPL HD+RFVED+WESPTL
Sbjct: 61  DGRYGENPNRLQHYYQFQVIIKPSPDDVQGLYLDSLKAIGIDPLAHDIRFVEDDWESPTL 120

Query: 131 GAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFN 190
           GA GLGWE W DGMEI+QFTYFQ    IE SP++ E+TYGLER+AMY+Q +++VY++ +N
Sbjct: 121 GAAGLGWEVWLDGMEITQFTYFQLAGSIELSPVTVELTYGLERIAMYLQEIDNVYELDWN 180

Query: 191 AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHH 250
            +    V YGD+   +E E S YNFE AN ++L   F   E E    L+K +        
Sbjct: 181 GV----VKYGDLHHMNEVEQSTYNFEVANVDMLLGFFDSYEAEAKACLEKEL-------- 228

Query: 251 LCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
             V PAY+ C+K SH FNLLDARG IS TER  YI RIR++A+ C E +L    
Sbjct: 229 --VLPAYEYCLKCSHTFNLLDARGAISVTERTGYIARIRNMARGCAEKYLEQRE 280


>gi|28867424|ref|NP_790043.1| glycyl-tRNA synthetase subunit alpha [Pseudomonas syringae pv.
           tomato str. DC3000]
 gi|237801653|ref|ZP_04590114.1| glycyl-tRNA synthetase subunit alpha [Pseudomonas syringae pv.
           oryzae str. 1_6]
 gi|302060158|ref|ZP_07251699.1| glycyl-tRNA synthetase subunit alpha [Pseudomonas syringae pv.
           tomato K40]
 gi|302130431|ref|ZP_07256421.1| glycyl-tRNA synthetase subunit alpha [Pseudomonas syringae pv.
           tomato NCPPB 1108]
 gi|38258483|sp|Q88B36|SYGA_PSESM RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|28850658|gb|AAO53738.1| glycyl-tRNA synthetase, alpha subunit [Pseudomonas syringae pv.
           tomato str. DC3000]
 gi|330876371|gb|EGH10520.1| glycyl-tRNA synthetase subunit alpha [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
 gi|330965129|gb|EGH65389.1| glycyl-tRNA synthetase subunit alpha [Pseudomonas syringae pv.
           actinidiae str. M302091]
 gi|331017694|gb|EGH97750.1| glycyl-tRNA synthetase subunit alpha [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
 gi|331024512|gb|EGI04568.1| glycyl-tRNA synthetase subunit alpha [Pseudomonas syringae pv.
           oryzae str. 1_6]
          Length = 315

 Score =  553 bits (1425), Expect = e-155,   Method: Composition-based stats.
 Identities = 186/293 (63%), Positives = 222/293 (75%), Gaps = 10/293 (3%)

Query: 12  SFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPLD 71
           +FQ++IL L QYWA+QGC +LQPYDMEVGAGTFH +T LRA+GP +W AAYVQPSRRP D
Sbjct: 10  TFQDLILALQQYWAEQGCVVLQPYDMEVGAGTFHTATFLRAVGPETWNAAYVQPSRRPTD 69

Query: 72  GRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTLG 131
           GRY ENPNRLQHYYQFQVI+KPNP N Q LY+ SLK +G+DPL+HDVRFVEDNWESPTLG
Sbjct: 70  GRYGENPNRLQHYYQFQVILKPNPDNFQELYLGSLKHIGLDPLVHDVRFVEDNWESPTLG 129

Query: 132 AWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFNA 191
           AWGLGWE W +GME+SQFTYFQQV GIEC P++GEITYGLERLAMY Q V+SVYD+V+  
Sbjct: 130 AWGLGWEIWLNGMEVSQFTYFQQVGGIECYPVTGEITYGLERLAMYQQGVDSVYDLVWAD 189

Query: 192 IEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHHL 251
                V YGD+F Q+E E S YNFE+AN + L   F   E E   L++  +P        
Sbjct: 190 GPFGKVTYGDVFHQNEVEQSTYNFEHANVDKLFELFDFYESEAARLIELELP-------- 241

Query: 252 CVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
              P Y+  +KASH FNLLDAR  IS T RQ+YILR+R+LA++  +A+L    
Sbjct: 242 --LPGYEMVLKASHTFNLLDARRAISVTARQQYILRVRTLARSVAQAYLQARA 292


>gi|254670878|emb|CBA07387.1| glycyl-tRNA synthetase alpha chain [Neisseria meningitidis
           alpha153]
          Length = 301

 Score =  553 bits (1425), Expect = e-155,   Method: Composition-based stats.
 Identities = 171/296 (57%), Positives = 219/296 (73%), Gaps = 8/296 (2%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ II  L  +WA +GCT++QP+DMEVGAGT HP+T LRALGP  W AAYVQPSRRP
Sbjct: 1   MLTFQQIIFKLQTFWADKGCTVIQPFDMEVGAGTSHPATCLRALGPEPWFAAYVQPSRRP 60

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY +NPNRLQHYYQFQV +KP P N+Q+LY++SL+ +GIDP +HD+RFVED+WE+PT
Sbjct: 61  KDGRYGDNPNRLQHYYQFQVALKPAPANIQDLYLDSLRELGIDPKVHDIRFVEDDWENPT 120

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQQV GI+C+P+ GEITYG+ERLAMY+Q V +VYD+V+
Sbjct: 121 LGAWGLGWEVWLNGMEVTQFTYFQQVGGIDCTPVLGEITYGIERLAMYLQGVENVYDLVW 180

Query: 190 NA-IEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHR 248
               +G  V YGD++ Q+E E S YNFEY++ + L   F D E +   LL          
Sbjct: 181 AKTPDGNTVSYGDVYHQNEVEQSTYNFEYSDADWLLRQFNDYEAQAKRLLA-------EE 233

Query: 249 HHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
           +     PAY+  +KA H FNLLDARG IS TER  YI RIR+L++A  + ++ +  
Sbjct: 234 NAALALPAYELVLKAGHTFNLLDARGAISVTERATYIGRIRALSRAVAQKYVESRE 289


>gi|296133897|ref|YP_003641144.1| glycyl-tRNA synthetase, alpha subunit [Thermincola sp. JR]
 gi|296032475|gb|ADG83243.1| glycyl-tRNA synthetase, alpha subunit [Thermincola potens JR]
          Length = 292

 Score =  552 bits (1424), Expect = e-155,   Method: Composition-based stats.
 Identities = 166/294 (56%), Positives = 218/294 (74%), Gaps = 14/294 (4%)

Query: 11  LSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPL 70
           ++FQ+IILTL ++W+++ C I QPYD+E GAGT +P+T LRALGP  W  AYV+PSRRP 
Sbjct: 1   MNFQDIILTLNKFWSERNCIIQQPYDVEKGAGTMNPATFLRALGPEPWNVAYVEPSRRPT 60

Query: 71  DGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTL 130
           DGRY +NPNRLQHYYQ+QVI+KP+P N+  +Y++SL+A+GI+P  HD+RFVEDNWESPTL
Sbjct: 61  DGRYGDNPNRLQHYYQYQVILKPHPENVVEIYLDSLRAIGINPEEHDIRFVEDNWESPTL 120

Query: 131 GAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFN 190
           GAWGLGWE W DGMEI+QFTYFQQ  G++C P+  EITYGLERLA ++Q  +SV+DI++ 
Sbjct: 121 GAWGLGWEVWLDGMEITQFTYFQQCGGLDCKPVCAEITYGLERLATFIQKKDSVFDIIWV 180

Query: 191 AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHH 250
                 + YGD+  Q E E+S YNFE A+ ++L N F   EKE + +++KG         
Sbjct: 181 ----DGITYGDVHHQGEVEHSHYNFEIADTDMLFNAFNMFEKEAVRVIEKGF-------- 228

Query: 251 LCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
             V PAYD  +K SH FNLLDARG IS TERQ YI R+R++A+ C +A++    
Sbjct: 229 --VLPAYDYVLKCSHTFNLLDARGAISVTERQGYIARVRNMARLCAQAYVEQRE 280


>gi|257485591|ref|ZP_05639632.1| glycyl-tRNA synthetase subunit alpha [Pseudomonas syringae pv.
           tabaci ATCC 11528]
 gi|289626618|ref|ZP_06459572.1| glycyl-tRNA synthetase subunit alpha [Pseudomonas syringae pv.
           aesculi str. NCPPB3681]
 gi|289648600|ref|ZP_06479943.1| glycyl-tRNA synthetase subunit alpha [Pseudomonas syringae pv.
           aesculi str. 2250]
 gi|289677559|ref|ZP_06498449.1| glycyl-tRNA synthetase subunit alpha [Pseudomonas syringae pv.
           syringae FF5]
 gi|298484620|ref|ZP_07002724.1| Glycyl-tRNA synthetase alpha chain [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|302185850|ref|ZP_07262523.1| glycyl-tRNA synthetase subunit alpha [Pseudomonas syringae pv.
           syringae 642]
 gi|298160844|gb|EFI01861.1| Glycyl-tRNA synthetase alpha chain [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|320326675|gb|EFW82720.1| glycyl-tRNA synthetase subunit alpha [Pseudomonas syringae pv.
           glycinea str. B076]
 gi|320331350|gb|EFW87293.1| glycyl-tRNA synthetase subunit alpha [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330937260|gb|EGH41274.1| glycyl-tRNA synthetase subunit alpha [Pseudomonas syringae pv. pisi
           str. 1704B]
 gi|330952322|gb|EGH52582.1| glycyl-tRNA synthetase subunit alpha [Pseudomonas syringae Cit 7]
 gi|330961520|gb|EGH61780.1| glycyl-tRNA synthetase subunit alpha [Pseudomonas syringae pv.
           maculicola str. ES4326]
 gi|330970336|gb|EGH70402.1| glycyl-tRNA synthetase subunit alpha [Pseudomonas syringae pv.
           aceris str. M302273PT]
 gi|330976413|gb|EGH76469.1| glycyl-tRNA synthetase subunit alpha [Pseudomonas syringae pv.
           aptata str. DSM 50252]
 gi|330985730|gb|EGH83833.1| glycyl-tRNA synthetase subunit alpha [Pseudomonas syringae pv.
           lachrymans str. M301315]
 gi|331011879|gb|EGH91935.1| glycyl-tRNA synthetase subunit alpha [Pseudomonas syringae pv.
           tabaci ATCC 11528]
          Length = 315

 Score =  552 bits (1424), Expect = e-155,   Method: Composition-based stats.
 Identities = 185/293 (63%), Positives = 222/293 (75%), Gaps = 10/293 (3%)

Query: 12  SFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPLD 71
           +FQ++IL L QYWA+QGC +LQPYDMEVGAGTFH +T LRA+GP +W AAYVQPSRRP D
Sbjct: 10  TFQDLILALQQYWAEQGCVVLQPYDMEVGAGTFHTATFLRAVGPETWNAAYVQPSRRPTD 69

Query: 72  GRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTLG 131
           GRY ENPNRLQHYYQFQVI+KPNP N Q LY+ SLK +G+DPL+HDVRFVEDNWESPTLG
Sbjct: 70  GRYGENPNRLQHYYQFQVILKPNPDNFQELYLGSLKHIGLDPLVHDVRFVEDNWESPTLG 129

Query: 132 AWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFNA 191
           AWGLGWE W +GME+SQFTYFQQV G+EC P++GEITYGLERLAMY Q V+SVYD+V+  
Sbjct: 130 AWGLGWEIWLNGMEVSQFTYFQQVGGLECYPVTGEITYGLERLAMYQQGVDSVYDLVWAD 189

Query: 192 IEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHHL 251
                V YGD+F Q+E E S YNFE+AN + L   F   E E   L++  +P        
Sbjct: 190 GPFGKVTYGDVFHQNEVEQSTYNFEHANVDKLFELFDFYESEAARLIELELP-------- 241

Query: 252 CVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
              P Y+  +KASH FNLLDAR  IS T RQ+YILR+R+LA++  +A+L    
Sbjct: 242 --LPGYEMVLKASHTFNLLDARRAISVTARQQYILRVRTLARSVAQAYLQARA 292


>gi|308047729|ref|YP_003911295.1| glycyl-tRNA synthetase alpha chain [Ferrimonas balearica DSM 9799]
 gi|307629919|gb|ADN74221.1| glycyl-tRNA synthetase alpha chain [Ferrimonas balearica DSM 9799]
          Length = 303

 Score =  552 bits (1424), Expect = e-155,   Method: Composition-based stats.
 Identities = 181/301 (60%), Positives = 223/301 (74%), Gaps = 8/301 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +IL L  YWAQQGC ++QP D EVGAGT HP T LRALGP  + AAYVQ
Sbjct: 1   MQKYDTKTFQGMILALQDYWAQQGCAVVQPLDKEVGAGTSHPLTCLRALGPEPFAAAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQV++KP+P N+Q+LY+ SL+A+G+D  +HD+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVMLKPSPDNIQDLYLGSLRALGVDTQVHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W DGME++QFTYFQQV G+EC P++GEITYG+ERLAMY+Q V++V
Sbjct: 121 WENPTLGAWGLGWEVWLDGMEVTQFTYFQQVGGLECKPVTGEITYGIERLAMYIQGVDNV 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V+       + YGD+F Q+E E S YNFE+A+ + L  HF  SEKEC  LL    P 
Sbjct: 181 YDLVWCDGPFGTITYGDVFLQNEIEQSTYNFEHADVDFLFAHFDQSEKECQKLLALEKP- 239

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY++ + A+H FNLLDAR  IS TERQRYILRIR+L KA  EA+  +  
Sbjct: 240 -------LPLPAYERILDAAHAFNLLDARKAISVTERQRYILRIRTLTKAVAEAYYASRE 292

Query: 305 G 305
            
Sbjct: 293 A 293


>gi|320191384|gb|EFW66034.1| Glycyl-tRNA synthetase alpha chain [Escherichia coli O157:H7 str.
           EC1212]
 gi|323153888|gb|EFZ40122.1| glycyl-tRNA synthetase alpha subunit [Escherichia coli EPECa14]
 gi|332751260|gb|EGJ81663.1| glycyl-tRNA synthetase alpha subunit [Shigella flexneri 2747-71]
 gi|332997462|gb|EGK17078.1| glycyl-tRNA synthetase alpha subunit [Shigella flexneri K-218]
 gi|333012923|gb|EGK32300.1| glycyl-tRNA synthetase alpha subunit [Shigella flexneri K-304]
          Length = 292

 Score =  552 bits (1424), Expect = e-155,   Method: Composition-based stats.
 Identities = 184/290 (63%), Positives = 217/290 (74%), Gaps = 8/290 (2%)

Query: 16  IILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPLDGRYA 75
           +ILTL  YWA+QGCTI+QP DMEVGAGT HP T LRALGP    AAYVQPSRRP DGRY 
Sbjct: 1   MILTLQDYWARQGCTIVQPLDMEVGAGTSHPMTCLRALGPEPMAAAYVQPSRRPTDGRYG 60

Query: 76  ENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTLGAWGL 135
           ENPNRLQHYYQFQV+IKP+P N+Q LY+ SLK +G+DP IHD+RFVEDNWE+PTLGAWGL
Sbjct: 61  ENPNRLQHYYQFQVVIKPSPDNIQELYLGSLKELGMDPTIHDIRFVEDNWENPTLGAWGL 120

Query: 136 GWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFNAIEGQ 195
           GWE W +GME++QFTYFQQV G+EC P++GEITYGLERLAMY+Q V+SVYD+V++     
Sbjct: 121 GWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGLERLAMYIQGVDSVYDLVWSDGPLG 180

Query: 196 NVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHHLCVFP 255
              YGD+F Q+E E S YNFEYA+ + L   F   EKE   LL    P           P
Sbjct: 181 KTTYGDVFHQNEVEQSTYNFEYADVDFLFTCFEQYEKEAQQLLALENP--------LPLP 232

Query: 256 AYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNG 305
           AY++ +KA+H FNLLDAR  IS TERQRYILRIR+L KA  EA+  +   
Sbjct: 233 AYERILKAAHSFNLLDARKAISVTERQRYILRIRTLTKAVAEAYYASREA 282


>gi|261365486|ref|ZP_05978369.1| glycyl-tRNA synthetase, alpha subunit [Neisseria mucosa ATCC 25996]
 gi|288566018|gb|EFC87578.1| glycyl-tRNA synthetase, alpha subunit [Neisseria mucosa ATCC 25996]
          Length = 298

 Score =  552 bits (1424), Expect = e-155,   Method: Composition-based stats.
 Identities = 170/296 (57%), Positives = 218/296 (73%), Gaps = 8/296 (2%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ II  L  +WA +GCT++QP+DMEVGAGT HP+T LRALGP  W AAYVQPSRRP
Sbjct: 1   MLTFQQIIFKLQTFWADKGCTVIQPFDMEVGAGTSHPATCLRALGPEPWFAAYVQPSRRP 60

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY +NPNRLQHYYQFQV +KP P N+Q+LY++SL+ +GIDP +HD+RFVED+WE+PT
Sbjct: 61  KDGRYGDNPNRLQHYYQFQVALKPAPANIQDLYLDSLRELGIDPKVHDIRFVEDDWENPT 120

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQQV GI+C+P+ GEITYG+ERLAMY+Q V +VYD+V+
Sbjct: 121 LGAWGLGWEVWLNGMEVTQFTYFQQVGGIDCTPVLGEITYGIERLAMYLQGVENVYDLVW 180

Query: 190 NAI-EGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHR 248
               +G  V YGD++ Q+E E S YNFEY++ + L   F D E +   LL          
Sbjct: 181 AKTLDGNTVTYGDVYHQNEVEQSTYNFEYSDADWLLRQFNDYEAQAKRLLA-------EE 233

Query: 249 HHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
           +     PAY+  +KA H FNLLDARG IS TER  YI RIR+L++   + ++ +  
Sbjct: 234 NASLALPAYELVLKAGHTFNLLDARGAISVTERATYIGRIRALSRTVAQKYVESRE 289


>gi|222054673|ref|YP_002537035.1| glycyl-tRNA synthetase, alpha subunit [Geobacter sp. FRC-32]
 gi|221563962|gb|ACM19934.1| glycyl-tRNA synthetase, alpha subunit [Geobacter sp. FRC-32]
          Length = 292

 Score =  552 bits (1424), Expect = e-155,   Method: Composition-based stats.
 Identities = 173/295 (58%), Positives = 218/295 (73%), Gaps = 14/295 (4%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ++IL+L  YWA QGC I QPYD E GAGTF+P+T LR LGP  W  AYV+PSRRP
Sbjct: 1   MLTFQDLILSLQGYWAGQGCVIQQPYDCEKGAGTFNPATFLRVLGPEPWNVAYVEPSRRP 60

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNRLQHYYQFQVI+KP+P+N+ +LY++SL++ GI+P  HD+RFVED+WESPT
Sbjct: 61  TDGRYGENPNRLQHYYQFQVIMKPSPMNILDLYLDSLRSFGINPNQHDIRFVEDDWESPT 120

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W DGMEI+QFTYFQQ  GI+  P+S EITYG ER+AMY+Q V++VYD+ +
Sbjct: 121 LGAWGLGWEVWLDGMEITQFTYFQQAGGIDLKPVSSEITYGCERIAMYLQGVDNVYDLEW 180

Query: 190 NAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRH 249
                + V YGDI  +SE E+S YNFE A+ ++L   F   EKEC+ L++KG+       
Sbjct: 181 V----KGVRYGDIHHESEVEFSTYNFEEADVDMLLQLFRMYEKECVRLVEKGL------- 229

Query: 250 HLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
              V PAYD  +K SH FNLLDARG IS TER  YI ++R++A+ C E +L    
Sbjct: 230 ---VLPAYDYVMKCSHTFNLLDARGAISVTERASYIGKVRNVARLCAEGYLQMRE 281


>gi|298369578|ref|ZP_06980895.1| glycyl-tRNA synthetase, alpha subunit [Neisseria sp. oral taxon 014
           str. F0314]
 gi|298282135|gb|EFI23623.1| glycyl-tRNA synthetase, alpha subunit [Neisseria sp. oral taxon 014
           str. F0314]
          Length = 303

 Score =  552 bits (1423), Expect = e-155,   Method: Composition-based stats.
 Identities = 170/296 (57%), Positives = 218/296 (73%), Gaps = 8/296 (2%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ II  L  +WA +GCT++QP+DMEVGAGT HP+T LRALGP  W AAYVQPSRRP
Sbjct: 1   MLTFQQIIFKLQTFWADKGCTVIQPFDMEVGAGTSHPATCLRALGPEPWFAAYVQPSRRP 60

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY +NPNRLQHYYQFQV +KP P N+Q+LY++SL+ +GIDP +HD+RFVED+WE+PT
Sbjct: 61  KDGRYGDNPNRLQHYYQFQVALKPAPANIQDLYLDSLRELGIDPKVHDIRFVEDDWENPT 120

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQQV GI+C+P+ GEITYG+ERLAMY+Q V +VYD+V+
Sbjct: 121 LGAWGLGWEVWLNGMEVTQFTYFQQVGGIDCTPVLGEITYGIERLAMYLQGVENVYDLVW 180

Query: 190 NAI-EGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHR 248
               +G  V YGD++ Q+E E S YNFEY++ + L   F D E +   LL          
Sbjct: 181 AKTLDGNTVTYGDVYHQNEVEQSTYNFEYSDADWLLRQFNDYEAQAKRLLA-------EE 233

Query: 249 HHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
           +     PAY+  +KA H FNLLDARG IS TER  YI RIR+L++   + ++ +  
Sbjct: 234 NASLALPAYELVLKAGHTFNLLDARGAISVTERATYIGRIRALSRTVAQKYVESRE 289


>gi|29655198|ref|NP_820890.1| glycyl-tRNA synthetase subunit alpha [Coxiella burnetii RSA 493]
 gi|153209356|ref|ZP_01947363.1| glycyl-tRNA synthetase, alpha subunit [Coxiella burnetii 'MSU Goat
           Q177']
 gi|154707612|ref|YP_001423633.1| glycyl-tRNA synthetase subunit alpha [Coxiella burnetii Dugway
           5J108-111]
 gi|161830849|ref|YP_001597729.1| glycyl-tRNA synthetase subunit alpha [Coxiella burnetii RSA 331]
 gi|212211690|ref|YP_002302626.1| glycyl-tRNA synthetase subunit alpha [Coxiella burnetii CbuG_Q212]
 gi|212217706|ref|YP_002304493.1| glycyl-tRNA synthetase subunit alpha [Coxiella burnetii CbuK_Q154]
 gi|11387189|sp|P94616|SYGA_COXBU RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|189082250|sp|A9KBT8|SYGA_COXBN RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|189082251|sp|A9NB98|SYGA_COXBR RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|238064836|sp|B6J8U0|SYGA_COXB1 RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|238064837|sp|B6J2A7|SYGA_COXB2 RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|1780764|emb|CAA71456.1| unnamed protein product [Coxiella burnetii]
 gi|29542470|gb|AAO91404.1| glycyl-tRNA synthetase alpha chain [Coxiella burnetii RSA 493]
 gi|120575389|gb|EAX32013.1| glycyl-tRNA synthetase, alpha subunit [Coxiella burnetii 'MSU Goat
           Q177']
 gi|154356898|gb|ABS78360.1| glycyl-tRNA synthetase alpha chain [Coxiella burnetii Dugway
           5J108-111]
 gi|161762716|gb|ABX78358.1| glycyl-tRNA synthetase, alpha subunit [Coxiella burnetii RSA 331]
 gi|212010100|gb|ACJ17481.1| glycyl-tRNA synthetase alpha chain [Coxiella burnetii CbuG_Q212]
 gi|212011968|gb|ACJ19348.1| glycyl-tRNA synthetase alpha chain [Coxiella burnetii CbuK_Q154]
          Length = 319

 Score =  552 bits (1423), Expect = e-155,   Method: Composition-based stats.
 Identities = 177/300 (59%), Positives = 225/300 (75%), Gaps = 10/300 (3%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
               + ++FQ +IL L +YWA QGC +LQP+DMEVGAGTFHP+T LRA+GP  W+AAYVQ
Sbjct: 1   MKSSHPVNFQQMILALQEYWASQGCVLLQPFDMEVGAGTFHPATFLRAIGPEPWRAAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY +NPNR QHYYQFQV++KP+P ++Q++Y+ SLKA+GIDPL HD+RFVEDN
Sbjct: 61  PSRRPTDGRYGDNPNRTQHYYQFQVVLKPSPDDIQDIYLGSLKALGIDPLTHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLG+WG+GWE W DGMEI+QFTYFQQ+ G+EC P++GEITYGLERLAM++Q ++++
Sbjct: 121 WEAPTLGSWGVGWEVWQDGMEITQFTYFQQIGGLECKPVTGEITYGLERLAMFLQGIDNM 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           +D+V+       V YG IF Q+E E S YNFEYAN E L N F   EKE   L++  +P 
Sbjct: 181 FDLVWTEGPNGRVTYGQIFQQNEVEMSAYNFEYANVEALFNFFDFYEKEASQLIEVHLP- 239

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                      AY+  +KASH FNLLDAR  IS TERQR+ILR+R LA+A  EA+     
Sbjct: 240 ---------LAAYEMVLKASHTFNLLDARQAISVTERQRFILRVRKLAQAVAEAYYSARE 290


>gi|121998010|ref|YP_001002797.1| glycyl-tRNA synthetase subunit alpha [Halorhodospira halophila SL1]
 gi|121589415|gb|ABM61995.1| glycyl-tRNA synthetase alpha chain [Halorhodospira halophila SL1]
          Length = 304

 Score =  552 bits (1423), Expect = e-155,   Method: Composition-based stats.
 Identities = 181/295 (61%), Positives = 222/295 (75%), Gaps = 10/295 (3%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
              FQ +IL L QYWA+QGC +LQP D+EVGAGTFHP+T LRA+GP  W AAYVQPSRRP
Sbjct: 5   PRDFQELILNLQQYWARQGCVVLQPLDIEVGAGTFHPATFLRAVGPEPWHAAYVQPSRRP 64

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY +NPNRLQHYYQFQV++KP+P + Q  Y+ SL+ +GIDP IHD+RFVED+WESPT
Sbjct: 65  TDGRYGDNPNRLQHYYQFQVVLKPSPADFQERYLGSLEQLGIDPQIHDIRFVEDDWESPT 124

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GMEISQFTYFQQV G++C P+ GEITYGLER+AMY+QNV SVYD+V+
Sbjct: 125 LGAWGLGWEVWLNGMEISQFTYFQQVGGLDCRPVMGEITYGLERIAMYLQNVESVYDLVW 184

Query: 190 NAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRH 249
              +   V YGD+F Q+E+E S YNFE A  E L   F   E+EC  L+++G+P      
Sbjct: 185 THTDAGPVTYGDVFLQNEREQSAYNFEQAPVEALLAAFGHQEQECRRLVEEGLP------ 238

Query: 250 HLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                PAY+Q +KASH FNLLDARG IS TERQ YILR+R+LA+   + +  +  
Sbjct: 239 ----LPAYEQVLKASHTFNLLDARGAISVTERQGYILRVRNLARTVAQGYYQSRE 289


>gi|256823751|ref|YP_003147714.1| glycyl-tRNA synthetase subunit alpha [Kangiella koreensis DSM
           16069]
 gi|256797290|gb|ACV27946.1| glycyl-tRNA synthetase, alpha subunit [Kangiella koreensis DSM
           16069]
          Length = 308

 Score =  552 bits (1423), Expect = e-155,   Method: Composition-based stats.
 Identities = 180/296 (60%), Positives = 222/296 (75%), Gaps = 10/296 (3%)

Query: 9   NDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRR 68
           +  +FQ +ILTL  YWA+QGC I QP D+EVGAGTFHP+T LRA+GP  W AAYVQP RR
Sbjct: 3   DTKTFQGLILTLQNYWAEQGCVIQQPLDLEVGAGTFHPATFLRAIGPEPWSAAYVQPCRR 62

Query: 69  PLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESP 128
           P DGRY ENPNRLQHYYQFQV+IKP+PL++Q +Y+ SLKA+G+DPL HD+RFVEDNWESP
Sbjct: 63  PTDGRYGENPNRLQHYYQFQVVIKPSPLDIQEMYLGSLKAMGLDPLEHDIRFVEDNWESP 122

Query: 129 TLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIV 188
           TLGAWGLGWE W +GME++QFTYFQQV G+EC P+ GEITYGLER+AMY+Q V+S+YD+V
Sbjct: 123 TLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVMGEITYGLERIAMYLQGVDSIYDLV 182

Query: 189 FNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHR 248
           +       V Y D+F Q+E E S YNFEYAN E L   F   E E + L++  +P     
Sbjct: 183 WTDGPLGKVYYRDVFHQNEVEQSTYNFEYANVEKLFEFFDYCESESMSLMEHNLP----- 237

Query: 249 HHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                 PAY+  +KASH FNLLDAR  IS TERQR+ILR+R+LA++  E++     
Sbjct: 238 -----LPAYEMVLKASHAFNLLDARHAISVTERQRFILRVRALARSVAESYYAARE 288


>gi|288959117|ref|YP_003449458.1| glycyl-tRNA synthetase alpha chain [Azospirillum sp. B510]
 gi|288911425|dbj|BAI72914.1| glycyl-tRNA synthetase alpha chain [Azospirillum sp. B510]
          Length = 298

 Score =  552 bits (1423), Expect = e-155,   Method: Composition-based stats.
 Identities = 198/292 (67%), Positives = 236/292 (80%), Gaps = 13/292 (4%)

Query: 8   KNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSR 67
           +  LSFQ +IL L QYW++QGC ILQPYDMEVGAGTFHP+TTLRALGP  WKAAYVQPSR
Sbjct: 16  RRGLSFQALILKLHQYWSEQGCVILQPYDMEVGAGTFHPATTLRALGPDPWKAAYVQPSR 75

Query: 68  RPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWES 127
           RP DGRY ENPNRLQHYYQ+QVI+KP+P N Q LY+ SL+A+GIDP +HD+RFVED+WES
Sbjct: 76  RPKDGRYGENPNRLQHYYQYQVIMKPSPANPQELYLNSLRAIGIDPALHDIRFVEDDWES 135

Query: 128 PTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDI 187
           PTLGAWGLGWE WCDGME++Q+TYFQQV GIEC P++ E+TYGLERLAMYVQ V +VYD+
Sbjct: 136 PTLGAWGLGWEVWCDGMEVTQYTYFQQVGGIECDPVAVELTYGLERLAMYVQGVENVYDL 195

Query: 188 VFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHH 247
            FN   GQ V YGD+F ++E EYS++NFE+AN ++L  HF D+E EC  L+ + +     
Sbjct: 196 DFN---GQGVKYGDVFKRAEVEYSKHNFEFANTDMLLQHFKDAEAECQALVARNL----- 247

Query: 248 RHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAF 299
                  PAYDQCIKASH+FNLLDARGVIS  ER  YI R+R+LAKAC EA+
Sbjct: 248 -----ALPAYDQCIKASHLFNLLDARGVISVVERAAYIGRVRALAKACCEAW 294


>gi|320539961|ref|ZP_08039620.1| putative glycine tRNA synthetase, alpha subunit [Serratia
           symbiotica str. Tucson]
 gi|320030147|gb|EFW12167.1| putative glycine tRNA synthetase, alpha subunit [Serratia
           symbiotica str. Tucson]
          Length = 337

 Score =  552 bits (1423), Expect = e-155,   Method: Composition-based stats.
 Identities = 182/301 (60%), Positives = 219/301 (72%), Gaps = 8/301 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +ILTL  YWA+QGCT++QP D+EVGAGT HP T LRALGP     AYVQ
Sbjct: 31  MQKFDTKTFQGLILTLQDYWARQGCTLVQPLDIEVGAGTSHPMTCLRALGPEPMATAYVQ 90

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQV+IKP+P N+Q LY+ SLK +G+DP IHD+RFVEDN
Sbjct: 91  PSRRPTDGRYGENPNRLQHYYQFQVVIKPSPDNIQELYLGSLKELGLDPTIHDIRFVEDN 150

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLERLAMY+Q V+SV
Sbjct: 151 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGLERLAMYIQGVDSV 210

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V++        YGD+F Q+E E S YNF YA+ + L + F   EKE   LL    P 
Sbjct: 211 YDLVWSHGSQGITTYGDVFHQNEVEQSTYNFTYADVDFLFSCFEQYEKEAQSLLALEKP- 269

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY++ +KA H FNLLD R  IS TERQRYILRIR+L KA  EA+  +  
Sbjct: 270 -------LPLPAYERILKAGHTFNLLDTRKAISVTERQRYILRIRTLTKAVAEAYYASRE 322

Query: 305 G 305
            
Sbjct: 323 A 323


>gi|145628139|ref|ZP_01783940.1| glycyl-tRNA synthetase alpha subunit [Haemophilus influenzae
           22.1-21]
 gi|144979914|gb|EDJ89573.1| glycyl-tRNA synthetase alpha subunit [Haemophilus influenzae
           22.1-21]
          Length = 302

 Score =  552 bits (1423), Expect = e-155,   Method: Composition-based stats.
 Identities = 180/302 (59%), Positives = 219/302 (72%), Gaps = 8/302 (2%)

Query: 4   IHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYV 63
           +  K N  +FQ +IL L +YWA QGCTI+QP+DMEVGAGT HP T LRALGP     AYV
Sbjct: 1   MSTKFNVKTFQGMILALQEYWANQGCTIVQPFDMEVGAGTSHPMTALRALGPEPMAFAYV 60

Query: 64  QPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVED 123
           QPSRRP DGRY ENPNRLQHYYQFQV+IKP+P N+Q LY+ SL+ +G DP  +D+RFVED
Sbjct: 61  QPSRRPTDGRYGENPNRLQHYYQFQVVIKPSPDNIQELYLGSLEMLGFDPTQNDIRFVED 120

Query: 124 NWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNS 183
           NWE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GE+TYGLERLAMY+Q V+S
Sbjct: 121 NWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEVTYGLERLAMYIQGVDS 180

Query: 184 VYDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIP 243
           VYD+V++        YGD+F Q+E E S YNFE+AN + L   F   EKE  +LL    P
Sbjct: 181 VYDLVWSDGPLGKTTYGDVFHQNEVEQSTYNFEHANTDFLFYCFDQYEKEAQELLALEKP 240

Query: 244 NEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTP 303
                       AY++ +KA+H FNLLDAR  IS TERQRYILRIR+L K   EA+  + 
Sbjct: 241 --------LPLLAYERILKAAHSFNLLDARKAISVTERQRYILRIRALTKGVAEAYYASR 292

Query: 304 NG 305
             
Sbjct: 293 EA 294


>gi|160896735|ref|YP_001562317.1| glycyl-tRNA synthetase subunit alpha [Delftia acidovorans SPH-1]
 gi|238687202|sp|A9BXZ7|SYGA_DELAS RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|160362319|gb|ABX33932.1| glycyl-tRNA synthetase, alpha subunit [Delftia acidovorans SPH-1]
          Length = 312

 Score =  552 bits (1423), Expect = e-155,   Method: Composition-based stats.
 Identities = 170/295 (57%), Positives = 214/295 (72%), Gaps = 14/295 (4%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ IIL L  YWA QGC +LQPYDMEVGAGT H +T LRALGP  WKAAYVQPSRRP
Sbjct: 1   MLTFQQIILKLQSYWADQGCALLQPYDMEVGAGTSHTATFLRALGPEPWKAAYVQPSRRP 60

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY +NPNRLQHYYQFQV++KP P N+  LY+ SL+A+G D   +D+RFVED+WE+PT
Sbjct: 61  KDGRYGDNPNRLQHYYQFQVVLKPAPDNILELYLGSLEALGFDLKKNDIRFVEDDWENPT 120

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQQV GI+C P +GEITYGLERLAMY+Q V++VY++ +
Sbjct: 121 LGAWGLGWEVWLNGMEVTQFTYFQQVGGIDCKPATGEITYGLERLAMYLQGVDNVYNLTW 180

Query: 190 NAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRH 249
                  + YGD++ Q+E E S YNFE+++ + L   F   EK+   L+           
Sbjct: 181 T----DGLSYGDVYHQNEVEQSTYNFEHSDADFLFTAFGAYEKQANHLI----------G 226

Query: 250 HLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                PAY+Q +KA+H FNLLDARG IS TER  YI RIR+LA+A  +A++ +  
Sbjct: 227 EQLALPAYEQVLKAAHTFNLLDARGAISVTERAAYIGRIRNLARAVAKAYMDSRA 281


>gi|254784295|ref|YP_003071723.1| glycyl-tRNA synthetase subunit alpha [Teredinibacter turnerae
           T7901]
 gi|259511916|sp|C5BKP0|SYGA_TERTT RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|237686945|gb|ACR14209.1| glycyl-tRNA synthetase, alpha subunit [Teredinibacter turnerae
           T7901]
          Length = 316

 Score =  551 bits (1422), Expect = e-155,   Method: Composition-based stats.
 Identities = 182/300 (60%), Positives = 228/300 (76%), Gaps = 11/300 (3%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
            +K +  +FQ +IL L QYWA+QGC +LQP DMEVGAGTFHP+T LRA+GP +W +AYVQ
Sbjct: 1   MSKPDVSTFQGLILALQQYWAEQGCVVLQPLDMEVGAGTFHPATFLRAIGPETWNSAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQV++KP+P N+Q LY+ SLK +G+DP IHD+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVVLKPSPDNIQELYLGSLKHLGVDPGIHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WESPTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYG+ER+AMY+QNVNS+
Sbjct: 121 WESPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECYPVTGEITYGIERIAMYLQNVNSI 180

Query: 185 YDIVFN-AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIP 243
           YD+V+  + +G  V YGD+F Q+E E S YNF +AN + L   F   E E   L+  G+P
Sbjct: 181 YDLVWTISPDGTPVTYGDVFHQNEVEMSHYNFSHANVDFLFQTFDTCEAESSKLIDAGLP 240

Query: 244 NEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTP 303
                      PAY+  +KASH FNLLDAR  IS TERQR+ILR+R+LA+   +A+    
Sbjct: 241 ----------LPAYEMVMKASHAFNLLDARQAISVTERQRFILRVRTLARNVAQAYFDAR 290


>gi|71281893|ref|YP_266787.1| glycyl-tRNA synthetase subunit alpha [Colwellia psychrerythraea
           34H]
 gi|71147633|gb|AAZ28106.1| glycyl-tRNA synthetase, alpha subunit [Colwellia psychrerythraea
           34H]
          Length = 311

 Score =  551 bits (1422), Expect = e-155,   Method: Composition-based stats.
 Identities = 182/302 (60%), Positives = 223/302 (73%), Gaps = 10/302 (3%)

Query: 3   PIHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAY 62
                 N  +FQ +IL L  YW++QGC I+QP DMEVGAGTFHP T LR++GP    +AY
Sbjct: 2   NTMTTYNSNTFQGLILQLQDYWSRQGCAIVQPLDMEVGAGTFHPMTFLRSIGPEPISSAY 61

Query: 63  VQPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVE 122
           VQP RRP DGRY +NPNRLQHYYQFQV++KP+P N+Q LY+ SLK +G+DPL+HD+RFVE
Sbjct: 62  VQPCRRPTDGRYGDNPNRLQHYYQFQVMLKPSPKNIQELYLNSLKELGVDPLVHDIRFVE 121

Query: 123 DNWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVN 182
           DNWESPTLGAWGLGWE W +GMEISQFTYFQQV G+EC+P++GEITYGLERLAMY+QNV+
Sbjct: 122 DNWESPTLGAWGLGWEIWLNGMEISQFTYFQQVGGLECTPVTGEITYGLERLAMYIQNVD 181

Query: 183 SVYDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGI 242
           S+YD+V+       V Y DIF Q+E E S YNFEYA+ + L   F   EK+   L++  +
Sbjct: 182 SIYDLVWTDGPLGTVYYRDIFHQNEVEQSTYNFEYADVDALFKQFDQCEKDSQKLIEANL 241

Query: 243 PNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMT 302
           P           PAY+Q +KASH FNLLDAR  IS TERQRYILR+R+L+KA  EA+   
Sbjct: 242 P----------LPAYEQVMKASHAFNLLDARHAISVTERQRYILRVRTLSKAVAEAYYQK 291

Query: 303 PN 304
             
Sbjct: 292 RE 293


>gi|88860612|ref|ZP_01135249.1| glycyl-tRNA synthetase, alpha subunit [Pseudoalteromonas tunicata
           D2]
 gi|88817207|gb|EAR27025.1| glycyl-tRNA synthetase, alpha subunit [Pseudoalteromonas tunicata
           D2]
          Length = 299

 Score =  551 bits (1421), Expect = e-155,   Method: Composition-based stats.
 Identities = 182/301 (60%), Positives = 221/301 (73%), Gaps = 10/301 (3%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +IL L  YWAQQGC I QP DMEVGAGTFHP T L+++GP    +AYVQ
Sbjct: 1   MQKYDTKTFQGLILALQDYWAQQGCVIAQPLDMEVGAGTFHPLTFLKSIGPEPMSSAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           P RRP DGRY ENPNRLQHYYQFQV++KP+P N+Q LY+ SL A+GID L  +VRFVEDN
Sbjct: 61  PCRRPTDGRYGENPNRLQHYYQFQVVLKPSPDNIQELYLGSLAAMGIDTLTDEVRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WESPTLGAWGLGWE W +GME++QFTYFQQV G+ECSP++GEITYGLERLAMY+Q V+S+
Sbjct: 121 WESPTLGAWGLGWEIWLNGMEVTQFTYFQQVGGLECSPVTGEITYGLERLAMYIQGVDSL 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V+       V YGD+F Q+E E S YNFEYA+   L   F   EKE   L++ G+P 
Sbjct: 181 YDLVWADGPLGKVTYGDVFHQNEVEQSTYNFEYADVTALFAQFDQCEKESQKLIEAGLP- 239

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY+Q +KASH FNLLDAR  IS TERQRYILR+R+L+KAC +++     
Sbjct: 240 ---------LPAYEQVMKASHAFNLLDARHAISVTERQRYILRVRALSKACAQSYYEARE 290

Query: 305 G 305
            
Sbjct: 291 A 291


>gi|300310052|ref|YP_003774144.1| glycyl-tRNA synthetase subunit alpha [Herbaspirillum seropedicae
           SmR1]
 gi|300072837|gb|ADJ62236.1| glycyl-tRNA synthetase alpha chain protein [Herbaspirillum
           seropedicae SmR1]
          Length = 305

 Score =  551 bits (1421), Expect = e-155,   Method: Composition-based stats.
 Identities = 169/299 (56%), Positives = 217/299 (72%), Gaps = 14/299 (4%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ IIL L +YW  QGC +LQPYDMEVGAGT H +T LRA+GP  W+AAYVQPSRRP
Sbjct: 1   MLTFQQIILKLQEYWDAQGCALLQPYDMEVGAGTSHTATFLRAIGPEPWRAAYVQPSRRP 60

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNR+QHYYQ+QV++KP P N+ +LY+ SL+A+G+D   +DVRFVED+WE+PT
Sbjct: 61  KDGRYGENPNRMQHYYQYQVVLKPAPENILDLYLGSLEALGLDLKQNDVRFVEDDWENPT 120

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQQV G++C P+ GEITYG+ERLAMY+Q V +VYD+V+
Sbjct: 121 LGAWGLGWEVWLNGMEVTQFTYFQQVGGLDCKPVLGEITYGIERLAMYLQGVENVYDLVW 180

Query: 190 NAIEGQNV----LYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNE 245
                  V     YGD+F Q+E E S +NFEY+N E L + F + E E   L++      
Sbjct: 181 TEWMENGVKKHLTYGDVFHQNEVEQSTFNFEYSNTEFLFSLFSNYEAEAKRLME------ 234

Query: 246 HHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                    PAY+Q +KA+H FN+LDARG IS TER  YI RIR+L++A  +A+  +  
Sbjct: 235 ----VPLALPAYEQVLKAAHTFNMLDARGAISVTERAAYIGRIRNLSRAVAQAYFESRE 289


>gi|163867856|ref|YP_001609060.1| glycyl-tRNA synthetase subunit alpha [Bartonella tribocorum CIP
           105476]
 gi|161017507|emb|CAK01065.1| glycyl-tRNA synthetase alpha chain [Bartonella tribocorum CIP
           105476]
          Length = 313

 Score =  551 bits (1420), Expect = e-155,   Method: Composition-based stats.
 Identities = 216/299 (72%), Positives = 251/299 (83%), Gaps = 1/299 (0%)

Query: 8   KNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSR 67
               SFQ +ILTL  YWA  GC ILQPYDMEVGAGTFHP+TTLR+LGP  WK AYVQPSR
Sbjct: 8   NPKSSFQGLILTLQNYWAHYGCAILQPYDMEVGAGTFHPATTLRSLGPRPWKVAYVQPSR 67

Query: 68  RPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWES 127
           RP DGRY +NPNRLQHYYQFQV++KP+P NLQ LYI+SL+A+G+D  +HD+RFVED+WES
Sbjct: 68  RPTDGRYGKNPNRLQHYYQFQVLLKPSPPNLQELYIKSLQAIGLDTKLHDIRFVEDDWES 127

Query: 128 PTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDI 187
           PTLGAWGLGWECWCDGMEISQFTYFQQVCGIEC+P+SGE+TYGLERLAMY+Q V++VYD+
Sbjct: 128 PTLGAWGLGWECWCDGMEISQFTYFQQVCGIECAPVSGELTYGLERLAMYIQGVDNVYDL 187

Query: 188 VFNAIEGQ-NVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEH 246
            FN +E +  + Y DIF Q+EQEYS YNFE+A+ ++LH HFID+E EC  LL  G PN+ 
Sbjct: 188 NFNGLEEENKISYRDIFLQAEQEYSYYNFEFADTKLLHQHFIDAECECNALLDVGKPNKE 247

Query: 247 HRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNG 305
           +  H CVFPAYDQCIKASHIFNLL ARGVIS TERQ YILR+R LA+ CGEAFL+T  G
Sbjct: 248 NALHRCVFPAYDQCIKASHIFNLLQARGVISVTERQNYILRVRDLARRCGEAFLLTEAG 306


>gi|85714239|ref|ZP_01045227.1| glycyl-tRNA synthetase alpha subunit [Nitrobacter sp. Nb-311A]
 gi|85698686|gb|EAQ36555.1| glycyl-tRNA synthetase alpha subunit [Nitrobacter sp. Nb-311A]
          Length = 308

 Score =  551 bits (1420), Expect = e-155,   Method: Composition-based stats.
 Identities = 204/300 (68%), Positives = 243/300 (81%), Gaps = 6/300 (2%)

Query: 12  SFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPLD 71
           SFQ ++LTL +YWA  GC ILQPYDMEVGAGTFHP+TTLRALGP  W AAYVQPSRRP D
Sbjct: 6   SFQGLLLTLQRYWADCGCVILQPYDMEVGAGTFHPATTLRALGPKRWNAAYVQPSRRPKD 65

Query: 72  GRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTLG 131
           GRY ENPNRLQHYYQFQVI+KP+P ++Q+LY++SL A+G+D  +HD+RFVED+WESPTLG
Sbjct: 66  GRYGENPNRLQHYYQFQVILKPSPSDIQDLYLKSLAAIGVDSALHDIRFVEDDWESPTLG 125

Query: 132 AWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFNA 191
           AWGLGWECWCDGME+SQFTYFQQV G+EC+P++GE+TYGLERLAMYVQ V+ VYD+ FN 
Sbjct: 126 AWGLGWECWCDGMEVSQFTYFQQVAGVECAPVAGELTYGLERLAMYVQGVDRVYDLNFNG 185

Query: 192 IEG-QNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRH- 249
            EG + V YGD+F Q+EQEYSR+NFE+++  +L   F  +E  C   L  G  ++  +  
Sbjct: 186 REGAEKVTYGDVFLQAEQEYSRHNFEHSDTAMLFEQFRMAENACKTYLDAGWQDDPKQPG 245

Query: 250 ----HLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNG 305
               HL   PAYDQCIKASH+FNLLDARGVIS TERQ YILR+R LAKACGEA+L T  G
Sbjct: 246 KHDAHLMALPAYDQCIKASHVFNLLDARGVISVTERQSYILRVRELAKACGEAWLHTDAG 305


>gi|302879306|ref|YP_003847870.1| glycyl-tRNA synthetase, alpha subunit [Gallionella
           capsiferriformans ES-2]
 gi|302582095|gb|ADL56106.1| glycyl-tRNA synthetase, alpha subunit [Gallionella
           capsiferriformans ES-2]
          Length = 315

 Score =  551 bits (1420), Expect = e-155,   Method: Composition-based stats.
 Identities = 174/295 (58%), Positives = 219/295 (74%), Gaps = 14/295 (4%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ IILTL  YW +QGC +LQPYDMEVGAGT H +T LRALGP  W+AAYVQPSRRP
Sbjct: 1   MLTFQQIILTLQNYWDKQGCALLQPYDMEVGAGTSHTATFLRALGPEPWRAAYVQPSRRP 60

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNRLQHYYQFQ+++KP P N+  LY+ SL+A+G D   +D+RFVED+WE+PT
Sbjct: 61  KDGRYGENPNRLQHYYQFQIVLKPAPANILELYLGSLEALGFDLKQNDIRFVEDDWENPT 120

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQQV GI+C PI+GEITYGLERLAMY+Q V SVYD+++
Sbjct: 121 LGAWGLGWEVWLNGMEVTQFTYFQQVGGIDCRPITGEITYGLERLAMYLQGVESVYDLIW 180

Query: 190 NAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRH 249
                + V YGD++ Q+E E S+YNFE+++ E L   F   EK+   L++  +       
Sbjct: 181 T----EGVTYGDVYHQNEVEQSKYNFEHSDVEFLLGAFASHEKQAKHLMENALS------ 230

Query: 250 HLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                PAY+Q +KA+H FNLLDARG IS TER  YI RIR+LA++   A+L +  
Sbjct: 231 ----LPAYEQVLKAAHSFNLLDARGAISVTERAAYIGRIRNLARSVAAAYLESRA 281


>gi|85860060|ref|YP_462262.1| glycyl-tRNA synthetase subunit alpha [Syntrophus aciditrophicus SB]
 gi|123517124|sp|Q2LVI0|SYGA_SYNAS RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|85723151|gb|ABC78094.1| glycyl-tRNA synthetase alpha chain [Syntrophus aciditrophicus SB]
          Length = 292

 Score =  551 bits (1420), Expect = e-155,   Method: Composition-based stats.
 Identities = 168/294 (57%), Positives = 215/294 (73%), Gaps = 14/294 (4%)

Query: 11  LSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPL 70
           ++FQ +I  L  YWA+QGC I QPYD+EVGAGTF+P+T LRALGP  W  AYV+PSRRP 
Sbjct: 1   MTFQELIFALENYWAKQGCVIQQPYDIEVGAGTFNPATFLRALGPEPWNVAYVEPSRRPT 60

Query: 71  DGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTL 130
           DGRY ENPNRLQHYYQ+QVI+KP+PLN+Q LY++SL++ GIDPL HD+RFVED+WESPT+
Sbjct: 61  DGRYGENPNRLQHYYQYQVIMKPSPLNIQELYLDSLRSFGIDPLEHDIRFVEDDWESPTV 120

Query: 131 GAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFN 190
           GAWGLGWE W DGMEISQFTYFQQV GI+  P+  E+TYG+ER+AMY+Q +++VYD+ +N
Sbjct: 121 GAWGLGWEVWLDGMEISQFTYFQQVGGIDVKPVCAELTYGIERIAMYIQGIDNVYDLQWN 180

Query: 191 AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHH 250
                ++ YGD+  Q E E+S YNFE A+ ++L   F   E E +   +K +        
Sbjct: 181 ----DSIKYGDVHHQGEVEFSTYNFEVADVDMLRKLFDMYEAEAIRTAEKDL-------- 228

Query: 251 LCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
             V PAYD C+K SH FNLL+ARG IS  ER  YI R+R+LA+   E ++    
Sbjct: 229 --VLPAYDYCLKCSHTFNLLNARGAISVAERTSYIGRVRNLARISAEGYIRQRE 280


>gi|301384280|ref|ZP_07232698.1| glycyl-tRNA synthetase subunit alpha [Pseudomonas syringae pv.
           tomato Max13]
          Length = 315

 Score =  551 bits (1420), Expect = e-155,   Method: Composition-based stats.
 Identities = 186/293 (63%), Positives = 222/293 (75%), Gaps = 10/293 (3%)

Query: 12  SFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPLD 71
           +FQ++IL L QYWA+QGC +LQPYDMEVGAGTFH +T LRA+GP +W AAYVQPSRRP D
Sbjct: 10  TFQDLILALQQYWAEQGCVVLQPYDMEVGAGTFHTATFLRAVGPETWNAAYVQPSRRPTD 69

Query: 72  GRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTLG 131
           GRY ENPNRLQHYYQFQVI+KPNP N Q LY+ SLK +G+DPL+HDVRFVEDNWESPTLG
Sbjct: 70  GRYGENPNRLQHYYQFQVILKPNPDNFQELYLGSLKHIGLDPLVHDVRFVEDNWESPTLG 129

Query: 132 AWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFNA 191
           AWGLGWE W +GME+SQFTYFQQV GIEC P++GEITYGLERLAMY Q V+SVYD+V+  
Sbjct: 130 AWGLGWEIWLNGMEVSQFTYFQQVGGIECYPVTGEITYGLERLAMYQQGVDSVYDLVWAD 189

Query: 192 IEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHHL 251
                V YGD+F Q+E E S YNFE+AN + L   F   E E   L ++ +P        
Sbjct: 190 GPFGKVTYGDVFHQNEVEQSTYNFEHANVDKLFELFDFYESEAARLSERELP-------- 241

Query: 252 CVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
              P Y+  +KASH FNLLDAR  IS T RQ+YILR+R+LA++  +A+L    
Sbjct: 242 --LPGYEMVLKASHTFNLLDARRAISVTARQQYILRVRTLARSVAQAYLQARA 292


>gi|262190465|ref|ZP_06048717.1| glycyl-tRNA synthetase alpha chain [Vibrio cholerae CT 5369-93]
 gi|262033662|gb|EEY52150.1| glycyl-tRNA synthetase alpha chain [Vibrio cholerae CT 5369-93]
          Length = 305

 Score =  551 bits (1420), Expect = e-155,   Method: Composition-based stats.
 Identities = 183/301 (60%), Positives = 220/301 (73%), Gaps = 8/301 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +IL L  YWAQQGCTI+QP DMEVGAGT HP T LRALGP    AAYVQ
Sbjct: 1   MQKYDIKTFQGMILALQDYWAQQGCTIVQPLDMEVGAGTSHPMTCLRALGPEPIAAAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQVIIKP+P N+Q LY+ SL+ +G+DP +HD+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVIIKPSPDNIQELYLGSLRVLGVDPCVHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYG+ERLAMY+Q V+SV
Sbjct: 121 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGIERLAMYIQGVDSV 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V+       V YGDIF Q+E E S YNFE+A+ + L  +F   EKEC          
Sbjct: 181 YDLVWTDGPLGKVTYGDIFHQNEVEQSTYNFEHADVDFLFTYFDQCEKECK--------Y 232

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY++ +KA+H FNLLDAR  IS TERQRYILRIR+L K+  EA+  +  
Sbjct: 233 LLELEKPLPLPAYERILKAAHAFNLLDARKAISVTERQRYILRIRNLTKSVAEAYYASRE 292

Query: 305 G 305
            
Sbjct: 293 A 293


>gi|329913695|ref|ZP_08275987.1| Glycyl-tRNA synthetase alpha chain [Oxalobacteraceae bacterium
           IMCC9480]
 gi|327545290|gb|EGF30538.1| Glycyl-tRNA synthetase alpha chain [Oxalobacteraceae bacterium
           IMCC9480]
          Length = 306

 Score =  550 bits (1419), Expect = e-155,   Method: Composition-based stats.
 Identities = 169/299 (56%), Positives = 216/299 (72%), Gaps = 14/299 (4%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ +IL L +YWA QGC +LQPYDMEVGAGT H +T LRA+GP  W+AAYVQPSRRP
Sbjct: 1   MLTFQQVILKLQEYWAAQGCALLQPYDMEVGAGTSHTATFLRAIGPEPWRAAYVQPSRRP 60

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNR+QHYYQ+QV++KP P N+ +LY+ SL+A+G+D   +DVRFVED+WE+PT
Sbjct: 61  KDGRYGENPNRMQHYYQYQVVLKPAPENILDLYLGSLEALGLDLKKNDVRFVEDDWENPT 120

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQQV G++C P+ GEITYG+ERLAMY+Q V +VYD+V+
Sbjct: 121 LGAWGLGWEVWLNGMEVTQFTYFQQVGGLDCKPVLGEITYGIERLAMYLQGVENVYDLVW 180

Query: 190 NAIEGQNV----LYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNE 245
                  V     YGD+F Q+E E S YNFEYAN + L + F + E E   L++      
Sbjct: 181 TEATTNGVTRKLTYGDVFHQNEVEQSTYNFEYANTDFLFSQFTNFEAEAKRLME------ 234

Query: 246 HHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                    PAY+  +KA+H FN+LDARG IS TER  YI RIR+L++    A+L +  
Sbjct: 235 ----IPLTLPAYEMILKAAHSFNMLDARGAISVTERAAYIGRIRTLSRGVAHAYLASRE 289


>gi|296532280|ref|ZP_06895020.1| glycyl-tRNA synthetase alpha subunit [Roseomonas cervicalis ATCC
           49957]
 gi|296267396|gb|EFH13281.1| glycyl-tRNA synthetase alpha subunit [Roseomonas cervicalis ATCC
           49957]
          Length = 311

 Score =  550 bits (1419), Expect = e-155,   Method: Composition-based stats.
 Identities = 194/304 (63%), Positives = 231/304 (75%), Gaps = 16/304 (5%)

Query: 3   PIHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAY 62
           P       LSFQ+IILTL ++W+ QGC ILQPYDME+GAGTFHP+TTLRALGP  WKAAY
Sbjct: 24  PPQKPGKPLSFQDIILTLHRFWSAQGCVILQPYDMEMGAGTFHPATTLRALGPKDWKAAY 83

Query: 63  VQPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVE 122
           VQPSRRP DGRY ENPNRLQHYYQ+QVI+KP+P + Q L IES KA+GIDP +HD+RFVE
Sbjct: 84  VQPSRRPADGRYGENPNRLQHYYQYQVILKPSPADPQALLIESYKALGIDPTLHDIRFVE 143

Query: 123 DNWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVN 182
           D+WESPTLGAWGLGWE WCDGME++QFTYFQQV GI       E+TYGLERLAMY+Q V 
Sbjct: 144 DDWESPTLGAWGLGWEVWCDGMEVTQFTYFQQVGGIPVEKPCAELTYGLERLAMYIQGVE 203

Query: 183 SVYDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGI 242
           +VYD+ FN   GQ V YG++F ++E+E+S +NFE+A+  +L  HF D+E EC  L++K +
Sbjct: 204 NVYDLDFN---GQGVTYGEVFLRAEKEFSAFNFEHADTALLFQHFKDAEGECAALVEKNL 260

Query: 243 PNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMT 302
                       PAYDQCIKASH FNLLDARG IS TER  YI R+R+LAK C E +L  
Sbjct: 261 ----------ALPAYDQCIKASHAFNLLDARGAISVTERAAYIGRVRALAKRCCETWL-- 308

Query: 303 PNGG 306
             GG
Sbjct: 309 -AGG 311


>gi|119503579|ref|ZP_01625662.1| glycyl-tRNA synthetase subunit alpha [marine gamma proteobacterium
           HTCC2080]
 gi|119460641|gb|EAW41733.1| glycyl-tRNA synthetase subunit alpha [marine gamma proteobacterium
           HTCC2080]
          Length = 307

 Score =  550 bits (1419), Expect = e-155,   Method: Composition-based stats.
 Identities = 179/294 (60%), Positives = 219/294 (74%), Gaps = 10/294 (3%)

Query: 12  SFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPLD 71
           +FQ +IL L  +W   GC +LQP DMEVGAGTFHP+T LRA+GP +W AAYVQPSRRP D
Sbjct: 5   TFQELILRLQTFWGSHGCVVLQPLDMEVGAGTFHPATFLRAIGPENWNAAYVQPSRRPAD 64

Query: 72  GRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTLG 131
           GRY ENPNRLQHYYQFQV++KP+P N Q+LY+ESL+ +G+D L HDVRFVEDNWESPTLG
Sbjct: 65  GRYGENPNRLQHYYQFQVVMKPSPSNFQDLYLESLRELGLDTLQHDVRFVEDNWESPTLG 124

Query: 132 AWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFNA 191
           AWGLGWE W +GME+SQFTYFQQ  G+EC P++GEITYGLER+AMY+Q+V+SVYD+V+  
Sbjct: 125 AWGLGWEVWLNGMEVSQFTYFQQAGGLECFPVTGEITYGLERIAMYLQDVDSVYDLVWAK 184

Query: 192 IEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHHL 251
                V YGD+F Q+E E S YNF+ A+ E L   F   E E   L++  +P        
Sbjct: 185 TPAGPVTYGDVFHQNEVEMSTYNFQEADTEALFRAFDFCEHEATRLVECKLP-------- 236

Query: 252 CVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNG 305
              PAY+Q +KASH FNLLDAR  I  TERQRYILR+RSLAKA  +++  +   
Sbjct: 237 --LPAYEQVMKASHAFNLLDARHAIGVTERQRYILRVRSLAKAAAQSYFDSRAA 288


>gi|90019662|ref|YP_525489.1| glycyl-tRNA synthetase subunit alpha [Saccharophagus degradans
           2-40]
 gi|123396839|sp|Q21PU3|SYGA_SACD2 RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|89949262|gb|ABD79277.1| Glycyl-tRNA synthetase, alpha subunit [Saccharophagus degradans
           2-40]
          Length = 318

 Score =  550 bits (1419), Expect = e-155,   Method: Composition-based stats.
 Identities = 178/300 (59%), Positives = 221/300 (73%), Gaps = 11/300 (3%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
            +K +  +FQ +IL L +YWA+QGC +LQP DMEVGAGTFHP+T LRA+GP +W  AYVQ
Sbjct: 1   MSKPDVSTFQGLILALQEYWAKQGCVVLQPLDMEVGAGTFHPATFLRAIGPETWNTAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           P RRP DGRY ENPNRLQHYYQFQV +KP+P N+Q LY+ SL  +G+D  IHD+RFVEDN
Sbjct: 61  PCRRPTDGRYGENPNRLQHYYQFQVALKPSPDNIQELYLGSLAHLGLDTNIHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WESPTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLER+AMY+Q+VNS+
Sbjct: 121 WESPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECYPVTGEITYGLERIAMYLQDVNSI 180

Query: 185 YDIVFNAIEGQN-VLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIP 243
           YD+V+        V YGD+F Q+E E S +NF  AN E L   F   E E   L++KG+P
Sbjct: 181 YDLVWTKRPDGGIVTYGDVFHQNEVEMSHFNFSEANVEFLFQTFDVCEAESRRLIEKGLP 240

Query: 244 NEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTP 303
                      PAY+  +KASH FNLLDAR  IS TERQR+ILR+R+LA+   +A+    
Sbjct: 241 ----------LPAYEMVMKASHAFNLLDARQAISVTERQRFILRVRTLARDVAQAYFDAR 290


>gi|260914507|ref|ZP_05920976.1| glycyl-tRNA synthetase [Pasteurella dagmatis ATCC 43325]
 gi|260631608|gb|EEX49790.1| glycyl-tRNA synthetase [Pasteurella dagmatis ATCC 43325]
          Length = 300

 Score =  550 bits (1419), Expect = e-155,   Method: Composition-based stats.
 Identities = 182/297 (61%), Positives = 218/297 (73%), Gaps = 8/297 (2%)

Query: 9   NDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRR 68
           N  +FQ +IL L  YWA+QG TI+QP+DMEVGAGT HP T LRALGP     AYVQPSRR
Sbjct: 5   NVKTFQGMILALQDYWAKQGATIVQPFDMEVGAGTSHPMTALRALGPEPMAFAYVQPSRR 64

Query: 69  PLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESP 128
           P DGRY ENPNRLQHYYQFQV+IKP+P N+Q LY++SLK +G DP  +D+RFVEDNWE+P
Sbjct: 65  PTDGRYGENPNRLQHYYQFQVVIKPSPDNIQELYLDSLKMLGFDPTQNDIRFVEDNWENP 124

Query: 129 TLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIV 188
           TLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLERLAMY+Q V+SVYD+V
Sbjct: 125 TLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGLERLAMYIQGVDSVYDLV 184

Query: 189 FNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHR 248
           ++        YGD+F Q+E E S YNFEYAN + L   F   EKE  +LL    P     
Sbjct: 185 WSDGPLGKTTYGDVFHQNEVEQSTYNFEYANTDFLFYCFDQYEKEASELLALEKP----- 239

Query: 249 HHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNG 305
                 PAY++ +KA+H FNLLDAR  IS TERQRYILRIR+L K   EA+  +   
Sbjct: 240 ---LPLPAYERILKAAHSFNLLDARKAISVTERQRYILRIRALTKGVAEAYYASREA 293


>gi|291286255|ref|YP_003503071.1| glycyl-tRNA synthetase, alpha subunit [Denitrovibrio acetiphilus
           DSM 12809]
 gi|290883415|gb|ADD67115.1| glycyl-tRNA synthetase, alpha subunit [Denitrovibrio acetiphilus
           DSM 12809]
          Length = 290

 Score =  550 bits (1418), Expect = e-155,   Method: Composition-based stats.
 Identities = 177/294 (60%), Positives = 222/294 (75%), Gaps = 13/294 (4%)

Query: 11  LSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPL 70
           + FQ++IL L Q+WA++GC I QPYD+EVGAGTF+P+T LR LGP  W  AYV+PSRRP 
Sbjct: 1   MHFQDVILKLHQFWAERGCVIYQPYDIEVGAGTFNPATFLRCLGPEPWNVAYVEPSRRPT 60

Query: 71  DGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTL 130
           DGRY ENPNRLQ++ Q+QVI+KP+P N+Q LY+ESLK +G+DP  HD+RFVED+WESPTL
Sbjct: 61  DGRYGENPNRLQNFNQYQVILKPSPDNIQELYLESLKTLGVDPKDHDIRFVEDDWESPTL 120

Query: 131 GAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFN 190
           GAWGLGWE W DGMEI+QFTYFQQ  GI+  P+SGEITYGLER+AM++Q V SVYD+ +N
Sbjct: 121 GAWGLGWEVWLDGMEITQFTYFQQAGGIDLKPVSGEITYGLERIAMFLQGVESVYDLTYN 180

Query: 191 AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHH 250
           A     + YGDIF ++E ++S YNFEYA+ E+L   F   EKEC+ + +KG+P       
Sbjct: 181 AT---GITYGDIFHENEVQHSGYNFEYADTEMLFKLFEMYEKECISINEKGLP------- 230

Query: 251 LCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
               PAYD C+K SH FNLLDAR  IS TER  YI+R+R+LAK C E +L    
Sbjct: 231 ---LPAYDYCLKCSHSFNLLDARNAISVTERTGYIVRVRNLAKMCAENYLKHRE 281


>gi|165922513|ref|ZP_02219684.1| glycyl-tRNA synthetase, alpha subunit [Coxiella burnetii RSA 334]
 gi|165916718|gb|EDR35322.1| glycyl-tRNA synthetase, alpha subunit [Coxiella burnetii RSA 334]
          Length = 319

 Score =  550 bits (1418), Expect = e-155,   Method: Composition-based stats.
 Identities = 177/300 (59%), Positives = 224/300 (74%), Gaps = 10/300 (3%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
               + ++FQ +IL L +YWA QGC +LQP+DMEVGAGTFHP+T LRA+GP  W+AAYVQ
Sbjct: 1   MKSSHPVNFQQMILALQEYWASQGCVLLQPFDMEVGAGTFHPATFLRAIGPEPWRAAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY +NPNR QHYYQFQV++KP+P ++Q++Y+ SLKA+GIDPL HD+RFVEDN
Sbjct: 61  PSRRPTDGRYGDNPNRTQHYYQFQVVLKPSPDDIQDIYLGSLKALGIDPLTHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLG+WG+GWE W DGMEI+QFTYFQQ+ G+EC P++GEITYGLERLAM++Q ++++
Sbjct: 121 WEAPTLGSWGVGWEVWQDGMEITQFTYFQQIGGLECKPVTGEITYGLERLAMFLQGIDNM 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           +D+V+       V YG IF Q+E E S YNFEYAN E L N F   EKE   L+   +P 
Sbjct: 181 FDLVWTEGPNGRVTYGQIFQQNEVEMSAYNFEYANVEALFNFFDFYEKEASQLIGVHLP- 239

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                      AY+  +KASH FNLLDAR  IS TERQR+ILR+R LA+A  EA+     
Sbjct: 240 ---------LAAYEMVLKASHTFNLLDARQAISVTERQRFILRVRKLAQAVAEAYYSARE 290


>gi|312797214|ref|YP_004030136.1| glycyl-tRNA synthetase alpha chain [Burkholderia rhizoxinica HKI
           454]
 gi|312168989|emb|CBW75992.1| Glycyl-tRNA synthetase alpha chain (EC 6.1.1.14) [Burkholderia
           rhizoxinica HKI 454]
          Length = 403

 Score =  550 bits (1418), Expect = e-154,   Method: Composition-based stats.
 Identities = 167/309 (54%), Positives = 219/309 (70%), Gaps = 18/309 (5%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             +   L+FQ IILTL  YW +QGC +LQPYDMEVGAGT H +T LRA+GP  W+AAYVQ
Sbjct: 62  PERHFMLTFQQIILTLQSYWDKQGCALLQPYDMEVGAGTSHTATFLRAIGPEPWRAAYVQ 121

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNR+QHYYQ+QV++KP P N+ +LY+ SL+A+G+D   +DVRFVED+
Sbjct: 122 PSRRPKDGRYGENPNRMQHYYQYQVVLKPAPENILDLYLGSLQALGLDLKQNDVRFVEDD 181

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G++C P+ GEITYG+ERLAMY+Q V +V
Sbjct: 182 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLDCKPVLGEITYGIERLAMYLQQVENV 241

Query: 185 YDIVFNAIEGQN--------VLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLD 236
           +D+V+   E           + YGD+F Q+E E S YNFE++N E+L   F   E E   
Sbjct: 242 FDLVWTEWEEDGPDGKVLRRLTYGDVFHQNEVEQSTYNFEHSNAELLFTFFNAYESEARR 301

Query: 237 LLKKGIPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACG 296
           ++++ +            PAY+  +KA+H FNLLDARG IS TER  YI RIR+L++   
Sbjct: 302 IIEQRL----------ALPAYELILKAAHTFNLLDARGAISVTERAAYIGRIRALSRLVA 351

Query: 297 EAFLMTPNG 305
           +A+  +   
Sbjct: 352 QAYYDSREA 360


>gi|312882228|ref|ZP_07741974.1| glycyl-tRNA synthetase subunit alpha [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309370072|gb|EFP97578.1| glycyl-tRNA synthetase subunit alpha [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 305

 Score =  550 bits (1418), Expect = e-154,   Method: Composition-based stats.
 Identities = 186/302 (61%), Positives = 224/302 (74%), Gaps = 9/302 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +IL L  YWAQ GC+I+QP DMEVGAGT HP T LRALGP     AYVQ
Sbjct: 1   MQKYDIKTFQEMILALQDYWAQNGCSIVQPLDMEVGAGTSHPMTCLRALGPEPMSTAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQV +KP+P N+Q LY+ SL+ +G+DPL+HD+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVALKPSPDNIQELYLGSLEVLGVDPLVHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GMEISQFTYFQQV G+EC P++GEITYG+ERLAMY+Q V+S+
Sbjct: 121 WENPTLGAWGLGWEVWLNGMEISQFTYFQQVGGLECKPVTGEITYGIERLAMYIQEVDSI 180

Query: 185 YDIVFN-AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIP 243
           YD+V+N A +G  V YGDIF Q+E E S YNFE+A+ + L   F   EKEC +LL    P
Sbjct: 181 YDLVWNIAPDGSQVTYGDIFHQNEVEQSTYNFEHADVDFLFGLFEQCEKECQELLALDKP 240

Query: 244 NEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTP 303
                      PAY++ +KA H FNLLDAR  IS TERQRYILRIR+L K+  EA+  + 
Sbjct: 241 --------LPLPAYERILKAGHAFNLLDARKAISVTERQRYILRIRNLTKSVAEAYYASR 292

Query: 304 NG 305
             
Sbjct: 293 EA 294


>gi|21233509|ref|NP_639426.1| glycyl-tRNA synthetase subunit alpha [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66770474|ref|YP_245236.1| glycyl-tRNA synthetase subunit alpha [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|188993685|ref|YP_001905695.1| glycyl-tRNA synthetase subunit alpha [Xanthomonas campestris pv.
           campestris str. B100]
 gi|25009296|sp|Q8P3I4|SYGA_XANCP RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|81303579|sp|Q4UP07|SYGA_XANC8 RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|229470690|sp|B0RYX4|SYGA_XANCB RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|21115362|gb|AAM43308.1| glycyl-tRNA synthetase alpha chain [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66575806|gb|AAY51216.1| glycyl-tRNA synthetase alpha chain [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|167735445|emb|CAP53660.1| glycyl-tRNA synthetase alpha chain [Xanthomonas campestris pv.
           campestris]
          Length = 302

 Score =  550 bits (1418), Expect = e-154,   Method: Composition-based stats.
 Identities = 182/300 (60%), Positives = 227/300 (75%), Gaps = 11/300 (3%)

Query: 6   NKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQP 65
           +++  ++FQ +I TL QYWA+QGC ++QP D+EVGAGTFHP+T LRALGP  W AAYVQP
Sbjct: 4   SRRVPITFQGLIQTLNQYWAEQGCVLIQPLDLEVGAGTFHPATFLRALGPEPWNAAYVQP 63

Query: 66  SRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNW 125
           SRRP DGRY ENPNRLQ YYQ+QV +KPNP N+Q+LY+ SLKA+GIDPL+HD+RFVEDNW
Sbjct: 64  SRRPTDGRYGENPNRLQRYYQYQVAMKPNPDNIQDLYLGSLKALGIDPLVHDLRFVEDNW 123

Query: 126 ESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVY 185
           ESPTLGAWGLGWE W +GME++QFTYFQQ  G+EC P+ GEITYGLERL MY+Q+ ++VY
Sbjct: 124 ESPTLGAWGLGWEVWLNGMEVTQFTYFQQAGGLECKPVLGEITYGLERLCMYLQSCDNVY 183

Query: 186 DIVFN-AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           D+V+    +G  V YGD++ Q+E E S YNFE+AN E L + F   E E   L++ G+P 
Sbjct: 184 DLVWTYGPDGTPVTYGDVYHQNEVEQSAYNFEHANVEELFHRFDACEAEAKHLVEVGLP- 242

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY+Q  KASH FNLLDAR  IS TERQRYILR+R+LA+   +A+     
Sbjct: 243 ---------LPAYEQVTKASHAFNLLDARRAISVTERQRYILRVRALAQGVAQAYYAQRE 293


>gi|229508306|ref|ZP_04397810.1| glycyl-tRNA synthetase alpha chain [Vibrio cholerae BX 330286]
 gi|229508855|ref|ZP_04398346.1| glycyl-tRNA synthetase alpha chain [Vibrio cholerae B33]
 gi|229515940|ref|ZP_04405397.1| glycyl-tRNA synthetase alpha chain [Vibrio cholerae TMA 21]
 gi|229517126|ref|ZP_04406572.1| glycyl-tRNA synthetase alpha chain [Vibrio cholerae RC9]
 gi|229520193|ref|ZP_04409620.1| glycyl-tRNA synthetase alpha chain [Vibrio cholerae TM 11079-80]
 gi|229524923|ref|ZP_04414328.1| glycyl-tRNA synthetase alpha chain [Vibrio cholerae bv. albensis
           VL426]
 gi|229530193|ref|ZP_04419582.1| glycyl-tRNA synthetase alpha chain [Vibrio cholerae 12129(1)]
 gi|229606580|ref|YP_002877228.1| glycyl-tRNA synthetase subunit alpha [Vibrio cholerae MJ-1236]
 gi|255746797|ref|ZP_05420743.1| glycyl-tRNA synthetase alpha chain [Vibrio cholera CIRS 101]
 gi|261213254|ref|ZP_05927536.1| glycyl-tRNA synthetase alpha chain [Vibrio sp. RC341]
 gi|262155877|ref|ZP_06028999.1| glycyl-tRNA synthetase alpha chain [Vibrio cholerae INDRE 91/1]
 gi|262167109|ref|ZP_06034824.1| glycyl-tRNA synthetase alpha chain [Vibrio cholerae RC27]
 gi|262172787|ref|ZP_06040465.1| glycyl-tRNA synthetase alpha chain [Vibrio mimicus MB-451]
 gi|262402072|ref|ZP_06078636.1| glycyl-tRNA synthetase alpha chain [Vibrio sp. RC586]
 gi|11387202|sp|Q9KVW7|SYGA_VIBCH RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|229332326|gb|EEN97813.1| glycyl-tRNA synthetase alpha chain [Vibrio cholerae 12129(1)]
 gi|229338504|gb|EEO03521.1| glycyl-tRNA synthetase alpha chain [Vibrio cholerae bv. albensis
           VL426]
 gi|229342787|gb|EEO07778.1| glycyl-tRNA synthetase alpha chain [Vibrio cholerae TM 11079-80]
 gi|229346189|gb|EEO11161.1| glycyl-tRNA synthetase alpha chain [Vibrio cholerae RC9]
 gi|229347040|gb|EEO12002.1| glycyl-tRNA synthetase alpha chain [Vibrio cholerae TMA 21]
 gi|229354130|gb|EEO19062.1| glycyl-tRNA synthetase alpha chain [Vibrio cholerae B33]
 gi|229354579|gb|EEO19501.1| glycyl-tRNA synthetase alpha chain [Vibrio cholerae BX 330286]
 gi|229369235|gb|ACQ59658.1| glycyl-tRNA synthetase alpha chain [Vibrio cholerae MJ-1236]
 gi|255735554|gb|EET90953.1| glycyl-tRNA synthetase alpha chain [Vibrio cholera CIRS 101]
 gi|260837528|gb|EEX64231.1| glycyl-tRNA synthetase alpha chain [Vibrio sp. RC341]
 gi|261893863|gb|EEY39849.1| glycyl-tRNA synthetase alpha chain [Vibrio mimicus MB-451]
 gi|262024495|gb|EEY43181.1| glycyl-tRNA synthetase alpha chain [Vibrio cholerae RC27]
 gi|262030329|gb|EEY48971.1| glycyl-tRNA synthetase alpha chain [Vibrio cholerae INDRE 91/1]
 gi|262351718|gb|EEZ00850.1| glycyl-tRNA synthetase alpha chain [Vibrio sp. RC586]
 gi|327482933|gb|AEA77340.1| Glycyl-tRNA synthetase alpha chain [Vibrio cholerae LMA3894-4]
          Length = 305

 Score =  550 bits (1418), Expect = e-154,   Method: Composition-based stats.
 Identities = 182/301 (60%), Positives = 219/301 (72%), Gaps = 8/301 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +IL L  YWAQQGCTI+QP DMEVGAGT HP T LRALGP     AYVQ
Sbjct: 1   MQKYDIKTFQGMILALQDYWAQQGCTIVQPLDMEVGAGTSHPMTCLRALGPEPIATAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQVIIKP+P N+Q LY+ SL+ +G+DP +HD+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVIIKPSPDNIQELYLGSLRVLGVDPCVHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYG+ERLAMY+Q V+SV
Sbjct: 121 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGIERLAMYIQGVDSV 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V+       V YGDIF Q+E E S YNFE+A+ + L  +F   EKEC          
Sbjct: 181 YDLVWTDGPLGKVTYGDIFHQNEVEQSTYNFEHADVDFLFTYFDQCEKECK--------Y 232

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY++ +KA+H FNLLDAR  IS TERQRYILRIR+L K+  EA+  +  
Sbjct: 233 LLELEKPLPLPAYERILKAAHAFNLLDARKAISVTERQRYILRIRNLTKSVAEAYYASRE 292

Query: 305 G 305
            
Sbjct: 293 A 293


>gi|330813967|ref|YP_004358206.1| glycyl-tRNA synthetase alpha chain [Candidatus Pelagibacter sp.
           IMCC9063]
 gi|327487062|gb|AEA81467.1| glycyl-tRNA synthetase alpha chain [Candidatus Pelagibacter sp.
           IMCC9063]
          Length = 314

 Score =  550 bits (1418), Expect = e-154,   Method: Composition-based stats.
 Identities = 183/299 (61%), Positives = 226/299 (75%), Gaps = 13/299 (4%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             + N LSFQ II  L ++W+ QGC ILQPYD EVGAGTFHP+TTLR+LGP  WKAAYVQ
Sbjct: 27  KKQPNFLSFQEIIFKLQKFWSDQGCVILQPYDTEVGAGTFHPATTLRSLGPEPWKAAYVQ 86

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQV+IKP+P ++Q LY++SL A+GI+   HD+RFVED+
Sbjct: 87  PSRRPTDGRYGENPNRLQHYYQFQVVIKPSPEDVQKLYLKSLAAIGINHKDHDIRFVEDD 146

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WESPTLGA GLGWE WCDG E++QFTYFQQ+ G EC P++ EITYGLERLAM++Q   SV
Sbjct: 147 WESPTLGAAGLGWEVWCDGTEVTQFTYFQQMAGFECKPVTAEITYGLERLAMFIQGKKSV 206

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           +DI +N    + + Y  IF Q+E+E+S YNFE+AN + L   F  +E EC  L++K +  
Sbjct: 207 FDIEWNK---EGIKYEAIFKQAEKEFSAYNFEHANTDNLLKMFGFAEAECNALIEKKL-- 261

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTP 303
                     PAYDQC+KASH FNLLDARGVIS +ER  YI RIR+LAK CG+A++ + 
Sbjct: 262 --------CLPAYDQCLKASHTFNLLDARGVISVSERAGYITRIRNLAKGCGQAWIDSQ 312


>gi|194100113|ref|YP_002003253.1| glycyl-tRNA synthetase subunit alpha [Neisseria gonorrhoeae
           NCCP11945]
 gi|239998101|ref|ZP_04718025.1| glycyl-tRNA synthetase subunit alpha [Neisseria gonorrhoeae 35/02]
 gi|240013282|ref|ZP_04720195.1| glycyl-tRNA synthetase subunit alpha [Neisseria gonorrhoeae DGI18]
 gi|240114819|ref|ZP_04728881.1| glycyl-tRNA synthetase subunit alpha [Neisseria gonorrhoeae PID18]
 gi|240120354|ref|ZP_04733316.1| glycyl-tRNA synthetase subunit alpha [Neisseria gonorrhoeae
           PID24-1]
 gi|240124846|ref|ZP_04737732.1| glycyl-tRNA synthetase subunit alpha [Neisseria gonorrhoeae
           SK-92-679]
 gi|254492883|ref|ZP_05106054.1| glycyl-tRNA synthetase subunit alpha [Neisseria gonorrhoeae 1291]
 gi|268593953|ref|ZP_06128120.1| glycyl-tRNA synthetase subunit alpha [Neisseria gonorrhoeae 35/02]
 gi|268600475|ref|ZP_06134642.1| glycyl-tRNA synthetase subunit alpha [Neisseria gonorrhoeae PID18]
 gi|268683427|ref|ZP_06150289.1| glycyl-tRNA synthetase subunit alpha [Neisseria gonorrhoeae
           SK-92-679]
 gi|238690172|sp|B4RJG2|SYGA_NEIG2 RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|193935403|gb|ACF31227.1| glycyl-tRNA synthetase alpha subunit [Neisseria gonorrhoeae
           NCCP11945]
 gi|226511923|gb|EEH61268.1| glycyl-tRNA synthetase subunit alpha [Neisseria gonorrhoeae 1291]
 gi|268547342|gb|EEZ42760.1| glycyl-tRNA synthetase subunit alpha [Neisseria gonorrhoeae 35/02]
 gi|268584606|gb|EEZ49282.1| glycyl-tRNA synthetase subunit alpha [Neisseria gonorrhoeae PID18]
 gi|268623711|gb|EEZ56111.1| glycyl-tRNA synthetase subunit alpha [Neisseria gonorrhoeae
           SK-92-679]
 gi|317165545|gb|ADV09086.1| glycyl-tRNA synthetase subunit alpha [Neisseria gonorrhoeae
           TCDC-NG08107]
          Length = 298

 Score =  550 bits (1418), Expect = e-154,   Method: Composition-based stats.
 Identities = 170/296 (57%), Positives = 219/296 (73%), Gaps = 8/296 (2%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ II  L  +WA +GCT++QP+DMEVGAGT HP+T LRALGP  W AAYVQPSRRP
Sbjct: 1   MLTFQQIIFKLQTFWADKGCTVIQPFDMEVGAGTSHPATCLRALGPEPWFAAYVQPSRRP 60

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY +NPNRLQHYYQFQV +KP P N+Q+LY++SL+ +GIDP +HD+RFVED+WE+PT
Sbjct: 61  KDGRYGDNPNRLQHYYQFQVALKPAPANIQDLYLDSLRELGIDPKVHDIRFVEDDWENPT 120

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQQV GI+C+P+ GEITYG+ERLAMY+Q V +VYD+V+
Sbjct: 121 LGAWGLGWEVWLNGMEVTQFTYFQQVGGIDCTPVLGEITYGIERLAMYLQGVENVYDLVW 180

Query: 190 NA-IEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHR 248
               +G  V YGD++ Q+E E S YNFEY++ + L   F D E +   L  +   +    
Sbjct: 181 AKTPDGNTVSYGDVYHQNEVEQSTYNFEYSDADWLLRQFNDYEAQAKRLFAEENAD---- 236

Query: 249 HHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                 PAY+  +KA H FNLLDARG IS TER  YI RIR+L++A  + ++ +  
Sbjct: 237 ---LALPAYELVLKAGHTFNLLDARGAISVTERATYIGRIRALSRAVAQKYIESRE 289


>gi|59802449|ref|YP_209161.1| glycyl-tRNA synthetase subunit alpha [Neisseria gonorrhoeae FA
           1090]
 gi|240015730|ref|ZP_04722270.1| glycyl-tRNA synthetase subunit alpha [Neisseria gonorrhoeae FA6140]
 gi|240079864|ref|ZP_04724407.1| glycyl-tRNA synthetase subunit alpha [Neisseria gonorrhoeae FA19]
 gi|240117021|ref|ZP_04731083.1| glycyl-tRNA synthetase subunit alpha [Neisseria gonorrhoeae PID1]
 gi|240122658|ref|ZP_04735614.1| glycyl-tRNA synthetase subunit alpha [Neisseria gonorrhoeae PID332]
 gi|240127361|ref|ZP_04740022.1| glycyl-tRNA synthetase subunit alpha [Neisseria gonorrhoeae
           SK-93-1035]
 gi|260441367|ref|ZP_05795183.1| glycyl-tRNA synthetase subunit alpha [Neisseria gonorrhoeae DGI2]
 gi|268596009|ref|ZP_06130176.1| glycyl-tRNA synthetase subunit alpha [Neisseria gonorrhoeae FA19]
 gi|268602707|ref|ZP_06136874.1| glycyl-tRNA synthetase subunit alpha [Neisseria gonorrhoeae PID1]
 gi|268681257|ref|ZP_06148119.1| glycyl-tRNA synthetase subunit alpha [Neisseria gonorrhoeae PID332]
 gi|268685734|ref|ZP_06152596.1| glycyl-tRNA synthetase subunit alpha [Neisseria gonorrhoeae
           SK-93-1035]
 gi|291044724|ref|ZP_06570433.1| glycyl-tRNA synthetase subunit alpha [Neisseria gonorrhoeae DGI2]
 gi|293397823|ref|ZP_06642029.1| glycyl-tRNA synthetase, alpha subunit [Neisseria gonorrhoeae F62]
 gi|75432312|sp|Q5F4Y8|SYGA_NEIG1 RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|59719344|gb|AAW90749.1| putative glycyl-tRNA synthetase alpha chain [Neisseria gonorrhoeae
           FA 1090]
 gi|268549797|gb|EEZ44816.1| glycyl-tRNA synthetase subunit alpha [Neisseria gonorrhoeae FA19]
 gi|268586838|gb|EEZ51514.1| glycyl-tRNA synthetase subunit alpha [Neisseria gonorrhoeae PID1]
 gi|268621541|gb|EEZ53941.1| glycyl-tRNA synthetase subunit alpha [Neisseria gonorrhoeae PID332]
 gi|268626018|gb|EEZ58418.1| glycyl-tRNA synthetase subunit alpha [Neisseria gonorrhoeae
           SK-93-1035]
 gi|291011618|gb|EFE03614.1| glycyl-tRNA synthetase subunit alpha [Neisseria gonorrhoeae DGI2]
 gi|291611769|gb|EFF40838.1| glycyl-tRNA synthetase, alpha subunit [Neisseria gonorrhoeae F62]
          Length = 298

 Score =  550 bits (1418), Expect = e-154,   Method: Composition-based stats.
 Identities = 170/296 (57%), Positives = 218/296 (73%), Gaps = 8/296 (2%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ II  L  +WA +GCT++QP+DMEVGAGT HP+T LRALGP  W AAYVQPSRRP
Sbjct: 1   MLTFQQIIFKLQTFWADKGCTVIQPFDMEVGAGTSHPATCLRALGPEPWFAAYVQPSRRP 60

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY +NPNRLQHYYQFQV +KP P N+Q+LY++SL+ +GIDP +HD+RFVED+WE+PT
Sbjct: 61  KDGRYGDNPNRLQHYYQFQVALKPAPANIQDLYLDSLRELGIDPKVHDIRFVEDDWENPT 120

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQQV GI+C+P+ GEITYG+ERLAMY+Q V +VYD+V+
Sbjct: 121 LGAWGLGWEVWLNGMEVTQFTYFQQVGGIDCTPVLGEITYGIERLAMYLQGVENVYDLVW 180

Query: 190 NA-IEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHR 248
               +G  V YGD++ Q+E E S YNFEY++ + L   F D E +   L           
Sbjct: 181 AKTPDGNTVSYGDVYHQNEVEQSTYNFEYSDADWLLRQFNDYEAQAKRLFA-------EE 233

Query: 249 HHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
           +     PAY+  +KA H FNLLDARG IS TER  YI RIR+L++A  + ++ +  
Sbjct: 234 NAGLALPAYELVLKAGHTFNLLDARGAISVTERATYIGRIRALSRAVAQKYIESRE 289


>gi|254284312|ref|ZP_04959280.1| glycyl-tRNA synthetase, alpha subunit [gamma proteobacterium
           NOR51-B]
 gi|219680515|gb|EED36864.1| glycyl-tRNA synthetase, alpha subunit [gamma proteobacterium
           NOR51-B]
          Length = 307

 Score =  550 bits (1418), Expect = e-154,   Method: Composition-based stats.
 Identities = 179/297 (60%), Positives = 219/297 (73%), Gaps = 10/297 (3%)

Query: 9   NDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRR 68
              +FQ +IL L  +W   GC +LQP D+EVGAGTFHP+T LRA+GP +W AAYVQPSRR
Sbjct: 2   TPKTFQALILRLQDFWGSHGCVLLQPLDLEVGAGTFHPATFLRAVGPENWNAAYVQPSRR 61

Query: 69  PLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESP 128
           P DGRY ENPNRLQHYYQFQV++KP+P + Q LY++SL+ +GIDPL HD+RFVEDNWESP
Sbjct: 62  PTDGRYGENPNRLQHYYQFQVVMKPSPDDFQGLYLDSLRELGIDPLEHDIRFVEDNWESP 121

Query: 129 TLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIV 188
           TLGAWGLGWE W +GME++QFTYFQQ  GIEC P++GEITYG+ER+AMY+Q V+SVYD+V
Sbjct: 122 TLGAWGLGWEVWLNGMEVTQFTYFQQAGGIECFPVTGEITYGIERIAMYLQGVDSVYDLV 181

Query: 189 FNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHR 248
           +       V YGD+F Q+E E S YNF+YA+ + L   F   E E L L++ G+P     
Sbjct: 182 WAETPQGVVTYGDVFHQNEVEQSTYNFQYADVDQLLATFDFCETETLRLVEAGLP----- 236

Query: 249 HHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNG 305
                 PAY+Q IKASH FNLLDAR  I  TERQRYILR+R+LAKA   A+      
Sbjct: 237 -----LPAYEQVIKASHAFNLLDARHAIGVTERQRYILRVRTLAKAVARAYFDARAA 288


>gi|121635588|ref|YP_975833.1| glycyl-tRNA synthetase subunit alpha [Neisseria meningitidis FAM18]
 gi|166200231|sp|A1KW09|SYGA_NEIMF RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|120867294|emb|CAM11065.1| glycyl-tRNA synthetase alpha chain [Neisseria meningitidis FAM18]
          Length = 298

 Score =  550 bits (1417), Expect = e-154,   Method: Composition-based stats.
 Identities = 170/296 (57%), Positives = 217/296 (73%), Gaps = 8/296 (2%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ II  L  +WA +GCT++Q +DMEVGAGT HP+T LRALGP  W AAYVQPSRRP
Sbjct: 1   MLTFQQIIFKLQTFWADKGCTVIQSFDMEVGAGTSHPATCLRALGPEPWFAAYVQPSRRP 60

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY +NPNRLQHYYQFQV +KP P N+Q+LY++SL+ +GIDP +HD+RFVED+WE+PT
Sbjct: 61  KDGRYGDNPNRLQHYYQFQVALKPAPANIQDLYLDSLRELGIDPKVHDIRFVEDDWENPT 120

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQQV GI+C+P+ GEITYG+ERLAMY+Q V +VYD+V+
Sbjct: 121 LGAWGLGWEVWLNGMEVTQFTYFQQVGGIDCTPVLGEITYGIERLAMYLQGVENVYDLVW 180

Query: 190 NAI-EGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHR 248
               +G  V YGD++ Q+E E S YNFEY++ + L   F D E +   LL          
Sbjct: 181 AKTLDGNTVTYGDVYHQNEVEQSTYNFEYSDADWLLRQFNDYEAQAKRLLA-------VE 233

Query: 249 HHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                 PAY+  +KA H FNLLDARG IS TER  YI RIR+L++A  + ++ +  
Sbjct: 234 EASLALPAYELVLKAGHTFNLLDARGAISVTERATYIGRIRALSRAVAQKYVESRE 289


>gi|225077387|ref|ZP_03720586.1| hypothetical protein NEIFLAOT_02448 [Neisseria flavescens
           NRL30031/H210]
 gi|224951271|gb|EEG32480.1| hypothetical protein NEIFLAOT_02448 [Neisseria flavescens
           NRL30031/H210]
          Length = 299

 Score =  550 bits (1417), Expect = e-154,   Method: Composition-based stats.
 Identities = 174/296 (58%), Positives = 218/296 (73%), Gaps = 8/296 (2%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ II  L  YWA +GCTI+QP+DMEVGAGT HP+T LRALGP  W AAYVQPSRRP
Sbjct: 1   MLTFQQIIFKLQNYWADKGCTIIQPFDMEVGAGTSHPATCLRALGPEPWFAAYVQPSRRP 60

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY +NPNRLQHYYQFQV +KP P N+Q+LY++SL+ +GIDP +HD+RFVED+WE+PT
Sbjct: 61  KDGRYGDNPNRLQHYYQFQVALKPAPANIQDLYLDSLRELGIDPKVHDIRFVEDDWENPT 120

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQQV GI+CSP+ GEITYG+ERLAMY+Q V +VYD+V+
Sbjct: 121 LGAWGLGWEVWLNGMEVTQFTYFQQVGGIDCSPVLGEITYGIERLAMYLQGVENVYDLVW 180

Query: 190 NAI-EGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHR 248
               +G  V YGD++ Q+E E S YNFEY++ + L   F D E++   LL          
Sbjct: 181 AKTLDGNIVTYGDVYHQNEVEQSTYNFEYSDADWLLRQFNDYEEQAKRLLA-------VE 233

Query: 249 HHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                 PAY+  +KA H FNLLDARG IS TER  YI RIR+L++   + F+ +  
Sbjct: 234 DTSLALPAYELVLKAGHTFNLLDARGAISVTERATYIGRIRALSRIVAQKFVESRE 289


>gi|240112073|ref|ZP_04726563.1| glycyl-tRNA synthetase subunit alpha [Neisseria gonorrhoeae MS11]
 gi|268598132|ref|ZP_06132299.1| glycyl-tRNA synthetase subunit alpha [Neisseria gonorrhoeae MS11]
 gi|268582263|gb|EEZ46939.1| glycyl-tRNA synthetase subunit alpha [Neisseria gonorrhoeae MS11]
          Length = 298

 Score =  550 bits (1417), Expect = e-154,   Method: Composition-based stats.
 Identities = 169/296 (57%), Positives = 219/296 (73%), Gaps = 8/296 (2%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ II  L  +WA +GCT++QP+DMEVGAGT HP+T LRALGP  W AAYVQPSRRP
Sbjct: 1   MLTFQQIIFKLQTFWADKGCTVIQPFDMEVGAGTSHPATCLRALGPEPWFAAYVQPSRRP 60

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY +NPNRLQHYYQFQ+ +KP P N+Q+LY++SL+ +GIDP +HD+RFVED+WE+PT
Sbjct: 61  KDGRYGDNPNRLQHYYQFQIALKPAPANIQDLYLDSLRELGIDPKVHDIRFVEDDWENPT 120

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQQV GI+C+P+ GEITYG+ERLAMY+Q V +VYD+V+
Sbjct: 121 LGAWGLGWEVWLNGMEVTQFTYFQQVGGIDCTPVLGEITYGIERLAMYLQGVENVYDLVW 180

Query: 190 NA-IEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHR 248
               +G  V YGD++ Q+E E S YNFEY++ + L   F D E +   L  +   +    
Sbjct: 181 AKTPDGNTVSYGDVYHQNEVEQSTYNFEYSDADWLLRQFNDYEAQAKRLFAEENAD---- 236

Query: 249 HHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                 PAY+  +KA H FNLLDARG IS TER  YI RIR+L++A  + ++ +  
Sbjct: 237 ---LALPAYELVLKAGHTFNLLDARGAISVTERATYIGRIRALSRAVAQKYIESRE 289


>gi|84683639|ref|ZP_01011542.1| glycyl-tRNA synthetase alpha subunit [Maritimibacter alkaliphilus
           HTCC2654]
 gi|84668382|gb|EAQ14849.1| glycyl-tRNA synthetase alpha subunit [Rhodobacterales bacterium
           HTCC2654]
          Length = 312

 Score =  549 bits (1416), Expect = e-154,   Method: Composition-based stats.
 Identities = 195/305 (63%), Positives = 236/305 (77%), Gaps = 2/305 (0%)

Query: 4   IHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYV 63
           +       SFQ IIL L  YWA +GC ILQPYDMEVGAGTFHP+TTLRALG  +W AAYV
Sbjct: 1   MAEFTKPKSFQEIILRLQTYWASKGCAILQPYDMEVGAGTFHPATTLRALGSNAWAAAYV 60

Query: 64  QPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVED 123
           QPSRRP DGRY ENPNRLQHYYQ+QV+IKP+P +LQ LY+ SL+A+GID  +HD+RFVED
Sbjct: 61  QPSRRPTDGRYGENPNRLQHYYQYQVLIKPSPPDLQALYLGSLEAIGIDMALHDIRFVED 120

Query: 124 NWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNS 183
           +WESPTLGAWGLGWE WCDGME+SQFTYFQQV G +C P+SGE+TYGLERLAMYV  ++ 
Sbjct: 121 DWESPTLGAWGLGWEVWCDGMEVSQFTYFQQVGGHDCRPVSGELTYGLERLAMYVLGIDH 180

Query: 184 VYDIVFNAIEGQ-NVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLK-KG 241
           V ++ FN  +    + YGD+F Q+E+EYSR+NF+ A+ E L  HF D+E+EC  +L  + 
Sbjct: 181 VMEMPFNDPQSPIPLSYGDVFRQTEEEYSRHNFDAADTEKLLRHFEDAERECQSILSHEA 240

Query: 242 IPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLM 301
              +  +  +   PAYDQCIKASHIFNLLDARGVIS TERQ YI R+R+LAK C +AF+ 
Sbjct: 241 EDPKTGKRIVMAHPAYDQCIKASHIFNLLDARGVISVTERQAYIGRVRALAKLCADAFVQ 300

Query: 302 TPNGG 306
           T  GG
Sbjct: 301 TEAGG 305


>gi|134300312|ref|YP_001113808.1| glycyl-tRNA synthetase subunit alpha [Desulfotomaculum reducens
           MI-1]
 gi|172044327|sp|A4J7D0|SYGA_DESRM RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|134053012|gb|ABO50983.1| glycyl-tRNA synthetase alpha chain [Desulfotomaculum reducens MI-1]
          Length = 295

 Score =  549 bits (1416), Expect = e-154,   Method: Composition-based stats.
 Identities = 170/294 (57%), Positives = 219/294 (74%), Gaps = 14/294 (4%)

Query: 11  LSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPL 70
           ++FQ +ILTL ++WA+Q C I QPYD+E GAGT +P+T LRALGP  W+ AYV+PSRRP 
Sbjct: 1   MNFQELILTLNKFWAEQNCIIQQPYDIEKGAGTMNPATFLRALGPEPWRVAYVEPSRRPT 60

Query: 71  DGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTL 130
           DGRY ENPNRLQHY+Q+QVI+KP+P ++  +Y++SL+A+GIDP  HD+RFVEDNWESPTL
Sbjct: 61  DGRYGENPNRLQHYFQYQVILKPSPDDVIPVYLDSLRAIGIDPDKHDIRFVEDNWESPTL 120

Query: 131 GAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFN 190
           GAWGLGWE W DGME++QFTYFQQ  GI+C P+S EITYGLERLAM++Q  +SVYDI + 
Sbjct: 121 GAWGLGWEVWLDGMEVTQFTYFQQCGGIDCHPVSAEITYGLERLAMFIQQKDSVYDITWV 180

Query: 191 AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHH 250
                ++ YGD++ Q+E E S YNFE AN E+L + F   E E   +L+KG+        
Sbjct: 181 G----DITYGDVYHQNEVEQSGYNFEVANTEMLFDLFDMYEAEANHILEKGL-------- 228

Query: 251 LCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
             V PAYD  +K SH FNLLDARG IS +ERQ +I R+R +A+AC  A++    
Sbjct: 229 --VLPAYDYVLKCSHTFNLLDARGAISVSERQGFIARVRQMARACAHAYVEQRE 280


>gi|113866552|ref|YP_725041.1| glycyl-tRNA synthetase subunit alpha [Ralstonia eutropha H16]
 gi|113525328|emb|CAJ91673.1| Glycyl-tRNA synthetase alpha subunit [Ralstonia eutropha H16]
          Length = 342

 Score =  549 bits (1416), Expect = e-154,   Method: Composition-based stats.
 Identities = 171/303 (56%), Positives = 218/303 (71%), Gaps = 6/303 (1%)

Query: 9   NDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRR 68
           + L+FQ +ILTL  YW +QGC +LQP D+EVGAGT H  T LRALGP  W+AAYVQPSRR
Sbjct: 27  HMLTFQQMILTLQAYWDRQGCALLQPIDLEVGAGTSHVHTFLRALGPEPWRAAYVQPSRR 86

Query: 69  PLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESP 128
           P DGRY ENPNRLQHYYQ+QV++KP P N+  LY+ SL+A+G+D   +D+RFVED+WE+P
Sbjct: 87  PKDGRYGENPNRLQHYYQYQVVLKPAPENILELYLGSLEALGLDLKQNDIRFVEDDWENP 146

Query: 129 TLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIV 188
           TLGAWGLGWE W +GME++QFTYFQQV GI+C PI+GEITYG+ERLAMY+Q V +VYD++
Sbjct: 147 TLGAWGLGWEVWLNGMEVTQFTYFQQVGGIDCKPITGEITYGIERLAMYLQKVENVYDLI 206

Query: 189 FNAIEGQN----VLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           +           + YGD++ Q+E E S YNFE++N EIL  HF + E E   L+  G   
Sbjct: 207 WTEWVENGETRRLTYGDVYHQNEVEQSTYNFEHSNTEILFRHFAEHEGEAKRLMGNGDGA 266

Query: 245 EHHRHH--LCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMT 302
           E  +        PAY+Q +KA+H FNLLDARG IS TER  YI RIR L++   +A+  +
Sbjct: 267 EEGQAAGTRLALPAYEQVLKAAHTFNLLDARGAISVTERAAYIGRIRHLSRQVAQAYYDS 326

Query: 303 PNG 305
              
Sbjct: 327 REA 329


>gi|257063814|ref|YP_003143486.1| glycyl-tRNA synthetase, tetrameric type, alpha subunit [Slackia
           heliotrinireducens DSM 20476]
 gi|256791467|gb|ACV22137.1| glycyl-tRNA synthetase, tetrameric type, alpha subunit [Slackia
           heliotrinireducens DSM 20476]
          Length = 310

 Score =  549 bits (1416), Expect = e-154,   Method: Composition-based stats.
 Identities = 182/300 (60%), Positives = 227/300 (75%), Gaps = 11/300 (3%)

Query: 3   PIHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAY 62
                 + L+FQ +IL L QYWA  GC +LQPYD EVGAGTFH +TTLR+LGP +W+ AY
Sbjct: 2   SKPANGDALTFQEVILRLQQYWADLGCVVLQPYDNEVGAGTFHTATTLRSLGPDTWRTAY 61

Query: 63  VQPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVE 122
           VQPSRRP DGRY ENPNR+QHYYQ+QV++KP+P N+Q+LY+ESL+A+GI+   HDVRFVE
Sbjct: 62  VQPSRRPTDGRYGENPNRMQHYYQYQVLLKPSPDNVQDLYLESLRAIGINVEEHDVRFVE 121

Query: 123 DNWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVN 182
           D+WESPTLGAWGLGWE W DGME++QFTYFQQV G ECSP+  EITYGLERL MY+Q V+
Sbjct: 122 DDWESPTLGAWGLGWEVWIDGMEVTQFTYFQQVGGFECSPVPAEITYGLERLTMYIQGVD 181

Query: 183 SVYDIVFNAIEGQNV-LYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKG 241
           SVYDIV++  +   V  YGD+F ++E+E+S YNFE A+ + L + F   E+EC   L+ G
Sbjct: 182 SVYDIVWSRGDDGIVFTYGDVFLENEREFSAYNFEVADTDFLFSEFDRYERECNRTLEAG 241

Query: 242 IPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLM 301
           +P           PAYD  +K SH FNLLDARGVIS TER  YILR+R++AKAC  ++L 
Sbjct: 242 LP----------LPAYDYVLKCSHAFNLLDARGVISATERMGYILRVRTIAKACCASYLE 291


>gi|260774574|ref|ZP_05883487.1| glycyl-tRNA synthetase alpha chain [Vibrio metschnikovii CIP 69.14]
 gi|260610480|gb|EEX35686.1| glycyl-tRNA synthetase alpha chain [Vibrio metschnikovii CIP 69.14]
          Length = 305

 Score =  549 bits (1416), Expect = e-154,   Method: Composition-based stats.
 Identities = 183/301 (60%), Positives = 218/301 (72%), Gaps = 8/301 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +IL L  YWAQQGCTI+QP DMEVGAGT HP T LRA+GP     AYVQ
Sbjct: 1   MQKYDIKTFQGMILALQDYWAQQGCTIVQPLDMEVGAGTSHPMTCLRAIGPEPIATAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQVIIKP+P N+Q LY+ SL+ +G+DPL+HD+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVIIKPSPDNIQELYLGSLEVLGVDPLVHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYG+ERLAMY+Q V+SV
Sbjct: 121 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGIERLAMYIQGVDSV 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V+       V YGDIF Q+E E S YNFE+A+ + L   F   EKEC          
Sbjct: 181 YDLVWTDGPLGKVTYGDIFHQNEVEQSTYNFEHADVDFLFTFFDQCEKECQ--------Y 232

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY++ +KA H FNLLDAR  IS TERQRYILRIR+L KA  EA+  +  
Sbjct: 233 LLELEKPLPLPAYERILKAGHAFNLLDARKAISVTERQRYILRIRNLTKAVAEAYYASRE 292

Query: 305 G 305
            
Sbjct: 293 A 293


>gi|241760244|ref|ZP_04758340.1| glycyl-tRNA synthetase, alpha subunit [Neisseria flavescens SK114]
 gi|319639054|ref|ZP_07993811.1| glycyl-tRNA synthetase alpha subunit [Neisseria mucosa C102]
 gi|241319355|gb|EER55820.1| glycyl-tRNA synthetase, alpha subunit [Neisseria flavescens SK114]
 gi|317399632|gb|EFV80296.1| glycyl-tRNA synthetase alpha subunit [Neisseria mucosa C102]
          Length = 299

 Score =  549 bits (1415), Expect = e-154,   Method: Composition-based stats.
 Identities = 173/296 (58%), Positives = 218/296 (73%), Gaps = 8/296 (2%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ II  L  YWA +GCT++QP+DMEVGAGT HP+T LRALGP  W AAYVQPSRRP
Sbjct: 1   MLTFQQIIFKLQNYWADKGCTVIQPFDMEVGAGTSHPATCLRALGPEPWFAAYVQPSRRP 60

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY +NPNRLQHYYQFQV +KP P N+Q+LY++SL+ +GIDP +HD+RFVED+WE+PT
Sbjct: 61  KDGRYGDNPNRLQHYYQFQVALKPAPANIQDLYLDSLRELGIDPKVHDIRFVEDDWENPT 120

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQQV GI+CSP+ GEITYG+ERLAMY+Q V +VYD+V+
Sbjct: 121 LGAWGLGWEVWLNGMEVTQFTYFQQVGGIDCSPVLGEITYGIERLAMYLQGVENVYDLVW 180

Query: 190 NAI-EGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHR 248
               +G  V YGD++ Q+E E S YNFEY++ + L   F D E++   LL          
Sbjct: 181 AKTLDGNIVTYGDVYHQNEVEQSTYNFEYSDADWLLRQFNDYEEQAKRLLA-------VE 233

Query: 249 HHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                 PAY+  +KA H FNLLDARG IS TER  YI RIR+L++   + F+ +  
Sbjct: 234 DTSLALPAYELVLKAGHTFNLLDARGAISVTERATYIGRIRALSRIVAQKFVESRE 289


>gi|284008980|emb|CBA75883.1| glycyl-tRNA synthetase alpha subunit [Arsenophonus nasoniae]
          Length = 303

 Score =  549 bits (1415), Expect = e-154,   Method: Composition-based stats.
 Identities = 185/291 (63%), Positives = 219/291 (75%), Gaps = 8/291 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +ILTL  YWA+QGCTI+QP DMEVGAGT HP T LRALGP    AAYVQ
Sbjct: 1   MQKFDTKTFQGLILTLQDYWARQGCTIVQPLDMEVGAGTSHPMTCLRALGPEPIAAAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQVIIKP+P N+Q LY+ SL+A+G+DP IHD+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVIIKPSPENIQELYLGSLQALGLDPTIHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLERLAMY+Q V+SV
Sbjct: 121 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGLERLAMYIQGVDSV 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD++++        YGDI+ Q+E E S YNFEYAN + L   F + EKE   LL    P 
Sbjct: 181 YDLLWSDGPLGKTTYGDIYHQNEVEQSAYNFEYANVDFLFKCFEEYEKEAQYLLSLETP- 239

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKAC 295
                     PAY++ +KA+H FNLLDAR  IS TERQRYILRIR+L K  
Sbjct: 240 -------LPLPAYERILKAAHTFNLLDARKAISVTERQRYILRIRTLTKGV 283


>gi|76811054|ref|YP_332295.1| glycyl-tRNA synthetase subunit alpha [Burkholderia pseudomallei
           1710b]
 gi|76580507|gb|ABA49982.1| glycyl-tRNA synthetase, alpha chain [Burkholderia pseudomallei
           1710b]
          Length = 390

 Score =  548 bits (1414), Expect = e-154,   Method: Composition-based stats.
 Identities = 171/310 (55%), Positives = 216/310 (69%), Gaps = 18/310 (5%)

Query: 3   PIHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAY 62
           P   +   L+FQ IILTL  YW +QGC +LQP DMEVGAGT H  T LRA+GP  W+AAY
Sbjct: 49  PAPRRPLMLTFQQIILTLQSYWDRQGCALLQPIDMEVGAGTSHVHTFLRAIGPEPWRAAY 108

Query: 63  VQPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVE 122
           VQPSRRP DGRY ENPNRLQHYYQ+QV++KP P N+ +LY+ SL+A+G D   +DVRFVE
Sbjct: 109 VQPSRRPKDGRYGENPNRLQHYYQYQVVLKPAPENILDLYLGSLEALGFDLKQNDVRFVE 168

Query: 123 DNWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVN 182
           D+WE+PTLGAWGLGWE W +GME++QFTYFQQV G++C P+ GEITYGLERLAMY+Q V 
Sbjct: 169 DDWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLDCKPVLGEITYGLERLAMYLQKVE 228

Query: 183 SVYDIVF--------NAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKEC 234
           +VYD+V+        N  E + + YGD++ Q+E E S YNFE AN E+L   F   E E 
Sbjct: 229 NVYDLVWTEWEEPGPNGPELRRLTYGDVYHQNEVEQSTYNFEQANVELLFTFFNSYEAEA 288

Query: 235 LDLLKKGIPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKA 294
             +++  +            PAY+  +KA H FNLLDARG IS TER  YI RIR+L++ 
Sbjct: 289 KRMIEAQL----------ALPAYELVLKAGHTFNLLDARGAISVTERAAYIGRIRALSRL 338

Query: 295 CGEAFLMTPN 304
             +A+  +  
Sbjct: 339 VAQAYYDSRE 348


>gi|124383694|ref|YP_001028313.1| glycyl-tRNA synthetase subunit alpha [Burkholderia mallei NCTC
           10229]
 gi|251767813|ref|ZP_02268488.2| glycyl-tRNA synthetase, alpha chain [Burkholderia mallei PRL-20]
 gi|124291714|gb|ABN00983.1| glycyl-tRNA synthetase, alpha chain [Burkholderia mallei NCTC
           10229]
 gi|243061637|gb|EES43823.1| glycyl-tRNA synthetase, alpha chain [Burkholderia mallei PRL-20]
          Length = 392

 Score =  548 bits (1414), Expect = e-154,   Method: Composition-based stats.
 Identities = 171/310 (55%), Positives = 216/310 (69%), Gaps = 18/310 (5%)

Query: 3   PIHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAY 62
           P   +   L+FQ IILTL  YW +QGC +LQP DMEVGAGT H  T LRA+GP  W+AAY
Sbjct: 51  PAPRRPLMLTFQQIILTLQSYWDRQGCALLQPIDMEVGAGTSHVHTFLRAIGPEPWRAAY 110

Query: 63  VQPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVE 122
           VQPSRRP DGRY ENPNRLQHYYQ+QV++KP P N+ +LY+ SL+A+G D   +DVRFVE
Sbjct: 111 VQPSRRPKDGRYGENPNRLQHYYQYQVVLKPAPENILDLYLGSLEALGFDLKQNDVRFVE 170

Query: 123 DNWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVN 182
           D+WE+PTLGAWGLGWE W +GME++QFTYFQQV G++C P+ GEITYGLERLAMY+Q V 
Sbjct: 171 DDWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLDCKPVLGEITYGLERLAMYLQKVE 230

Query: 183 SVYDIVF--------NAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKEC 234
           +VYD+V+        N  E + + YGD++ Q+E E S YNFE AN E+L   F   E E 
Sbjct: 231 NVYDLVWTEWEEPGPNGPELRRLTYGDVYHQNEVEQSTYNFEQANVELLFTFFNSYEAEA 290

Query: 235 LDLLKKGIPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKA 294
             +++  +            PAY+  +KA H FNLLDARG IS TER  YI RIR+L++ 
Sbjct: 291 KRMIEAQL----------ALPAYELVLKAGHTFNLLDARGAISVTERAAYIGRIRALSRL 340

Query: 295 CGEAFLMTPN 304
             +A+  +  
Sbjct: 341 VAQAYYDSRE 350


>gi|325917987|ref|ZP_08180154.1| glycyl-tRNA synthetase alpha chain [Xanthomonas vesicatoria ATCC
           35937]
 gi|325535810|gb|EGD07639.1| glycyl-tRNA synthetase alpha chain [Xanthomonas vesicatoria ATCC
           35937]
          Length = 302

 Score =  548 bits (1414), Expect = e-154,   Method: Composition-based stats.
 Identities = 182/300 (60%), Positives = 226/300 (75%), Gaps = 11/300 (3%)

Query: 6   NKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQP 65
           +++  ++FQ +I TL QYWA QGC ++QP D+EVGAGTFHP+T LRALGP  W AAYVQP
Sbjct: 4   SRRVPITFQGLIQTLNQYWADQGCVLIQPLDLEVGAGTFHPATFLRALGPEPWNAAYVQP 63

Query: 66  SRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNW 125
           SRRP DGRY ENPNRLQ YYQ+QV +KPNP N+Q+LY+ SLKA+GIDPL+HD+RFVEDNW
Sbjct: 64  SRRPTDGRYGENPNRLQRYYQYQVAMKPNPDNIQDLYLGSLKALGIDPLVHDLRFVEDNW 123

Query: 126 ESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVY 185
           ESPTLGAWGLGWE W +GME++QFTYFQQ  G+EC P+ GEITYGLERL MY+Q+ ++VY
Sbjct: 124 ESPTLGAWGLGWEVWLNGMEVTQFTYFQQAGGLECKPVLGEITYGLERLCMYLQSCDNVY 183

Query: 186 DIVFN-AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           D+V+    +G  V YGD++ Q+E E S YNFE+AN E L + F   E E   L++ G+P 
Sbjct: 184 DLVWTYGPDGAAVTYGDVYHQNEVEQSAYNFEHANVEELFHRFDACEAEAKQLIEVGLP- 242

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY+Q  KASH FNLLDAR  IS TERQRYILR+R+LA+   +A+     
Sbjct: 243 ---------LPAYEQVTKASHAFNLLDARRAISVTERQRYILRVRALAQGVAQAYHAQRE 293


>gi|329119290|ref|ZP_08247977.1| glycyl-tRNA synthetase alpha subunit [Neisseria bacilliformis ATCC
           BAA-1200]
 gi|327464637|gb|EGF10935.1| glycyl-tRNA synthetase alpha subunit [Neisseria bacilliformis ATCC
           BAA-1200]
          Length = 330

 Score =  548 bits (1414), Expect = e-154,   Method: Composition-based stats.
 Identities = 173/297 (58%), Positives = 218/297 (73%), Gaps = 8/297 (2%)

Query: 9   NDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRR 68
             L+FQ II  L  YWA QGC +LQP+DMEVGAGT HP+T LRALGP  W AAYVQPSRR
Sbjct: 27  TMLTFQQIIFKLQTYWAAQGCALLQPFDMEVGAGTSHPATCLRALGPEPWFAAYVQPSRR 86

Query: 69  PLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESP 128
           P DGRY +NPNRLQHYYQFQV +KP P N+Q+LY++SL+ +GIDP +HD+RFVED+WE+P
Sbjct: 87  PKDGRYGDNPNRLQHYYQFQVALKPAPANIQDLYLDSLRELGIDPKVHDIRFVEDDWENP 146

Query: 129 TLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIV 188
           TLGAWGLGWE W +GME++QFTYFQQV GI+C+P+ GEITYG+ERLAMY+Q V +VYD+V
Sbjct: 147 TLGAWGLGWEVWLNGMEVTQFTYFQQVGGIDCAPVLGEITYGIERLAMYLQGVENVYDLV 206

Query: 189 FNAI-EGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHH 247
           +    +GQ + YGD++ Q+E E S YNFEY++ + L   F D E +   LL     N   
Sbjct: 207 WTKTLDGQVLTYGDVYHQNEVEQSTYNFEYSDADWLLAQFNDYEAQAKRLLALEDAN--- 263

Query: 248 RHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                  PAY+  +KA H FNLLDARG IS TER  YI RIR+L+++  + ++    
Sbjct: 264 ----LALPAYELVLKAGHTFNLLDARGAISVTERATYIGRIRALSRSVAQKYVEGRE 316


>gi|289209734|ref|YP_003461800.1| glycyl-tRNA synthetase subunit alpha [Thioalkalivibrio sp. K90mix]
 gi|288945365|gb|ADC73064.1| glycyl-tRNA synthetase, alpha subunit [Thioalkalivibrio sp. K90mix]
          Length = 314

 Score =  548 bits (1414), Expect = e-154,   Method: Composition-based stats.
 Identities = 171/295 (57%), Positives = 220/295 (74%), Gaps = 11/295 (3%)

Query: 12  SFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPLD 71
           +FQ++I  L  YW   GC +LQPYDME+GAGTFHP+T LR++GP  W+AAYVQPSRRP D
Sbjct: 13  TFQDLIRRLQDYWNDHGCVVLQPYDMEMGAGTFHPATFLRSIGPEPWRAAYVQPSRRPTD 72

Query: 72  GRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTLG 131
           GRY +NPNRLQHYYQFQV++KP+P ++Q+L++ SL+A+G D L HDVRFVEDNWESPTLG
Sbjct: 73  GRYGDNPNRLQHYYQFQVLLKPSPPDIQDLFLGSLQALGFDTLTHDVRFVEDNWESPTLG 132

Query: 132 AWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFN- 190
           AWGLGWE W +GME++QFTYFQQV G++C P+SGEITYGLERLAMY+Q V SV+D+V+  
Sbjct: 133 AWGLGWEVWLNGMEVTQFTYFQQVGGLDCYPVSGEITYGLERLAMYLQGVESVFDLVWTV 192

Query: 191 AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHH 250
             +G+ V YGD++ Q+E E S YNFE+A+ + L   F     E   ++  G+P       
Sbjct: 193 GPDGRPVTYGDVYHQNEVEQSTYNFEHADRDALFAAFDQHANESDRMIDLGLP------- 245

Query: 251 LCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNG 305
               PAY+Q ++ASH FNLLDARG IS TERQRYILR+R L++     +  +   
Sbjct: 246 ---LPAYEQMLRASHSFNLLDARGAISVTERQRYILRVRELSRNVARKYYESREA 297


>gi|15640053|ref|NP_229680.1| glycyl-tRNA synthetase subunit alpha [Vibrio cholerae O1 biovar El
           Tor str. N16961]
 gi|121587263|ref|ZP_01677036.1| glycyl-tRNA synthetase, alpha chain [Vibrio cholerae 2740-80]
 gi|121727897|ref|ZP_01680956.1| glycyl-tRNA synthetase, alpha chain [Vibrio cholerae V52]
 gi|147675392|ref|YP_001218391.1| glycyl-tRNA synthetase subunit alpha [Vibrio cholerae O395]
 gi|153212932|ref|ZP_01948526.1| glycyl-tRNA synthetase, alpha chain [Vibrio cholerae 1587]
 gi|153802497|ref|ZP_01957083.1| glycyl-tRNA synthetase, alpha chain [Vibrio cholerae MZO-3]
 gi|153817609|ref|ZP_01970276.1| glycyl-tRNA synthetase, alpha chain [Vibrio cholerae NCTC 8457]
 gi|153821943|ref|ZP_01974610.1| glycyl-tRNA synthetase, alpha chain [Vibrio cholerae B33]
 gi|153826422|ref|ZP_01979089.1| glycyl-tRNA synthetase, alpha chain [Vibrio cholerae MZO-2]
 gi|153830854|ref|ZP_01983521.1| glycyl-tRNA synthetase, alpha chain [Vibrio cholerae 623-39]
 gi|227080258|ref|YP_002808809.1| glycyl-tRNA synthetase, alpha chain [Vibrio cholerae M66-2]
 gi|254225551|ref|ZP_04919160.1| glycyl-tRNA synthetase, alpha chain [Vibrio cholerae V51]
 gi|254291118|ref|ZP_04961915.1| glycyl-tRNA synthetase, alpha chain [Vibrio cholerae AM-19226]
 gi|254851585|ref|ZP_05240935.1| glycyl-tRNA synthetase [Vibrio cholerae MO10]
 gi|258622966|ref|ZP_05717981.1| glycyl-tRNA synthetase alpha subunit [Vibrio mimicus VM573]
 gi|297581945|ref|ZP_06943865.1| glycyl-tRNA synthetase subunit alpha [Vibrio cholerae RC385]
 gi|9654413|gb|AAF93199.1| glycyl-tRNA synthetase, alpha chain [Vibrio cholerae O1 biovar El
           Tor str. N16961]
 gi|121548509|gb|EAX58565.1| glycyl-tRNA synthetase, alpha chain [Vibrio cholerae 2740-80]
 gi|121629841|gb|EAX62256.1| glycyl-tRNA synthetase, alpha chain [Vibrio cholerae V52]
 gi|124116158|gb|EAY34978.1| glycyl-tRNA synthetase, alpha chain [Vibrio cholerae 1587]
 gi|124121967|gb|EAY40710.1| glycyl-tRNA synthetase, alpha chain [Vibrio cholerae MZO-3]
 gi|125621871|gb|EAZ50196.1| glycyl-tRNA synthetase, alpha chain [Vibrio cholerae V51]
 gi|126511877|gb|EAZ74471.1| glycyl-tRNA synthetase, alpha chain [Vibrio cholerae NCTC 8457]
 gi|126520563|gb|EAZ77786.1| glycyl-tRNA synthetase, alpha chain [Vibrio cholerae B33]
 gi|146317275|gb|ABQ21814.1| glycyl-tRNA synthetase, alpha chain [Vibrio cholerae O395]
 gi|148873664|gb|EDL71799.1| glycyl-tRNA synthetase, alpha chain [Vibrio cholerae 623-39]
 gi|149739808|gb|EDM54003.1| glycyl-tRNA synthetase, alpha chain [Vibrio cholerae MZO-2]
 gi|150422963|gb|EDN14913.1| glycyl-tRNA synthetase, alpha chain [Vibrio cholerae AM-19226]
 gi|227008146|gb|ACP04358.1| glycyl-tRNA synthetase, alpha chain [Vibrio cholerae M66-2]
 gi|227011976|gb|ACP08186.1| glycyl-tRNA synthetase, alpha chain [Vibrio cholerae O395]
 gi|254847290|gb|EET25704.1| glycyl-tRNA synthetase [Vibrio cholerae MO10]
 gi|258584749|gb|EEW09483.1| glycyl-tRNA synthetase alpha subunit [Vibrio mimicus VM573]
 gi|297533812|gb|EFH72653.1| glycyl-tRNA synthetase subunit alpha [Vibrio cholerae RC385]
          Length = 330

 Score =  548 bits (1414), Expect = e-154,   Method: Composition-based stats.
 Identities = 182/302 (60%), Positives = 219/302 (72%), Gaps = 8/302 (2%)

Query: 4   IHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYV 63
              K +  +FQ +IL L  YWAQQGCTI+QP DMEVGAGT HP T LRALGP     AYV
Sbjct: 25  TMQKYDIKTFQGMILALQDYWAQQGCTIVQPLDMEVGAGTSHPMTCLRALGPEPIATAYV 84

Query: 64  QPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVED 123
           QPSRRP DGRY ENPNRLQHYYQFQVIIKP+P N+Q LY+ SL+ +G+DP +HD+RFVED
Sbjct: 85  QPSRRPTDGRYGENPNRLQHYYQFQVIIKPSPDNIQELYLGSLRVLGVDPCVHDIRFVED 144

Query: 124 NWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNS 183
           NWE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYG+ERLAMY+Q V+S
Sbjct: 145 NWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGIERLAMYIQGVDS 204

Query: 184 VYDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIP 243
           VYD+V+       V YGDIF Q+E E S YNFE+A+ + L  +F   EKEC         
Sbjct: 205 VYDLVWTDGPLGKVTYGDIFHQNEVEQSTYNFEHADVDFLFTYFDQCEKECK-------- 256

Query: 244 NEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTP 303
                      PAY++ +KA+H FNLLDAR  IS TERQRYILRIR+L K+  EA+  + 
Sbjct: 257 YLLELEKPLPLPAYERILKAAHAFNLLDARKAISVTERQRYILRIRNLTKSVAEAYYASR 316

Query: 304 NG 305
             
Sbjct: 317 EA 318


>gi|258626090|ref|ZP_05720941.1| glycyl-tRNA synthetase alpha subunit [Vibrio mimicus VM603]
 gi|258581616|gb|EEW06514.1| glycyl-tRNA synthetase alpha subunit [Vibrio mimicus VM603]
          Length = 330

 Score =  548 bits (1414), Expect = e-154,   Method: Composition-based stats.
 Identities = 182/302 (60%), Positives = 219/302 (72%), Gaps = 8/302 (2%)

Query: 4   IHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYV 63
              K +  +FQ +IL L  YWAQQGCTI+QP DMEVGAGT HP T LRALGP     AYV
Sbjct: 25  TMQKYDIKTFQGMILALQDYWAQQGCTIVQPLDMEVGAGTSHPMTCLRALGPEPIATAYV 84

Query: 64  QPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVED 123
           QPSRRP DGRY ENPNRLQHYYQFQVIIKP+P N+Q LY+ SL+ +G+DP +HD+RFVED
Sbjct: 85  QPSRRPTDGRYGENPNRLQHYYQFQVIIKPSPDNIQELYLGSLRVLGVDPCVHDIRFVED 144

Query: 124 NWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNS 183
           NWE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYG+ERLAMY+Q V+S
Sbjct: 145 NWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGIERLAMYIQGVDS 204

Query: 184 VYDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIP 243
           VYD+V+       V YGDIF Q+E E S YNFE+A+ + L  +F   EKEC         
Sbjct: 205 VYDLVWTDGPLGKVTYGDIFHQNEVEQSTYNFEHADVDFLFTYFDQCEKECK-------- 256

Query: 244 NEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTP 303
                      PAY++ +KA+H FNLLDAR  IS TERQRYILRIR+L K+  EA+  + 
Sbjct: 257 YLLELEKPLPLPAYERILKAAHAFNLLDARKAISVTERQRYILRIRNLTKSVAEAYYASR 316

Query: 304 NG 305
             
Sbjct: 317 EA 318


>gi|330890239|gb|EGH22900.1| glycyl-tRNA synthetase subunit alpha [Pseudomonas syringae pv. mori
           str. 301020]
          Length = 315

 Score =  548 bits (1414), Expect = e-154,   Method: Composition-based stats.
 Identities = 184/293 (62%), Positives = 221/293 (75%), Gaps = 10/293 (3%)

Query: 12  SFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPLD 71
           +FQ++IL L QYWA+QGC +LQPYDMEVGAGTFH +T LRA+GP +W AAYVQPSR P D
Sbjct: 10  TFQDLILALQQYWAEQGCVVLQPYDMEVGAGTFHTATFLRAVGPETWNAAYVQPSRPPTD 69

Query: 72  GRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTLG 131
           GRY ENPNRLQHYYQFQVI+KPNP N Q LY+ SLK +G+DPL+HDVRFVEDNWESPTLG
Sbjct: 70  GRYGENPNRLQHYYQFQVILKPNPDNFQELYLGSLKHIGLDPLVHDVRFVEDNWESPTLG 129

Query: 132 AWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFNA 191
           AWGLGWE W +GME+SQFTYFQQV G+EC P++GEITYGLERLAMY Q V+SVYD+V+  
Sbjct: 130 AWGLGWEIWLNGMEVSQFTYFQQVGGLECYPVTGEITYGLERLAMYQQGVDSVYDLVWAD 189

Query: 192 IEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHHL 251
                V YGD+F Q+E E S YNFE+AN + L   F   E E   L++  +P        
Sbjct: 190 GPFGKVTYGDVFHQNEVEQSTYNFEHANVDKLFELFDFYESEAARLIELELP-------- 241

Query: 252 CVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
              P Y+  +KASH FNLLDAR  IS T RQ+YILR+R+LA++  +A+L    
Sbjct: 242 --LPGYEMVLKASHTFNLLDARRAISVTARQQYILRVRTLARSVAQAYLQARA 292


>gi|149912059|ref|ZP_01900650.1| glycyl-tRNA synthetase alpha subunit [Moritella sp. PE36]
 gi|149804855|gb|EDM64892.1| glycyl-tRNA synthetase alpha subunit [Moritella sp. PE36]
          Length = 303

 Score =  548 bits (1414), Expect = e-154,   Method: Composition-based stats.
 Identities = 183/301 (60%), Positives = 223/301 (74%), Gaps = 8/301 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
            +K N  +FQ +IL L  YWA+QGC I+QP+DMEVGAGT HP T LR+LGP     AYVQ
Sbjct: 1   MSKYNVKTFQGLILALQDYWARQGCAIVQPFDMEVGAGTSHPMTFLRSLGPEPMAFAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQV++KP+P N+Q LY++SLK VG+DPL+HD+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVVLKPSPANIQELYLDSLKEVGLDPLVHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME+SQFTYFQ V GIEC P++GE+TYGLERLAMY+Q V+SV
Sbjct: 121 WENPTLGAWGLGWEIWLNGMEVSQFTYFQAVGGIECKPVTGEMTYGLERLAMYIQEVDSV 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V+       V YGDIF Q+E E S YNFE+AN + L   F +SEKE   LL   +P 
Sbjct: 181 YDLVWTDGPLGTVKYGDIFHQNEVEQSTYNFEHANVDFLFTLFDESEKEAQKLLDLEVP- 239

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY++ + A H FN+LDAR  IS TERQRYILRIR+L+K   +A+  +  
Sbjct: 240 -------LPLPAYERILDAGHAFNMLDARHAISVTERQRYILRIRTLSKGVAQAYYASRE 292

Query: 305 G 305
            
Sbjct: 293 A 293


>gi|88705385|ref|ZP_01103096.1| Glycyl-tRNA synthetase alpha chain [Congregibacter litoralis KT71]
 gi|88700475|gb|EAQ97583.1| Glycyl-tRNA synthetase alpha chain [Congregibacter litoralis KT71]
          Length = 319

 Score =  548 bits (1414), Expect = e-154,   Method: Composition-based stats.
 Identities = 182/297 (61%), Positives = 222/297 (74%), Gaps = 10/297 (3%)

Query: 9   NDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRR 68
           + +SFQ +IL L Q+W +QGC ILQP DMEVGAGTFHP+T LR+LGP +W AAYVQPSRR
Sbjct: 10  DPISFQELILKLQQFWGEQGCLILQPLDMEVGAGTFHPATFLRSLGPENWNAAYVQPSRR 69

Query: 69  PLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESP 128
           P DGRY ENPNRLQHYYQFQV +KP+P   Q LYI+SL+A+GI+ LIHDVRFVEDNWESP
Sbjct: 70  PTDGRYGENPNRLQHYYQFQVAMKPSPPEFQELYIQSLEALGINTLIHDVRFVEDNWESP 129

Query: 129 TLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIV 188
           TLGAWGLGWE W +GME+SQFTYFQQ  G+EC P++GEITYGLER+AMY+Q V+SVYD++
Sbjct: 130 TLGAWGLGWEVWLNGMEVSQFTYFQQAGGMECYPVTGEITYGLERIAMYLQGVDSVYDLL 189

Query: 189 FNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHR 248
           +       VLYGD+F Q+E E SRYN+E A+ + L   F   E+E   L +  +P     
Sbjct: 190 WTRSPQGPVLYGDVFHQNEVEMSRYNYEEADVDFLFLQFDHCEREAARLTEMALP----- 244

Query: 249 HHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNG 305
                 PAY+  +KASH FNLLDAR  IS TERQRYILR+R+LA+   +A+      
Sbjct: 245 -----LPAYEMVMKASHTFNLLDARHAISVTERQRYILRVRTLARNVAQAYFDARAA 296


>gi|261379325|ref|ZP_05983898.1| glycyl-tRNA synthetase, alpha subunit [Neisseria subflava NJ9703]
 gi|284797762|gb|EFC53109.1| glycyl-tRNA synthetase, alpha subunit [Neisseria subflava NJ9703]
          Length = 299

 Score =  548 bits (1414), Expect = e-154,   Method: Composition-based stats.
 Identities = 172/296 (58%), Positives = 218/296 (73%), Gaps = 8/296 (2%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ II  L  YWA +GCT++QP+DMEVGAGT HP+T LRALGP  W AAYVQPSRRP
Sbjct: 1   MLTFQQIIFKLQNYWADKGCTVIQPFDMEVGAGTSHPATCLRALGPEPWFAAYVQPSRRP 60

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY +NPNRLQHYYQFQV +KP P N+Q+LY++SL+ +GIDP +HD+RFVED+WE+PT
Sbjct: 61  KDGRYGDNPNRLQHYYQFQVALKPAPANIQDLYLDSLRELGIDPKVHDIRFVEDDWENPT 120

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQQV GI+CSP+ GEITYG+ERLAMY+Q V +VYD+V+
Sbjct: 121 LGAWGLGWEVWLNGMEVTQFTYFQQVGGIDCSPVLGEITYGIERLAMYLQGVENVYDLVW 180

Query: 190 NAI-EGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHR 248
               +G  V YGD++ Q+E E S YNFEY++ + L   F + E++   LL          
Sbjct: 181 AKTLDGNIVTYGDVYHQNEVEQSTYNFEYSDADWLLRQFNNYEEQAKRLLA-------VE 233

Query: 249 HHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                 PAY+  +KA H FNLLDARG IS TER  YI RIR+L++   + F+ +  
Sbjct: 234 DTSLALPAYELVLKAGHTFNLLDARGAISVTERATYIGRIRALSRIVAQKFVESRE 289


>gi|294787916|ref|ZP_06753160.1| glycyl-tRNA synthetase, alpha subunit [Simonsiella muelleri ATCC
           29453]
 gi|294484209|gb|EFG31892.1| glycyl-tRNA synthetase, alpha subunit [Simonsiella muelleri ATCC
           29453]
          Length = 300

 Score =  548 bits (1413), Expect = e-154,   Method: Composition-based stats.
 Identities = 174/297 (58%), Positives = 217/297 (73%), Gaps = 8/297 (2%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ II  L  YWA+QGC I+QP+DMEVGAGT HPST LRALGP  W  AYVQPSRRP
Sbjct: 2   MLTFQQIIFKLQNYWAEQGCAIIQPFDMEVGAGTSHPSTCLRALGPEPWNVAYVQPSRRP 61

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY +NPNRLQHYYQFQV +KP P ++Q+LY+ SLK +GIDP +HD+RFVED+WE+PT
Sbjct: 62  KDGRYGDNPNRLQHYYQFQVALKPAPDDIQDLYLGSLKELGIDPTVHDIRFVEDDWENPT 121

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQQV GI+CSP+ GEITYG+ERLAMY+Q V +VYD+V+
Sbjct: 122 LGAWGLGWEVWLNGMEVTQFTYFQQVGGIDCSPVLGEITYGIERLAMYLQGVENVYDLVW 181

Query: 190 N-AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHR 248
               +G  + YGD++ Q+E E S YNFEY++ E L N F   E +   LL+         
Sbjct: 182 AITPDGSKLTYGDVYHQNEVEQSTYNFEYSDAEWLLNQFNGFEAQAKRLLE-------TE 234

Query: 249 HHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNG 305
                 PAY+  +KA H+FNLLDARG IS TER  YI RIR+L++   + F+ +   
Sbjct: 235 DAQLALPAYELVLKAGHMFNLLDARGAISVTERATYIGRIRTLSRQVAQKFVASREA 291


>gi|226327617|ref|ZP_03803135.1| hypothetical protein PROPEN_01488 [Proteus penneri ATCC 35198]
 gi|225204143|gb|EEG86497.1| hypothetical protein PROPEN_01488 [Proteus penneri ATCC 35198]
          Length = 309

 Score =  548 bits (1413), Expect = e-154,   Method: Composition-based stats.
 Identities = 183/296 (61%), Positives = 216/296 (72%), Gaps = 8/296 (2%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
             +FQ +ILTL  YWA+QGCTI+QP DMEVGAGT HP T LRALGP    AAYVQPSRRP
Sbjct: 14  PKTFQGLILTLQDYWARQGCTIVQPLDMEVGAGTSHPMTCLRALGPEPIAAAYVQPSRRP 73

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNRLQHYYQFQVIIKP+P N+Q LY+ SL+ +G+DP IHD+RFVEDNWE+PT
Sbjct: 74  TDGRYGENPNRLQHYYQFQVIIKPSPDNIQELYLGSLRELGLDPTIHDIRFVEDNWENPT 133

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLERLAMY+Q V+SVYD+V+
Sbjct: 134 LGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGLERLAMYIQGVDSVYDLVW 193

Query: 190 NAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRH 249
                    YGDI+ Q+E E S YNFEYA+ + L + F   EKE                
Sbjct: 194 CDGPLGKTTYGDIYHQNEVEQSTYNFEYADVDFLFSCFEQYEKEAR--------ELLELE 245

Query: 250 HLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNG 305
                PAY++ +KA H FNLLDAR  IS TERQRYILRIR+L KA  EA+  +   
Sbjct: 246 KPLPLPAYERILKAGHTFNLLDARKAISVTERQRYILRIRTLTKAVAEAYYASREA 301


>gi|294676754|ref|YP_003577369.1| glycyl-tRNA synthetase subunit alpha [Rhodobacter capsulatus SB
           1003]
 gi|294475574|gb|ADE84962.1| glycyl-tRNA synthetase, alpha subunit [Rhodobacter capsulatus SB
           1003]
          Length = 312

 Score =  548 bits (1413), Expect = e-154,   Method: Composition-based stats.
 Identities = 195/305 (63%), Positives = 235/305 (77%), Gaps = 2/305 (0%)

Query: 4   IHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYV 63
           +       SFQ IIL L  YW+ +GC +LQPYDMEVGAGTFHP+TTLR+LG   W AAYV
Sbjct: 1   MEKPAAPRSFQEIILRLMTYWSSKGCAVLQPYDMEVGAGTFHPATTLRSLGHQPWAAAYV 60

Query: 64  QPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVED 123
           QPSRRP DGRY ENPNRLQHYYQ+QV+IKP+P +LQ LY+ SL+A+GID  +HD+RFVED
Sbjct: 61  QPSRRPTDGRYGENPNRLQHYYQYQVLIKPSPPDLQALYLGSLEAIGIDLGLHDIRFVED 120

Query: 124 NWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNS 183
           +WESPTLGAWGLGWE WCDGME+SQFTYFQQV G +C P+SGE+TYGLERLAMYV  ++ 
Sbjct: 121 DWESPTLGAWGLGWEVWCDGMEVSQFTYFQQVGGHDCKPVSGELTYGLERLAMYVLGIDH 180

Query: 184 VYDIVFNAIEGQ-NVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGI 242
           V D+ FN       + YGDIF Q+E+EYSR+NF+ AN E+L  HF+D+E EC  LL    
Sbjct: 181 VMDMPFNDPSSPIPLKYGDIFRQTEEEYSRHNFDGANTEVLLQHFLDAEAECERLLSFPA 240

Query: 243 PNEH-HRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLM 301
            + +  +  +   PAYDQCIKASH+FNLLDARGVIS TERQ YI R+R+LAK C +AF+ 
Sbjct: 241 EDPNSGKRIVMAHPAYDQCIKASHLFNLLDARGVISVTERQAYIGRVRALAKKCADAFVT 300

Query: 302 TPNGG 306
           T  GG
Sbjct: 301 TTAGG 305


>gi|253997239|ref|YP_003049303.1| glycyl-tRNA synthetase subunit alpha [Methylotenera mobilis JLW8]
 gi|253983918|gb|ACT48776.1| glycyl-tRNA synthetase, alpha subunit [Methylotenera mobilis JLW8]
          Length = 318

 Score =  548 bits (1412), Expect = e-154,   Method: Composition-based stats.
 Identities = 170/296 (57%), Positives = 218/296 (73%), Gaps = 11/296 (3%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ IILTL +YW+ +GC +LQ YDMEVGAGT H +T LR+LGP  WKAAYVQPSRRP
Sbjct: 2   ALTFQEIILTLQKYWSDKGCALLQSYDMEVGAGTSHTATFLRSLGPEPWKAAYVQPSRRP 61

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNRLQHYYQFQV++KP P ++  LY+ SL+A+G D   +D+RFVED+WE+PT
Sbjct: 62  KDGRYGENPNRLQHYYQFQVVLKPAPADILELYLGSLEALGFDLKQNDIRFVEDDWENPT 121

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQQV GI+C PI+GEITYGLERLAMY+Q V +VYD+ +
Sbjct: 122 LGAWGLGWEVWLNGMEVTQFTYFQQVGGIDCKPITGEITYGLERLAMYLQGVENVYDLTW 181

Query: 190 N-AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHR 248
                G+ + YGD++ Q+EQE S YNFE+++ + L   F   EK+   L+   +      
Sbjct: 182 TVDANGKALSYGDVYLQNEQEQSAYNFEHSDADFLFTAFNAHEKQAKHLMDNQL------ 235

Query: 249 HHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                 PAY+Q +KA+H FNLLDARG IS TER  YI RIR+LA++   ++L +  
Sbjct: 236 ----ALPAYEQVLKAAHTFNLLDARGAISVTERAGYIGRIRNLARSVAASYLDSRA 287


>gi|254525330|ref|ZP_05137385.1| glycyl-tRNA synthetase, alpha subunit [Stenotrophomonas sp. SKA14]
 gi|219722921|gb|EED41446.1| glycyl-tRNA synthetase, alpha subunit [Stenotrophomonas sp. SKA14]
          Length = 303

 Score =  548 bits (1412), Expect = e-154,   Method: Composition-based stats.
 Identities = 182/296 (61%), Positives = 226/296 (76%), Gaps = 11/296 (3%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            ++FQ +I TL Q+WAQQGC ++QP D+EVGAGTFHP+T LRA+GP  W AAYVQPSRRP
Sbjct: 8   PITFQGLIQTLNQFWAQQGCVLIQPLDLEVGAGTFHPATFLRAIGPEGWNAAYVQPSRRP 67

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNRLQ YYQ+QV +KP P N+Q LY++SLKA+GIDPL+HD+RFVEDNWESPT
Sbjct: 68  TDGRYGENPNRLQRYYQYQVAMKPAPDNIQQLYLDSLKALGIDPLVHDLRFVEDNWESPT 127

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQQ  G+EC P+ GEITYGLERL MY+QN ++VYD+V+
Sbjct: 128 LGAWGLGWEVWLNGMEVTQFTYFQQAGGLECRPVLGEITYGLERLCMYLQNCDNVYDLVW 187

Query: 190 N-AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHR 248
               +GQ V YGD++ Q+E E S YNFEYA+ E L + F   E+E   L++  +P     
Sbjct: 188 TYGPDGQPVTYGDVYHQNEVEQSTYNFEYADVEELFHRFDACEREAQKLVEVNLP----- 242

Query: 249 HHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                 PAY+Q +KASH FNLLDAR  IS TERQRYILR+R+LA+A  +A+     
Sbjct: 243 -----LPAYEQVMKASHTFNLLDARRAISVTERQRYILRVRALAQAVAKAYYEQRE 293


>gi|33603063|ref|NP_890623.1| glycyl-tRNA synthetase subunit alpha [Bordetella bronchiseptica
           RB50]
 gi|33568694|emb|CAE34452.1| glycyl-tRNA synthetase alpha chain [Bordetella bronchiseptica RB50]
          Length = 324

 Score =  547 bits (1411), Expect = e-154,   Method: Composition-based stats.
 Identities = 176/296 (59%), Positives = 219/296 (73%), Gaps = 11/296 (3%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ IILTL  YW +QGC +LQPYDMEVGAGT H +T LRA+GP  W+AAYVQPSRRP
Sbjct: 22  MLTFQQIILTLQDYWDKQGCALLQPYDMEVGAGTSHTATFLRAIGPEPWRAAYVQPSRRP 81

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNRLQHYYQ+QV++KP P  + +LYI SLKA+GIDP  HD+RFVED+WE+PT
Sbjct: 82  KDGRYGENPNRLQHYYQYQVVLKPAPPEILDLYIGSLKALGIDPTQHDIRFVEDDWENPT 141

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQQV G++C+P +GEITYGLERLAMY+Q+V SVYD+V+
Sbjct: 142 LGAWGLGWEVWLNGMEVTQFTYFQQVGGLDCTPTTGEITYGLERLAMYLQDVESVYDLVW 201

Query: 190 N-AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHR 248
                G  V Y D+F Q+E E S YNFE+A+ ++L  HF D E E   L+          
Sbjct: 202 TEGANGNRVYYRDVFHQNEVEQSTYNFEHASADMLFAHFNDYEAEAKRLMD--------- 252

Query: 249 HHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                 PAY+  +KA+H FN+LDARG IS TER  YI RIR+L++A  +A+  +  
Sbjct: 253 -VPLALPAYEAALKAAHTFNMLDARGAISVTERAAYIGRIRNLSRAVAQAYYDSRE 307


>gi|73540215|ref|YP_294735.1| glycyl-tRNA synthetase subunit alpha [Ralstonia eutropha JMP134]
 gi|72117628|gb|AAZ59891.1| Glycyl-tRNA synthetase, alpha subunit [Ralstonia eutropha JMP134]
          Length = 322

 Score =  547 bits (1411), Expect = e-154,   Method: Composition-based stats.
 Identities = 170/301 (56%), Positives = 218/301 (72%), Gaps = 5/301 (1%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ +ILTL  YW +QGC +LQP D+EVGAGT H  T LRA+GP  W+AAYVQPSRRP
Sbjct: 11  MLTFQQMILTLQAYWDRQGCALLQPIDLEVGAGTSHVHTFLRAIGPEPWRAAYVQPSRRP 70

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNRLQHYYQ+QV++KP P N+  LY+ SL+A+G+D   +D+RFVED+WE+PT
Sbjct: 71  KDGRYGENPNRLQHYYQYQVVLKPAPENILELYLGSLEALGLDLKQNDIRFVEDDWENPT 130

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQQV GI+C PI+GEITYG+ERLAMY+Q V +VYD+V+
Sbjct: 131 LGAWGLGWEVWLNGMEVTQFTYFQQVGGIDCKPITGEITYGIERLAMYLQKVENVYDLVW 190

Query: 190 NAIEGQN----VLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLL-KKGIPN 244
              +       + YGD++ Q+E E S YNFE++N EIL  HF + E E   L+   G   
Sbjct: 191 TEWQENGETRRLTYGDVYHQNEVEQSTYNFEHSNTEILFRHFAEHEGEAKRLMGDTGTDG 250

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
           +         PAY+Q +KA+H FNLLDARG IS TER  YI RIR+L++   +A+  +  
Sbjct: 251 QTATGTRLALPAYEQVLKAAHTFNLLDARGAISVTERAAYIGRIRNLSRQVAQAYYDSRE 310

Query: 305 G 305
            
Sbjct: 311 A 311


>gi|33598169|ref|NP_885812.1| glycyl-tRNA synthetase subunit alpha [Bordetella parapertussis
           12822]
 gi|33566727|emb|CAE38938.1| glycyl-tRNA synthetase alpha chain [Bordetella parapertussis]
          Length = 324

 Score =  547 bits (1411), Expect = e-154,   Method: Composition-based stats.
 Identities = 176/296 (59%), Positives = 219/296 (73%), Gaps = 11/296 (3%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ IILTL  YW +QGC +LQPYDMEVGAGT H +T LRA+GP  W+AAYVQPSRRP
Sbjct: 22  MLTFQQIILTLQDYWDKQGCALLQPYDMEVGAGTSHTATFLRAIGPEPWRAAYVQPSRRP 81

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNRLQHYYQ+QV++KP P  + +LYI SLKA+GIDP  HD+RFVED+WE+PT
Sbjct: 82  KDGRYGENPNRLQHYYQYQVVLKPAPPEILDLYIGSLKALGIDPTQHDIRFVEDDWENPT 141

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQQV G++C+P +GEITYGLERLAMY+Q+V SVYD+V+
Sbjct: 142 LGAWGLGWEVWLNGMEVTQFTYFQQVGGLDCTPTTGEITYGLERLAMYLQDVESVYDLVW 201

Query: 190 N-AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHR 248
                G  V Y D+F Q+E E S YNFE+A+ ++L  HF D E E   L+          
Sbjct: 202 TEGANGNRVYYRDVFHQNEVEQSTYNFEHASADMLFAHFNDYEAEAKRLMD--------- 252

Query: 249 HHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                 PAY+  +KA+H FN+LDARG IS TER  YI RIR+L++A  +A+  +  
Sbjct: 253 -VPLALPAYEAALKAAHTFNMLDARGAISVTERTAYIGRIRNLSRAVAQAYYDSRE 307


>gi|290473326|ref|YP_003466192.1| glycine tRNA synthetase subunit alpha [Xenorhabdus bovienii
           SS-2004]
 gi|289172625|emb|CBJ79394.1| glycine tRNA synthetase, alpha subunit [Xenorhabdus bovienii
           SS-2004]
          Length = 302

 Score =  547 bits (1411), Expect = e-154,   Method: Composition-based stats.
 Identities = 183/301 (60%), Positives = 221/301 (73%), Gaps = 8/301 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +ILTL  YWA+QGCTI+QP DMEVGAGT HP T LRALGP    AAYVQ
Sbjct: 1   MQKFDTKTFQGLILTLQDYWARQGCTIVQPLDMEVGAGTSHPMTCLRALGPEPIAAAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQVIIKP+P N+Q LY+ SLKA+G+DP +HD+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVIIKPSPDNIQELYLGSLKALGLDPTVHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GE+TYGLERLAMY+Q V+SV
Sbjct: 121 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEVTYGLERLAMYIQGVDSV 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V++        YGDI+ Q+E E S YNFE+A+ + L   F   EKE  +LL    P 
Sbjct: 181 YDLVWSDGPLGKTTYGDIYHQNEVEQSTYNFEHADVDFLFTCFEQYEKEAQELLALEAPL 240

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                       Y++ +KA H FNLLDAR  IS TERQRYILRIR+L K+  EA+  +  
Sbjct: 241 PLPA--------YERILKAGHTFNLLDARKAISVTERQRYILRIRTLTKSVAEAYYASRE 292

Query: 305 G 305
            
Sbjct: 293 A 293


>gi|332980879|ref|YP_004462320.1| glycyl-tRNA synthetase alpha chain [Mahella australiensis 50-1 BON]
 gi|332698557|gb|AEE95498.1| glycyl-tRNA synthetase alpha chain [Mahella australiensis 50-1 BON]
          Length = 293

 Score =  547 bits (1411), Expect = e-154,   Method: Composition-based stats.
 Identities = 163/294 (55%), Positives = 220/294 (74%), Gaps = 14/294 (4%)

Query: 11  LSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPL 70
           ++FQ+IILTL ++W+ +GC ++QPYD+E GAGT +P+T LRALGP  W+ AYV+PSRRP 
Sbjct: 1   MNFQDIILTLQRFWSSKGCALMQPYDIEKGAGTMNPATFLRALGPEPWRVAYVEPSRRPK 60

Query: 71  DGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTL 130
           DGRY +NPNRL  ++QFQV+IKP+P N+Q LY++SL+A+GI+   HDVRFVEDNWESPTL
Sbjct: 61  DGRYGDNPNRLYQHHQFQVVIKPSPDNIQELYLDSLRALGIELEKHDVRFVEDNWESPTL 120

Query: 131 GAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFN 190
           GAWGLGWE W DGMEI+QFTYFQQV  I+C P+S EITYGLER+AMY+Q+ ++VYDI + 
Sbjct: 121 GAWGLGWEVWLDGMEITQFTYFQQVGSIDCRPVSVEITYGLERIAMYIQDKDNVYDIQWV 180

Query: 191 AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHH 250
                ++ YGDIF ++E E+S+YNFE ++ ++L   F   EKE   L+++G+        
Sbjct: 181 ----DDISYGDIFHRAEWEHSKYNFECSDVDMLTQLFEIYEKESYRLVEEGL-------- 228

Query: 251 LCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
             + PAYD  +K SH FNLLDARG IS +ER  YI R+R++A+ C   ++    
Sbjct: 229 --LLPAYDYVLKCSHTFNLLDARGAISVSERASYIGRVRNMARRCARLYIKQRE 280


>gi|54294728|ref|YP_127143.1| glycyl-tRNA synthetase subunit alpha [Legionella pneumophila str.
           Lens]
 gi|54297753|ref|YP_124122.1| glycyl-tRNA synthetase subunit alpha [Legionella pneumophila str.
           Paris]
 gi|148359387|ref|YP_001250594.1| glycyl tRNA synthetase subunit alpha [Legionella pneumophila str.
           Corby]
 gi|296107433|ref|YP_003619133.1| glycyl-tRNA synthetase alpha chain [Legionella pneumophila 2300/99
           Alcoy]
 gi|53751538|emb|CAH12956.1| glycyl-tRNA synthetase alpha chain [Legionella pneumophila str.
           Paris]
 gi|53754560|emb|CAH16044.1| glycyl-tRNA synthetase alpha chain [Legionella pneumophila str.
           Lens]
 gi|148281160|gb|ABQ55248.1| glycyl tRNA synthetase, alpha subunit [Legionella pneumophila str.
           Corby]
 gi|295649334|gb|ADG25181.1| glycyl-tRNA synthetase alpha chain [Legionella pneumophila 2300/99
           Alcoy]
 gi|307610543|emb|CBX00129.1| glycyl-tRNA synthetase alpha chain [Legionella pneumophila 130b]
          Length = 301

 Score =  547 bits (1411), Expect = e-154,   Method: Composition-based stats.
 Identities = 175/299 (58%), Positives = 219/299 (73%), Gaps = 10/299 (3%)

Query: 7   KKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPS 66
                +FQ IILTL +YW+  GC ILQP D+EVGAGTFHP+T LRA+GP  W AAYVQPS
Sbjct: 1   MTKPTTFQEIILTLQKYWSDLGCVILQPLDLEVGAGTFHPATFLRAIGPEPWSAAYVQPS 60

Query: 67  RRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWE 126
           RRP DGRY ENPNR+QHYYQFQV++KP+PL++Q+ Y++SL+A+G+DPL+ D+RFVEDNWE
Sbjct: 61  RRPTDGRYGENPNRVQHYYQFQVVLKPSPLDIQDRYLDSLRALGVDPLLDDIRFVEDNWE 120

Query: 127 SPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYD 186
           SPTLGAWGLGWE W +GME+SQFTYFQQV G+ C PI+GE+TYGLER+AM+V  V++++D
Sbjct: 121 SPTLGAWGLGWEVWQNGMEVSQFTYFQQVGGLVCKPITGELTYGLERIAMFVLGVDNLFD 180

Query: 187 IVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEH 246
           + +       V YGD+F Q+E E S YNFE+AN E L   F   E E   L+   +P   
Sbjct: 181 LPWCKTANGIVTYGDVFHQNEVEMSAYNFEHANVEELFKQFDYYEGEAQKLIALQLP--- 237

Query: 247 HRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNG 305
                   PAY+  IKASH FNLLDAR  IS TERQRYILR+R L++A  +A+      
Sbjct: 238 -------LPAYEMVIKASHTFNLLDARKAISVTERQRYILRVRHLSRAVAQAYYQAREA 289


>gi|34497109|ref|NP_901324.1| glycyl-tRNA synthetase subunit alpha [Chromobacterium violaceum
           ATCC 12472]
 gi|34102966|gb|AAQ59330.1| glycyl-tRNA synthetase, alpha chain [Chromobacterium violaceum ATCC
           12472]
          Length = 306

 Score =  547 bits (1410), Expect = e-154,   Method: Composition-based stats.
 Identities = 172/302 (56%), Positives = 217/302 (71%), Gaps = 11/302 (3%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
            N    L+FQ IILTL  YW +QGC +LQPYD EVGAGT H +T LRALGP  W AAYVQ
Sbjct: 6   SNTTFMLTFQEIILTLQHYWNRQGCALLQPYDTEVGAGTSHTATFLRALGPEPWNAAYVQ 65

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRL  ++QFQV++KP+P N+Q LY+ SL+ +G+DP + D+RFVEDN
Sbjct: 66  PSRRPKDGRYGENPNRLFQHHQFQVVLKPSPSNIQELYLGSLQELGLDPTVQDIRFVEDN 125

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G++C P+ GEITYGLERLAMY+Q V +V
Sbjct: 126 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLDCKPVLGEITYGLERLAMYLQGVENV 185

Query: 185 YDIVFNA-IEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIP 243
           YD+++    +GQ V YG++F Q+E E S+Y FE++N E+L   F D E E   LL+  +P
Sbjct: 186 YDLIWTHLPDGQPVTYGNVFYQNEVEQSKYAFEHSNVELLFRQFNDYEAEAKKLLEASLP 245

Query: 244 NEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTP 303
                      PAY+  +KA H FNLLDARG IS TER  YI RIR+L++   +A+    
Sbjct: 246 ----------LPAYEMILKAGHTFNLLDARGSISVTERAAYIGRIRNLSRGVAQAYYDAR 295

Query: 304 NG 305
             
Sbjct: 296 EA 297


>gi|197286683|ref|YP_002152555.1| glycyl-tRNA synthetase subunit alpha [Proteus mirabilis HI4320]
 gi|227355125|ref|ZP_03839536.1| glycyl-tRNA synthetase alpha subunit [Proteus mirabilis ATCC 29906]
 gi|238693194|sp|B4EZ94|SYGA_PROMH RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|194684170|emb|CAR45625.1| glycyl-tRNA synthetase alpha subunit [Proteus mirabilis HI4320]
 gi|227164912|gb|EEI49759.1| glycyl-tRNA synthetase alpha subunit [Proteus mirabilis ATCC 29906]
          Length = 301

 Score =  547 bits (1410), Expect = e-154,   Method: Composition-based stats.
 Identities = 184/301 (61%), Positives = 218/301 (72%), Gaps = 8/301 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +ILTL  YWA+QGCTI+QP DMEVGAGT HP T LRALGP    AAYVQ
Sbjct: 1   MQKFDTKTFQGLILTLQDYWARQGCTIVQPLDMEVGAGTSHPMTCLRALGPEPIAAAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQVIIKP+P N+Q LY+ SL+ +G+DP IHD+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVIIKPSPDNIQELYLGSLRELGLDPTIHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLERLAMY+Q V+SV
Sbjct: 121 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGLERLAMYIQGVDSV 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V+         YGDI+ Q+E E S YNFEYA+ + L + F   EKE           
Sbjct: 181 YDLVWCDGPLGKTTYGDIYHQNEVEQSTYNFEYADVDFLFSCFEQYEKEAR--------E 232

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY++ +KA H FNLLDAR  IS TERQRYILRIR+L KA  EA+  +  
Sbjct: 233 LLELEKPLPLPAYERILKAGHTFNLLDARKAISVTERQRYILRIRTLTKAVAEAYYASRE 292

Query: 305 G 305
            
Sbjct: 293 A 293


>gi|238022195|ref|ZP_04602621.1| hypothetical protein GCWU000324_02102 [Kingella oralis ATCC 51147]
 gi|237866809|gb|EEP67851.1| hypothetical protein GCWU000324_02102 [Kingella oralis ATCC 51147]
          Length = 300

 Score =  547 bits (1410), Expect = e-154,   Method: Composition-based stats.
 Identities = 170/297 (57%), Positives = 213/297 (71%), Gaps = 8/297 (2%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ II  L QYWA QGC I+QP+DMEVGAGT HP+T LRALGP  W  AYVQPSRRP
Sbjct: 1   MLTFQQIIFKLQQYWANQGCAIIQPFDMEVGAGTSHPATCLRALGPEPWNVAYVQPSRRP 60

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY +NPNRLQHYYQFQV +KP P ++Q+LY+ SLK +GIDP +HD+RFVED+WE+PT
Sbjct: 61  KDGRYGDNPNRLQHYYQFQVALKPAPADIQDLYLGSLKELGIDPTVHDIRFVEDDWENPT 120

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQQV GI+C+P+ GEITYG+ERLAMY+Q V +VYD+++
Sbjct: 121 LGAWGLGWEVWLNGMEVTQFTYFQQVGGIDCTPVLGEITYGIERLAMYLQGVENVYDLMW 180

Query: 190 NAIE-GQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHR 248
                G  + YGD++ Q+E E S YNFEY++   L   F   E +   LL     +    
Sbjct: 181 TTTPAGDTLTYGDVYHQNEVEQSTYNFEYSDAAWLLEQFNGYEAQAKRLLALEDAS---- 236

Query: 249 HHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNG 305
                 PAY+  +KA H FNLLDARG IS TER  YI RIR+L++   + F+ +   
Sbjct: 237 ---LALPAYELVLKAGHTFNLLDARGAISVTERATYIGRIRALSRQVAQEFVASREA 290


>gi|312898537|ref|ZP_07757927.1| glycyl-tRNA synthetase, alpha subunit [Megasphaera micronuciformis
           F0359]
 gi|310620456|gb|EFQ04026.1| glycyl-tRNA synthetase, alpha subunit [Megasphaera micronuciformis
           F0359]
          Length = 291

 Score =  547 bits (1410), Expect = e-154,   Method: Composition-based stats.
 Identities = 163/294 (55%), Positives = 211/294 (71%), Gaps = 14/294 (4%)

Query: 11  LSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPL 70
           ++FQ++I  L ++W+ QGC I +PYD+E GAGT +P+T LR LGP  W  AYV+PSRRP 
Sbjct: 1   MNFQDMIFALKKFWSSQGCIIQEPYDVEKGAGTMNPATFLRTLGPEPWHVAYVEPSRRPA 60

Query: 71  DGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTL 130
           DGRY +NPNRL  ++QFQVI KP+P N+Q LY++SL+ +GI+P  HD+RFVEDNWESPTL
Sbjct: 61  DGRYGDNPNRLYQHHQFQVICKPSPDNIQELYLQSLEVLGINPKEHDIRFVEDNWESPTL 120

Query: 131 GAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFN 190
           GAWGLGWE W DGMEI+QFTYFQQV GI+  P+S EITYG+ERLAMY+Q V +VYD+ + 
Sbjct: 121 GAWGLGWEVWLDGMEITQFTYFQQVGGIDVKPVSSEITYGMERLAMYIQGVENVYDLEWT 180

Query: 191 AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHH 250
                 V YGDIF Q+E E S Y FE ++ ++L   F   EKE L  ++KG         
Sbjct: 181 ----DGVTYGDIFHQNEFEQSSYAFEISDSDMLFTLFDMYEKEALRTIEKGF-------- 228

Query: 251 LCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
             V PAYD  +K SH FNLLDARG IS +ER  +I R+R++++AC +A+L    
Sbjct: 229 --VLPAYDYVLKCSHAFNLLDARGAISVSERAAFIGRVRNMSRACAKAYLAERE 280


>gi|83719677|ref|YP_441142.1| glycyl-tRNA synthetase subunit alpha [Burkholderia thailandensis
           E264]
 gi|83653502|gb|ABC37565.1| glycyl-tRNA synthetase, alpha chain [Burkholderia thailandensis
           E264]
          Length = 390

 Score =  547 bits (1410), Expect = e-154,   Method: Composition-based stats.
 Identities = 170/310 (54%), Positives = 215/310 (69%), Gaps = 18/310 (5%)

Query: 3   PIHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAY 62
           P   +   L+FQ IILTL  YW +QGC +LQP DMEVGAGT H  T LRA+GP  W+AAY
Sbjct: 49  PAPRRPLMLTFQQIILTLQSYWDRQGCALLQPIDMEVGAGTSHVHTFLRAIGPEPWRAAY 108

Query: 63  VQPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVE 122
           VQPSRRP DGRY ENPNRLQHYYQ+QV++KP P N+ +LY+ SL A+G D   +DVRFVE
Sbjct: 109 VQPSRRPKDGRYGENPNRLQHYYQYQVVLKPAPENILDLYLGSLAALGFDLKQNDVRFVE 168

Query: 123 DNWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVN 182
           D+WE+PTLGAWGLGWE W +GME++QFTYFQQV G++C P+ GEITYGLERLAMY+Q V 
Sbjct: 169 DDWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLDCKPVLGEITYGLERLAMYLQKVE 228

Query: 183 SVYDIVF--------NAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKEC 234
           +VYD+++        N  E + + YGD++ Q+E E S YNFE AN E+L   F   E E 
Sbjct: 229 NVYDLIWTEWEEQGPNGPEIRRLTYGDVYHQNEVEQSTYNFEQANVELLFTFFNSYEAEA 288

Query: 235 LDLLKKGIPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKA 294
             +++  +            PAY+  +KA H FNLLDARG IS TER  YI RIR+L++ 
Sbjct: 289 KRMIEAQL----------ALPAYELVLKAGHTFNLLDARGAISVTERAAYIGRIRALSRL 338

Query: 295 CGEAFLMTPN 304
             +A+  +  
Sbjct: 339 VAQAYYDSRE 348


>gi|94498279|ref|ZP_01304839.1| Glycine--tRNA ligase [Sphingomonas sp. SKA58]
 gi|94422281|gb|EAT07322.1| Glycine--tRNA ligase [Sphingomonas sp. SKA58]
          Length = 319

 Score =  547 bits (1410), Expect = e-154,   Method: Composition-based stats.
 Identities = 187/300 (62%), Positives = 227/300 (75%), Gaps = 13/300 (4%)

Query: 2   APIHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAA 61
            P       LSFQ++ILTL  YW +QGC ILQPYDMEVGAGTFHP+TTLR+LGP +W AA
Sbjct: 13  GPSVATSKALSFQDLILTLHAYWGKQGCVILQPYDMEVGAGTFHPATTLRSLGPDAWNAA 72

Query: 62  YVQPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFV 121
           YVQPSRRP DGRY ENPNRLQHYYQ+QVI+KP+P NLQ LY+ SL  +GIDPL+HD+RFV
Sbjct: 73  YVQPSRRPTDGRYGENPNRLQHYYQYQVIMKPSPANLQELYLGSLVEIGIDPLVHDIRFV 132

Query: 122 EDNWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNV 181
           ED+WESPTLGAWGLGWE WCDGME++QFTYFQQ+ G +C P++GE+TYGLERLAMY+Q V
Sbjct: 133 EDDWESPTLGAWGLGWEVWCDGMEVTQFTYFQQMGGFDCKPVAGELTYGLERLAMYIQGV 192

Query: 182 NSVYDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKG 241
           +SVYD+ FN      V YGD+F ++E++ S++NFE A+ + L   F D+E EC   L+ G
Sbjct: 193 DSVYDLKFNDA---GVTYGDVFLENERQMSKWNFEVADTDKLLRWFKDAEAECKASLEAG 249

Query: 242 IPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLM 301
           +P            AYDQ IKASH+FNLL ARGVIS  ER  YI R+R LAK   E ++ 
Sbjct: 250 VP----------LAAYDQAIKASHVFNLLQARGVISVQERASYIGRVRDLAKGSCEKWME 299


>gi|58584022|ref|YP_203038.1| glycyl-tRNA synthetase subunit alpha [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|58428616|gb|AAW77653.1| glycyl-tRNA synthetase alpha chain [Xanthomonas oryzae pv. oryzae
           KACC10331]
          Length = 346

 Score =  547 bits (1410), Expect = e-154,   Method: Composition-based stats.
 Identities = 178/300 (59%), Positives = 224/300 (74%), Gaps = 11/300 (3%)

Query: 6   NKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQP 65
           +++  ++FQ +I TL QYWA+QGC ++QP D+EVGAGTFHP+T LRALGP  W AAYVQP
Sbjct: 48  SRRVPITFQGLIQTLNQYWAEQGCVLIQPLDLEVGAGTFHPATFLRALGPEPWNAAYVQP 107

Query: 66  SRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNW 125
           SRRP DGRY ENPNRLQ YYQ+QV +KPNP N+Q+LY+ SL+A+GIDPL+HD+RFVEDNW
Sbjct: 108 SRRPTDGRYGENPNRLQRYYQYQVAMKPNPDNIQDLYLGSLQALGIDPLVHDLRFVEDNW 167

Query: 126 ESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVY 185
           ESPTLGAWG+GWE W +GME++QFTYFQQ  G+EC P+ GEITYGLERL MY+Q  ++VY
Sbjct: 168 ESPTLGAWGVGWEVWLNGMEVTQFTYFQQAGGLECKPVLGEITYGLERLCMYLQRCDNVY 227

Query: 186 DIVFN-AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
            +V+    +G  V YGD++ Q+E E S YNFE+AN   L + F   E E   L++ G+P 
Sbjct: 228 ALVWTYGPDGAAVTYGDVYHQNEVEQSTYNFEHANVAELFHRFDACEAEAKHLVEVGLP- 286

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY+Q  KASH FNLLDAR  IS TERQRYILR+R+LA+   +A+     
Sbjct: 287 ---------LPAYEQVTKASHAFNLLDARRAISVTERQRYILRVRALAQGVAQAYYAQRE 337


>gi|238917997|ref|YP_002931511.1| glycyl-tRNA synthetase subunit alpha [Edwardsiella ictaluri 93-146]
 gi|269137371|ref|YP_003294071.1| glycyl-tRNA synthetase, alpha subunit [Edwardsiella tarda EIB202]
 gi|259511908|sp|C5B996|SYGA_EDWI9 RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|238867565|gb|ACR67276.1| glycyl-tRNA synthetase, alpha subunit, putative [Edwardsiella
           ictaluri 93-146]
 gi|267983031|gb|ACY82860.1| glycyl-tRNA synthetase, alpha subunit [Edwardsiella tarda EIB202]
 gi|304557472|gb|ADM40136.1| Glycyl-tRNA synthetase alpha chain [Edwardsiella tarda FL6-60]
          Length = 302

 Score =  547 bits (1410), Expect = e-153,   Method: Composition-based stats.
 Identities = 183/301 (60%), Positives = 219/301 (72%), Gaps = 8/301 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +ILTL  YWA+QGCTI+QP DMEVGAGT HP T LRALGP     AYVQ
Sbjct: 1   MQKFDIKTFQGLILTLQDYWARQGCTIVQPLDMEVGAGTSHPMTCLRALGPEPMATAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQV+IKP+P N+Q LY+ SLKA+G+DP +HD+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVVIKPSPDNIQELYLGSLKALGLDPTVHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLERLAMY+Q V+SV
Sbjct: 121 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGLERLAMYIQGVDSV 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V++        YGD+F Q+E E S YNFEYA+ + L   F   EKE           
Sbjct: 181 YDLVWSDGPLGKTTYGDVFHQNEVEQSTYNFEYADVDFLFACFEQYEKEAR--------M 232

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                H    PAY++ +KA+H FNLLDAR  IS TERQRYILRIR+L K   EA+  +  
Sbjct: 233 LLELEHPLPLPAYERILKAAHSFNLLDARKAISVTERQRYILRIRTLTKMVAEAYYASRE 292

Query: 305 G 305
            
Sbjct: 293 A 293


>gi|285016899|ref|YP_003374610.1| glycyl-tRNA synthetase alpha chain protein [Xanthomonas albilineans
           GPE PC73]
 gi|283472117|emb|CBA14624.1| probable glycyl-trna synthetase alpha chain protein [Xanthomonas
           albilineans]
          Length = 302

 Score =  546 bits (1409), Expect = e-153,   Method: Composition-based stats.
 Identities = 180/300 (60%), Positives = 226/300 (75%), Gaps = 11/300 (3%)

Query: 6   NKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQP 65
           ++   ++FQ +I TL Q+WAQ GC ++QP D+EVGAGTFHP+T LRALGP  W AAYVQP
Sbjct: 4   SRSVPITFQGLIQTLNQFWAQHGCVLIQPLDLEVGAGTFHPATFLRALGPEPWNAAYVQP 63

Query: 66  SRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNW 125
           SRRP DGRY ENPNRLQ YYQ+QV +KPNP N+Q LY++SL+A+GIDPL+HD+RFVEDNW
Sbjct: 64  SRRPTDGRYGENPNRLQRYYQYQVAMKPNPDNIQQLYLDSLRALGIDPLVHDLRFVEDNW 123

Query: 126 ESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVY 185
           ESPTLGAWGLGWE W +GME++QFTYFQQ  G+EC P+ GEITYGLERL MY+QN ++VY
Sbjct: 124 ESPTLGAWGLGWEVWLNGMEVTQFTYFQQAGGLECKPVLGEITYGLERLCMYLQNCDNVY 183

Query: 186 DIVFN-AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           D+++    +G  V YGD++ Q+E E S YNFE+AN   L + F   E+E   L++ G+P 
Sbjct: 184 DLIWTYGPDGTPVTYGDVYHQNEVEQSAYNFEHANVAELFHRFDACEREAQALVEVGLP- 242

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY+Q  KASH FNLLDAR  IS TERQRYILR+R+LA+A  +A+     
Sbjct: 243 ---------LPAYEQVTKASHAFNLLDARRAISVTERQRYILRVRALAQAVAKAYYAQRE 293


>gi|121603357|ref|YP_980686.1| glycyl-tRNA synthetase subunit alpha [Polaromonas naphthalenivorans
           CJ2]
 gi|166200234|sp|A1VJD7|SYGA_POLNA RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|120592326|gb|ABM35765.1| glycyl-tRNA synthetase alpha chain [Polaromonas naphthalenivorans
           CJ2]
          Length = 308

 Score =  546 bits (1409), Expect = e-153,   Method: Composition-based stats.
 Identities = 169/295 (57%), Positives = 215/295 (72%), Gaps = 14/295 (4%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ IIL L  YWA QGC +LQPYDMEVGAGT H +T LRALGP  WKAAYVQPSRRP
Sbjct: 1   MLTFQQIILKLQSYWADQGCALLQPYDMEVGAGTSHTATFLRALGPEPWKAAYVQPSRRP 60

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNRLQHYYQ+QV++KP P N+  LY+ SL+A+G D   +D+RFVED+WE+PT
Sbjct: 61  KDGRYGENPNRLQHYYQYQVVLKPAPANILELYLGSLEALGFDLKKNDIRFVEDDWENPT 120

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQQV GI+C P +GEITYGLERLAMY+Q V++VY++ +
Sbjct: 121 LGAWGLGWEVWLNGMEVTQFTYFQQVGGIDCKPATGEITYGLERLAMYLQGVDNVYNLTW 180

Query: 190 NAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRH 249
                  + YGD++ Q+E E S YNFE+++ + L   F   EK+   L+++ +       
Sbjct: 181 T----DGLTYGDVYKQNEVEQSTYNFEHSDTDFLFTAFSAHEKQAKHLVEQQL------- 229

Query: 250 HLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                PAY+Q +KA H FNLLDARG IS TER  YI RIR+LA+A  +++  +  
Sbjct: 230 ---ALPAYEQVLKAGHSFNLLDARGAISVTERAAYIGRIRNLARAVAQSYYESRE 281


>gi|134093653|ref|YP_001098728.1| glycyl-tRNA synthetase subunit alpha [Herminiimonas arsenicoxydans]
 gi|166200226|sp|A4G262|SYGA_HERAR RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|133737556|emb|CAL60599.1| glycine tRNA synthetase, alpha subunit (Glycine--tRNA ligase alpha
           chain) (GlyRS) [Herminiimonas arsenicoxydans]
          Length = 305

 Score =  546 bits (1408), Expect = e-153,   Method: Composition-based stats.
 Identities = 171/295 (57%), Positives = 219/295 (74%), Gaps = 14/295 (4%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ IILTL +YW  QGC +LQPYDMEVGAGT H +T LR++GP  WKAAYVQPSRRP
Sbjct: 1   MLTFQQIILTLQKYWDAQGCALLQPYDMEVGAGTSHTATFLRSIGPEPWKAAYVQPSRRP 60

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNRLQHYYQFQV++KP P N+  LY+ SL+A+G D   +D+RFVED+WE+PT
Sbjct: 61  KDGRYGENPNRLQHYYQFQVVLKPAPANILELYLGSLEALGFDLKANDIRFVEDDWENPT 120

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQQV GI C PI+GEITYGLERLAMY+Q V++VYD+ +
Sbjct: 121 LGAWGLGWEVWLNGMEVTQFTYFQQVGGINCKPITGEITYGLERLAMYLQGVDNVYDLKW 180

Query: 190 NAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRH 249
                + + YGD++ Q+E E S YNFE+++ + L   F   EK+ L+L++  +       
Sbjct: 181 T----EGLSYGDVYKQNEIEQSTYNFEHSDADFLFTAFGAHEKQALNLIENKL------- 229

Query: 250 HLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                PAY+Q +KA+H FNLLDARG IS TER  YI RIR+LA++   ++L +  
Sbjct: 230 ---ALPAYEQVLKAAHTFNLLDARGAISVTERAAYIGRIRNLARSVARSYLDSRA 281


>gi|194367755|ref|YP_002030365.1| glycyl-tRNA synthetase subunit alpha [Stenotrophomonas maltophilia
           R551-3]
 gi|238693456|sp|B4SNR2|SYGA_STRM5 RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|194350559|gb|ACF53682.1| glycyl-tRNA synthetase, alpha subunit [Stenotrophomonas maltophilia
           R551-3]
          Length = 303

 Score =  546 bits (1408), Expect = e-153,   Method: Composition-based stats.
 Identities = 182/296 (61%), Positives = 227/296 (76%), Gaps = 11/296 (3%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            ++FQ +I TL Q+WAQQGC ++QP D+EVGAGTFHP+T LRA+GP SW AAYVQPSRRP
Sbjct: 8   PITFQGLIQTLNQFWAQQGCVLIQPLDLEVGAGTFHPATFLRAIGPESWNAAYVQPSRRP 67

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNRLQ YYQ+QV +KP P N+Q LY++SLKA+GIDPL+HD+RFVEDNWESPT
Sbjct: 68  TDGRYGENPNRLQRYYQYQVAMKPAPDNIQQLYLDSLKALGIDPLVHDLRFVEDNWESPT 127

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQQ  G+EC P+ GEITYGLERL MY+QN ++VYD+V+
Sbjct: 128 LGAWGLGWEVWLNGMEVTQFTYFQQAGGLECRPVLGEITYGLERLCMYLQNCDNVYDLVW 187

Query: 190 N-AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHR 248
               +GQ V YGD++ Q+E E S YNFEYA+ E + + F   E+E   L++  +P     
Sbjct: 188 TYGPDGQPVTYGDVYHQNEVEQSTYNFEYADVEEMFHRFDACEREAQKLVEVNLP----- 242

Query: 249 HHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                 PAY+Q +KASH FNLLDAR  IS TERQRYILR+R+LA+A  +A+     
Sbjct: 243 -----LPAYEQVMKASHTFNLLDARRAISVTERQRYILRVRALAQAVAKAYYEQRE 293


>gi|313201806|ref|YP_004040464.1| glycyl-tRNA synthetase subunit alpha [Methylovorus sp. MP688]
 gi|312441122|gb|ADQ85228.1| glycyl-tRNA synthetase, alpha subunit [Methylovorus sp. MP688]
          Length = 312

 Score =  546 bits (1408), Expect = e-153,   Method: Composition-based stats.
 Identities = 175/297 (58%), Positives = 217/297 (73%), Gaps = 12/297 (4%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ IIL L QYW  QGC +LQPYDMEVGAGT H +T LRALGP  WKAAYVQPSRRP
Sbjct: 1   MLTFQQIILKLQQYWDAQGCALLQPYDMEVGAGTSHTATFLRALGPEPWKAAYVQPSRRP 60

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNRLQHYYQFQV++KP P N+  LY+ SL+A+G D   +D+RFVED+WE+PT
Sbjct: 61  KDGRYGENPNRLQHYYQFQVVLKPAPDNILELYLGSLEALGFDLKKNDIRFVEDDWENPT 120

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQQV GI C PI+GEITYGLERLAMY+Q V +VYD+V+
Sbjct: 121 LGAWGLGWEVWLNGMEVTQFTYFQQVGGINCKPITGEITYGLERLAMYLQGVENVYDLVY 180

Query: 190 NAI--EGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHH 247
                  +++ YGD+F Q+E E S YNFE+++ + L   F   EK+   L++        
Sbjct: 181 AKGLHGARDLSYGDVFKQNEVEQSTYNFEHSDADFLFTAFNAHEKQAQHLME-------- 232

Query: 248 RHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
             H    PAY+Q +KA+H FNLLDARG IS TER  YI RIR+LA++   ++L +  
Sbjct: 233 --HQLALPAYEQVLKAAHTFNLLDARGAISVTERAAYIGRIRNLARSVAASYLDSRA 287


>gi|254441165|ref|ZP_05054658.1| glycyl-tRNA synthetase, alpha subunit [Octadecabacter antarcticus
           307]
 gi|198251243|gb|EDY75558.1| glycyl-tRNA synthetase, alpha subunit [Octadecabacter antarcticus
           307]
          Length = 309

 Score =  546 bits (1408), Expect = e-153,   Method: Composition-based stats.
 Identities = 194/300 (64%), Positives = 233/300 (77%), Gaps = 2/300 (0%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
             SFQ IIL L  YWA +GC I+QPYD+EVGAGTFHP+TTLR+LG + W AAYVQPSRRP
Sbjct: 5   PRSFQEIILRLQAYWAAKGCAIMQPYDLEVGAGTFHPATTLRSLGTVPWAAAYVQPSRRP 64

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNRLQH+YQFQV+IKP+P +LQ LY+ SLKA+G+D  +HD+RFVED+WESPT
Sbjct: 65  TDGRYGENPNRLQHFYQFQVLIKPSPPDLQELYLGSLKAIGVDMDLHDIRFVEDDWESPT 124

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE WCDGME+SQFTYFQQV G EC PISGE+TYGLERLAMYV  V+ V D+ +
Sbjct: 125 LGAWGLGWEVWCDGMEVSQFTYFQQVGGHECHPISGELTYGLERLAMYVLGVDHVMDMPY 184

Query: 190 NAIEGQ-NVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKK-GIPNEHH 247
           N  +    + YGD+F Q+EQEYSR+NF+ A+ +IL  HF D+E+EC  +L    +  +  
Sbjct: 185 NDPDASIPLTYGDVFKQAEQEYSRFNFDIADTDILLKHFEDAERECAAILAHDPVDPKTG 244

Query: 248 RHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNGGH 307
              +   PAYDQ IKASH+FNLLDARGVIS TERQ YI R+R+L K C +AFL T  GG 
Sbjct: 245 HKIVMAQPAYDQAIKASHLFNLLDARGVISVTERQAYIGRVRTLTKHCADAFLQTAAGGQ 304


>gi|311104092|ref|YP_003976945.1| glycyl-tRNA synthetase subunit alpha [Achromobacter xylosoxidans
           A8]
 gi|310758781|gb|ADP14230.1| glycyl-tRNA synthetase alpha subunit [Achromobacter xylosoxidans
           A8]
          Length = 303

 Score =  546 bits (1408), Expect = e-153,   Method: Composition-based stats.
 Identities = 177/296 (59%), Positives = 223/296 (75%), Gaps = 11/296 (3%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ IILTL +YW +QGC +LQPYDMEVGAGT H +T LRA+GP  W+AAYVQPSRRP
Sbjct: 1   MLTFQQIILTLQEYWDKQGCALLQPYDMEVGAGTSHTATFLRAIGPEPWRAAYVQPSRRP 60

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNRLQHYYQ+QV++KP P  + +LYI SLKA+GIDP  HD+RFVED+WE+PT
Sbjct: 61  KDGRYGENPNRLQHYYQYQVVLKPAPPEILDLYIGSLKALGIDPAQHDIRFVEDDWENPT 120

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQQV G++C+P +GEITYGLERLAMY+Q+V SVYD+V+
Sbjct: 121 LGAWGLGWEVWLNGMEVTQFTYFQQVGGLDCTPTTGEITYGLERLAMYLQDVESVYDLVW 180

Query: 190 N-AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHR 248
                G  VLY D+F Q+E E S YNFE+++ E+L +HF D E E   L++         
Sbjct: 181 TEGANGNRVLYRDVFHQNEVEQSTYNFEHSSAEMLFSHFNDYEAEAKRLME--------- 231

Query: 249 HHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                 PAY+  +KA+H FN+LDARG IS TER  YI RIR+L++A  +A+  +  
Sbjct: 232 -VPLALPAYEAALKAAHTFNMLDARGAISVTERAAYIGRIRNLSRAVAQAYYDSRE 286


>gi|297539319|ref|YP_003675088.1| glycyl-tRNA synthetase subunit alpha [Methylotenera sp. 301]
 gi|297258666|gb|ADI30511.1| glycyl-tRNA synthetase, alpha subunit [Methylotenera sp. 301]
          Length = 307

 Score =  546 bits (1408), Expect = e-153,   Method: Composition-based stats.
 Identities = 170/295 (57%), Positives = 218/295 (73%), Gaps = 14/295 (4%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ IILTL  YW+ +GC +LQ YDMEVGAGT H +T LR+LGP  WKAAYVQPSRRP
Sbjct: 2   ALTFQQIILTLQNYWSDKGCALLQSYDMEVGAGTSHTATFLRSLGPEPWKAAYVQPSRRP 61

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNRLQHYYQFQV++KP P ++  LY+ SL+A+G D   +D+RFVED+WE+PT
Sbjct: 62  KDGRYGENPNRLQHYYQFQVVLKPAPADILELYLGSLEALGFDLKKNDIRFVEDDWENPT 121

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQQV GI C PI+GEITYGLERLAMY+Q V++VYD+ +
Sbjct: 122 LGAWGLGWEVWLNGMEVTQFTYFQQVGGINCKPITGEITYGLERLAMYLQGVDNVYDLTW 181

Query: 190 NAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRH 249
            A     + YGD++ Q+E+E S YNFE+++ + L   F   EK+ L L+++ +       
Sbjct: 182 TA----GLSYGDVYLQNEKEQSTYNFEHSDADFLFTAFTAHEKQALHLIEEKLS------ 231

Query: 250 HLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                PAY+Q +KA+H FNLLDARG IS TER  YI RIR+LA++    +L +  
Sbjct: 232 ----LPAYEQVLKAAHTFNLLDARGAISVTERAGYIGRIRNLARSVAAGYLESRA 282


>gi|52842067|ref|YP_095866.1| glycyl-tRNA synthetase subunit alpha [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|52629178|gb|AAU27919.1| glycyl tRNA synthetase, alpha subunit [Legionella pneumophila
           subsp. pneumophila str. Philadelphia 1]
          Length = 307

 Score =  546 bits (1408), Expect = e-153,   Method: Composition-based stats.
 Identities = 175/299 (58%), Positives = 219/299 (73%), Gaps = 10/299 (3%)

Query: 7   KKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPS 66
                +FQ IILTL +YW+  GC ILQP D+EVGAGTFHP+T LRA+GP  W AAYVQPS
Sbjct: 7   MTKPTTFQEIILTLQKYWSDLGCVILQPLDLEVGAGTFHPATFLRAIGPEPWSAAYVQPS 66

Query: 67  RRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWE 126
           RRP DGRY ENPNR+QHYYQFQV++KP+PL++Q+ Y++SL+A+G+DPL+ D+RFVEDNWE
Sbjct: 67  RRPTDGRYGENPNRVQHYYQFQVVLKPSPLDIQDRYLDSLRALGVDPLLDDIRFVEDNWE 126

Query: 127 SPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYD 186
           SPTLGAWGLGWE W +GME+SQFTYFQQV G+ C PI+GE+TYGLER+AM+V  V++++D
Sbjct: 127 SPTLGAWGLGWEVWQNGMEVSQFTYFQQVGGLVCKPITGELTYGLERIAMFVLGVDNLFD 186

Query: 187 IVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEH 246
           + +       V YGD+F Q+E E S YNFE+AN E L   F   E E   L+   +P   
Sbjct: 187 LPWCKTANGIVTYGDVFHQNEVEMSAYNFEHANVEELFKQFDYYEGEAQKLIALQLP--- 243

Query: 247 HRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNG 305
                   PAY+  IKASH FNLLDAR  IS TERQRYILR+R L++A  +A+      
Sbjct: 244 -------LPAYEMVIKASHTFNLLDARKAISVTERQRYILRVRHLSRAVAQAYYQAREA 295


>gi|319761351|ref|YP_004125288.1| glycyl-tRNA synthetase, alpha subunit [Alicycliphilus denitrificans
           BC]
 gi|330823226|ref|YP_004386529.1| glycyl-tRNA synthetase subunit alpha [Alicycliphilus denitrificans
           K601]
 gi|317115912|gb|ADU98400.1| glycyl-tRNA synthetase, alpha subunit [Alicycliphilus denitrificans
           BC]
 gi|329308598|gb|AEB83013.1| glycyl-tRNA synthetase, alpha subunit [Alicycliphilus denitrificans
           K601]
          Length = 312

 Score =  546 bits (1407), Expect = e-153,   Method: Composition-based stats.
 Identities = 168/295 (56%), Positives = 216/295 (73%), Gaps = 14/295 (4%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ IIL L  YWA QGC +LQPYDMEVGAGT H +T LRA+GP  WKAAYVQPSRRP
Sbjct: 1   MLTFQQIILKLQSYWADQGCALLQPYDMEVGAGTSHTATFLRAIGPEPWKAAYVQPSRRP 60

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY +NPNRLQHYYQ+QV++KP P N+  LY+ SL+A+G D   +D+RFVED+WE+PT
Sbjct: 61  KDGRYGDNPNRLQHYYQYQVVLKPAPANILELYLGSLEALGFDLKKNDIRFVEDDWENPT 120

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQQV GI+C P +GEITYGLERLAMY+Q V++VY++ +
Sbjct: 121 LGAWGLGWEVWLNGMEVTQFTYFQQVGGIDCKPATGEITYGLERLAMYLQGVDNVYNLTW 180

Query: 190 NAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRH 249
                + + YGD++ Q+E E S YNFE+++ + L   F   EK+   L+ + +       
Sbjct: 181 T----EGLSYGDVYHQNEVEQSTYNFEHSDADFLFTAFGAHEKQAQHLMAEQL------- 229

Query: 250 HLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                PAY+Q +KA+H FNLLDARG IS TER  YI RIR+LA+A   ++L +  
Sbjct: 230 ---ALPAYEQVLKAAHTFNLLDARGAISVTERAAYIGRIRNLARAVARSYLDSRA 281


>gi|253999832|ref|YP_003051895.1| glycyl-tRNA synthetase subunit alpha [Methylovorus sp. SIP3-4]
 gi|253986511|gb|ACT51368.1| glycyl-tRNA synthetase, alpha subunit [Methylovorus sp. SIP3-4]
          Length = 312

 Score =  546 bits (1407), Expect = e-153,   Method: Composition-based stats.
 Identities = 175/297 (58%), Positives = 217/297 (73%), Gaps = 12/297 (4%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ IIL L QYW  QGC +LQPYDMEVGAGT H +T LRALGP  WKAAYVQPSRRP
Sbjct: 1   MLTFQQIILKLQQYWDAQGCALLQPYDMEVGAGTSHTATFLRALGPEPWKAAYVQPSRRP 60

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNRLQHYYQFQV++KP P N+  LY+ SL+A+G D   +D+RFVED+WE+PT
Sbjct: 61  KDGRYGENPNRLQHYYQFQVVLKPAPDNILELYLGSLEALGFDLKKNDIRFVEDDWENPT 120

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQQV GI C PI+GEITYGLERLAMY+Q V +VYD+V+
Sbjct: 121 LGAWGLGWEVWLNGMEVTQFTYFQQVGGINCKPITGEITYGLERLAMYLQGVENVYDLVY 180

Query: 190 NAI--EGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHH 247
                  +++ YGD+F Q+E E S YNFE+++ + L   F   EK+   L++        
Sbjct: 181 AKGLHGDRDLSYGDVFKQNEVEQSTYNFEHSDADFLFTAFNAHEKQAQHLME-------- 232

Query: 248 RHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
             H    PAY+Q +KA+H FNLLDARG IS TER  YI RIR+LA++   ++L +  
Sbjct: 233 --HQLALPAYEQVLKAAHTFNLLDARGAISVTERAAYIGRIRNLARSVAASYLDSRA 287


>gi|258545074|ref|ZP_05705308.1| glycyl-tRNA synthetase, alpha subunit [Cardiobacterium hominis ATCC
           15826]
 gi|258519694|gb|EEV88553.1| glycyl-tRNA synthetase, alpha subunit [Cardiobacterium hominis ATCC
           15826]
          Length = 311

 Score =  546 bits (1407), Expect = e-153,   Method: Composition-based stats.
 Identities = 181/305 (59%), Positives = 228/305 (74%), Gaps = 10/305 (3%)

Query: 1   MAPIHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKA 60
           + P       L+FQ++I TL ++WAQQGC +LQPYDMEVGAGTFH +T L+A+GP  W A
Sbjct: 5   LKPDTLMAEALNFQDMIFTLQRFWAQQGCVVLQPYDMEVGAGTFHTATFLQAVGPEPWNA 64

Query: 61  AYVQPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRF 120
           AYVQPSRRP DGRY +NPNRLQ YYQFQV++KP+P   Q+LY+ES++A+GIDP +HD+RF
Sbjct: 65  AYVQPSRRPTDGRYGDNPNRLQRYYQFQVVMKPSPPRFQDLYLESMRAIGIDPAVHDMRF 124

Query: 121 VEDNWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQN 180
           VEDNWESPTLGAWGLGWE W +GMEISQFTYFQQ  G+EC P+ GE+TYGLER+AMY+Q+
Sbjct: 125 VEDNWESPTLGAWGLGWEVWVNGMEISQFTYFQQAGGLECKPVMGELTYGLERIAMYLQD 184

Query: 181 VNSVYDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKK 240
           V+SVYD+V+       V YGD+  Q+E+E S YNFE+A+ + L   F  +EK  L L + 
Sbjct: 185 VDSVYDLVWTTTPQGVVRYGDVHQQNEREQSAYNFEHADVDSLFAQFESAEKMALQLAEA 244

Query: 241 GIPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFL 300
           G+P           PAY+Q +KASH FNLLDAR  IS TERQRYILR+R+L+KA   A+ 
Sbjct: 245 GLP----------LPAYEQALKASHTFNLLDARRAISVTERQRYILRVRALSKAAAVAWY 294

Query: 301 MTPNG 305
            +   
Sbjct: 295 QSREA 299


>gi|325919826|ref|ZP_08181818.1| glycyl-tRNA synthetase alpha chain [Xanthomonas gardneri ATCC
           19865]
 gi|325549692|gb|EGD20554.1| glycyl-tRNA synthetase alpha chain [Xanthomonas gardneri ATCC
           19865]
          Length = 302

 Score =  546 bits (1407), Expect = e-153,   Method: Composition-based stats.
 Identities = 179/300 (59%), Positives = 226/300 (75%), Gaps = 11/300 (3%)

Query: 6   NKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQP 65
           +++  ++FQ +I TL QYWA+QGC ++QP D+EVGAGTFHP+T LRALGP  W AAYVQP
Sbjct: 4   SRRVPITFQGLIQTLNQYWAEQGCVLIQPLDLEVGAGTFHPATFLRALGPEPWNAAYVQP 63

Query: 66  SRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNW 125
           SRRP DGRY ENPNRLQ YYQ+QV +KPNP N+Q+LY+ SL+A+GIDPL+HD+RFVEDNW
Sbjct: 64  SRRPTDGRYGENPNRLQRYYQYQVAMKPNPDNIQDLYLGSLQALGIDPLVHDLRFVEDNW 123

Query: 126 ESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVY 185
           ESPTLGAWGLGWE W +GME++QFTYFQQ  G+EC P+ GEITYGLERL MY+Q+ ++VY
Sbjct: 124 ESPTLGAWGLGWEVWLNGMEVTQFTYFQQAGGLECKPVLGEITYGLERLCMYLQSCDNVY 183

Query: 186 DIVFN-AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           D+V+    +G  V YGD++ Q+E E S YNFE+AN   L + F   E E   L++ G+P 
Sbjct: 184 DLVWTYGPDGTPVSYGDVYHQNEVEQSAYNFEHANVAELFHRFDACEAEAKQLIEVGLP- 242

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY+Q  KASH FNLLDAR  IS TERQRYILR+R+L++   +A+     
Sbjct: 243 ---------LPAYEQVTKASHAFNLLDARRAISVTERQRYILRVRTLSQGVAQAYYAQRE 293


>gi|317494688|ref|ZP_07953100.1| glycyl-tRNA synthetase alpha subunit protein [Enterobacteriaceae
           bacterium 9_2_54FAA]
 gi|316917290|gb|EFV38637.1| glycyl-tRNA synthetase alpha subunit protein [Enterobacteriaceae
           bacterium 9_2_54FAA]
          Length = 310

 Score =  546 bits (1407), Expect = e-153,   Method: Composition-based stats.
 Identities = 182/301 (60%), Positives = 220/301 (73%), Gaps = 8/301 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +ILTL  YWA+QGCTI+QP DMEVGAGT HP T LRALGP     AYVQ
Sbjct: 1   MQKFDTKTFQGLILTLQDYWARQGCTIVQPLDMEVGAGTSHPMTCLRALGPEPMATAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQV+IKP+P N+Q LY+ SLK +G+DPL++D+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVVIKPSPENIQELYLGSLKELGLDPLVNDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLERLAMY+Q V+SV
Sbjct: 121 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGLERLAMYIQGVDSV 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V++        YGD+F Q+E E S YNFEYA+ + L + F   EKE           
Sbjct: 181 YDLVWSDGPLGKTTYGDVFHQNEVEQSTYNFEYADVDFLFSCFEQYEKEAK--------M 232

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY++ +KA+H FNLLDAR  IS TERQRYILRIR+L KA  EA+  +  
Sbjct: 233 LLELEKPLPLPAYERILKAAHSFNLLDARKAISVTERQRYILRIRTLTKAVAEAYYASRE 292

Query: 305 G 305
            
Sbjct: 293 A 293


>gi|167630519|ref|YP_001681018.1| glycyl-tRNA synthetase, alpha subunit [Heliobacterium modesticaldum
           Ice1]
 gi|238687863|sp|B0TAF7|SYGA_HELMI RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|167593259|gb|ABZ85007.1| glycyl-tRNA synthetase, alpha subunit [Heliobacterium modesticaldum
           Ice1]
          Length = 305

 Score =  546 bits (1407), Expect = e-153,   Method: Composition-based stats.
 Identities = 168/294 (57%), Positives = 213/294 (72%), Gaps = 14/294 (4%)

Query: 11  LSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPL 70
           ++FQ IIL L Q+W +QGC I QPYD+E GAGT +P+T LRALGP  W  AYV+PSRRP 
Sbjct: 1   MNFQEIILALNQFWGEQGCIIQQPYDVEKGAGTMNPATFLRALGPEPWNVAYVEPSRRPT 60

Query: 71  DGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTL 130
           DGRY ENPNRLQHYYQ+QVI+KP+P ++  +Y++SL+ +GIDPL HD+RFVEDNWESPTL
Sbjct: 61  DGRYGENPNRLQHYYQYQVILKPSPDDVLEMYLDSLRRLGIDPLKHDIRFVEDNWESPTL 120

Query: 131 GAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFN 190
           GAWGLGWE W DGME++QFTYFQQ  GI+C P+  EITYG+ER+AM++Q  +SVYDI + 
Sbjct: 121 GAWGLGWEVWLDGMEVTQFTYFQQCGGIDCRPVCAEITYGIERIAMFIQQKDSVYDIEWV 180

Query: 191 AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHH 250
               + + YGD+  Q E +YS YNFE A+   L   F   EKE L +++KG+        
Sbjct: 181 ----EGITYGDVHHQGEVDYSHYNFEVADTAALFTFFDMYEKEALRVIEKGL-------- 228

Query: 251 LCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
             V PAYD  +K SH FNLLDARG IS TER  +I R+R LA+ C +A++    
Sbjct: 229 --VQPAYDYVLKCSHTFNLLDARGAISVTERTSFITRVRHLARVCAQAYVKQRE 280


>gi|330447263|ref|ZP_08310913.1| glycyl-tRNA synthetase alpha subunit [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
 gi|328491454|dbj|GAA05410.1| glycyl-tRNA synthetase alpha subunit [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
          Length = 303

 Score =  546 bits (1407), Expect = e-153,   Method: Composition-based stats.
 Identities = 180/301 (59%), Positives = 216/301 (71%), Gaps = 8/301 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +IL L  YW QQGCTI+QP DMEVGAGT HP T LRALGP    AAYVQ
Sbjct: 1   MQKYDIKTFQGMILALQDYWGQQGCTIVQPLDMEVGAGTSHPMTCLRALGPEPIAAAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQV++KP+P N+Q LY+ SL+ +GID  +HD+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVMLKPSPDNIQELYLGSLEVLGIDTKVHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYG+ERLAMY+QNV+SV
Sbjct: 121 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGIERLAMYIQNVDSV 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V+       V YGDIF Q+E E S YNFE+A+ + L   F   EKE           
Sbjct: 181 YDLVWTDGPLGKVTYGDIFHQNEVEQSTYNFEHADVDFLFTFFDQCEKEA--------TQ 232

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY++ +KA+H FNLLDAR  IS TERQRYILRIR+L K   EA+  +  
Sbjct: 233 LLELEQPLPLPAYERILKAAHAFNLLDARKAISVTERQRYILRIRNLTKQVAEAYYASRE 292

Query: 305 G 305
            
Sbjct: 293 A 293


>gi|258516201|ref|YP_003192423.1| glycyl-tRNA synthetase subunit alpha [Desulfotomaculum acetoxidans
           DSM 771]
 gi|257779906|gb|ACV63800.1| glycyl-tRNA synthetase, alpha subunit [Desulfotomaculum acetoxidans
           DSM 771]
          Length = 296

 Score =  546 bits (1407), Expect = e-153,   Method: Composition-based stats.
 Identities = 174/294 (59%), Positives = 216/294 (73%), Gaps = 14/294 (4%)

Query: 11  LSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPL 70
           ++FQ ++L L  +WA++ C ILQPYD+E GAGT +P+T LRALGP  W+ AYV+PSRRP 
Sbjct: 1   MNFQELVLALNNFWAKENCIILQPYDVEKGAGTMNPATFLRALGPEPWRVAYVEPSRRPT 60

Query: 71  DGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTL 130
           DGRY ENPNRLQHYYQ+QVI+KP+P N+  +Y+ESLKA+GIDP  HD+RFVEDNWESPTL
Sbjct: 61  DGRYGENPNRLQHYYQYQVILKPSPENVLEVYLESLKAIGIDPERHDIRFVEDNWESPTL 120

Query: 131 GAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFN 190
           GAWGLGWE W DGME++QFTYFQQ  G++C P+S EITYGLERL+M++QN +SV+DIV+ 
Sbjct: 121 GAWGLGWEVWLDGMEVTQFTYFQQCGGLDCRPVSAEITYGLERLSMFIQNKDSVFDIVWV 180

Query: 191 AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHH 250
                 V YGDI  Q E EYS YNFE A+  +L N F   E+E L +  KG+        
Sbjct: 181 ----DGVTYGDIHHQGEVEYSHYNFETADTAMLLNLFNVYEQEALRVADKGL-------- 228

Query: 251 LCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
             V PAYD  +K SH FNLLDARG IS TER  YI R+R+LA+ C  A++    
Sbjct: 229 --VLPAYDYVLKCSHTFNLLDARGAISVTERTNYIGRVRNLARTCASAYVAERE 280


>gi|224369903|ref|YP_002604067.1| glycyl-tRNA synthetase subunit alpha [Desulfobacterium
           autotrophicum HRM2]
 gi|259511905|sp|C0QJ90|SYGA_DESAH RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|223692620|gb|ACN15903.1| GlyQ [Desulfobacterium autotrophicum HRM2]
          Length = 299

 Score =  545 bits (1406), Expect = e-153,   Method: Composition-based stats.
 Identities = 178/298 (59%), Positives = 219/298 (73%), Gaps = 15/298 (5%)

Query: 11  LSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPL 70
           ++FQ++ILTL  +WA++GC ++Q YD EVGAGTFHP+T L+ALGP  WK AYVQPSRRP 
Sbjct: 1   MNFQDVILTLNNFWAEKGCVLIQSYDTEVGAGTFHPTTLLKALGPEPWKVAYVQPSRRPT 60

Query: 71  DGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTL 130
           DGRY ENPNRLQHYYQ+QVIIKP+P N+Q LYIESLK +GIDPL HD+RFVED+WESPTL
Sbjct: 61  DGRYGENPNRLQHYYQYQVIIKPSPSNIQALYIESLKKLGIDPLDHDIRFVEDDWESPTL 120

Query: 131 GAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFN 190
           GA GLGWE W DGME++QFTYFQ    IE  P+S EITYGLERL MY+Q V+SVYD+ +N
Sbjct: 121 GASGLGWEVWLDGMEVTQFTYFQMAGSIELKPVSVEITYGLERLCMYLQGVDSVYDLKWN 180

Query: 191 AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHH 250
                 + YGD++ Q E E S YNFE A+ ++L + F   E E L +++KG+        
Sbjct: 181 ----DTITYGDVYHQQEVEQSTYNFEVADTDMLFDFFNKYESEALRIIEKGL-------- 228

Query: 251 LCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN-GGH 307
             V PAY+  +K SH FNLLDARG IS TER  YI RIR +A+AC  A++      GH
Sbjct: 229 --VLPAYEFGLKCSHTFNLLDARGAISVTERTGYIGRIRKIARACSNAYVAQREQMGH 284


>gi|298501205|ref|ZP_07011004.1| glycyl-tRNA synthetase, alpha subunit [Vibrio cholerae MAK 757]
 gi|297540077|gb|EFH76139.1| glycyl-tRNA synthetase, alpha subunit [Vibrio cholerae MAK 757]
          Length = 319

 Score =  545 bits (1406), Expect = e-153,   Method: Composition-based stats.
 Identities = 182/295 (61%), Positives = 217/295 (73%), Gaps = 8/295 (2%)

Query: 4   IHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYV 63
              K +  +FQ +IL L  YWAQQGCTI+QP DMEVGAGT HP T LRALGP     AYV
Sbjct: 2   TMQKYDIKTFQGMILALQDYWAQQGCTIVQPLDMEVGAGTSHPMTCLRALGPEPIATAYV 61

Query: 64  QPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVED 123
           QPSRRP DGRY ENPNRLQHYYQFQVIIKP+P N+Q LY+ SL+ +G+DP +HD+RFVED
Sbjct: 62  QPSRRPTDGRYGENPNRLQHYYQFQVIIKPSPDNIQELYLGSLRVLGVDPCVHDIRFVED 121

Query: 124 NWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNS 183
           NWE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYG+ERLAMY+Q V+S
Sbjct: 122 NWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGIERLAMYIQGVDS 181

Query: 184 VYDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIP 243
           VYD+V+       V YGDIF Q+E E S YNFE+A+ + L  +F   EKEC         
Sbjct: 182 VYDLVWTDGPLGKVTYGDIFHQNEVEQSTYNFEHADVDFLFTYFDQCEKECK-------- 233

Query: 244 NEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEA 298
                      PAY++ +KA+H FNLLDAR  IS TERQRYILRIR+L K+  EA
Sbjct: 234 YLLELEKPLPLPAYERILKAAHAFNLLDARKAISVTERQRYILRIRNLTKSVAEA 288


>gi|255262671|ref|ZP_05342013.1| glycyl-tRNA synthetase, alpha subunit [Thalassiobium sp. R2A62]
 gi|255105006|gb|EET47680.1| glycyl-tRNA synthetase, alpha subunit [Thalassiobium sp. R2A62]
          Length = 307

 Score =  545 bits (1405), Expect = e-153,   Method: Composition-based stats.
 Identities = 186/301 (61%), Positives = 231/301 (76%), Gaps = 2/301 (0%)

Query: 8   KNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSR 67
               SFQ IIL L  YWA+ GC ++Q YDMEVGAGTFHP+TT+R+LG   W AAYVQPSR
Sbjct: 4   DKPKSFQEIILRLQSYWAEHGCAVMQSYDMEVGAGTFHPATTMRSLGSTPWSAAYVQPSR 63

Query: 68  RPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWES 127
           RP DGRY ++PNR QHYYQ+QVIIKP+P NLQ LY+ SL+A+GID  +HD+RFVED+WES
Sbjct: 64  RPTDGRYGDSPNRWQHYYQYQVIIKPSPPNLQELYLGSLRAIGIDMAMHDIRFVEDDWES 123

Query: 128 PTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDI 187
           PTLGAWGLGWE WCDGME+SQFTYFQQV G +C P+SGE+TYGLERLAMY+ N +   ++
Sbjct: 124 PTLGAWGLGWEVWCDGMEVSQFTYFQQVGGHDCKPVSGELTYGLERLAMYILNCDDGNEM 183

Query: 188 VFNAIEGQ-NVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLL-KKGIPNE 245
            FNA +    + YGD+F ++E +Y+R+NF+ A+ + L  HF D+E EC  +L +     +
Sbjct: 184 PFNAPDAPIPLTYGDVFREAEAQYARWNFDVADTDTLLRHFEDAEAECARILAEPHDDPK 243

Query: 246 HHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNG 305
             R  +   PAYDQCIKASH+FNLLDARGVIS TERQ YI R+R+LAKAC +AF+ T  G
Sbjct: 244 TGRRIVMALPAYDQCIKASHVFNLLDARGVISVTERQAYIGRVRTLAKACADAFVQTRAG 303

Query: 306 G 306
           G
Sbjct: 304 G 304


>gi|163738404|ref|ZP_02145819.1| Glycine--tRNA ligase [Phaeobacter gallaeciensis BS107]
 gi|161388325|gb|EDQ12679.1| Glycine--tRNA ligase [Phaeobacter gallaeciensis BS107]
          Length = 309

 Score =  545 bits (1405), Expect = e-153,   Method: Composition-based stats.
 Identities = 194/306 (63%), Positives = 238/306 (77%), Gaps = 2/306 (0%)

Query: 4   IHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYV 63
              K    SFQ IIL L  YWA +GC ++QPYDMEVGAGTFHP+TTLR+LG  +W AAYV
Sbjct: 2   TDTKGAPRSFQEIILRLQNYWAAKGCAVMQPYDMEVGAGTFHPATTLRSLGSKAWAAAYV 61

Query: 64  QPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVED 123
           QPSRRP DGRY ENPNRLQHYYQ+QV+IKP+P NLQ LY+ SL+A+G+D  +HD+RFVED
Sbjct: 62  QPSRRPTDGRYGENPNRLQHYYQYQVLIKPSPPNLQELYLGSLEAIGVDMDMHDIRFVED 121

Query: 124 NWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNS 183
           +WESPTLGAWGLGWE WCDGME+SQFTYFQQV G +C P+SGE+TYGLERLAMY+  V+ 
Sbjct: 122 DWESPTLGAWGLGWEVWCDGMEVSQFTYFQQVGGHDCHPVSGELTYGLERLAMYILGVDH 181

Query: 184 VYDIVFNAIEGQN-VLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLL-KKG 241
           V D+ FN  +    + YGD+F Q+E+EY+R+NF+ AN E+L  HF ++E EC  +L +  
Sbjct: 182 VMDMPFNDPDAPIAMTYGDVFKQTEEEYARWNFDVANTEVLLRHFEEAEAECAAILAQAH 241

Query: 242 IPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLM 301
           I  +  +  +   PAYDQCIKASH+FNLLDARGVIS TERQ YI R+R+LAK C +AF+ 
Sbjct: 242 IDPKTGKRIIMAHPAYDQCIKASHVFNLLDARGVISVTERQAYIGRVRTLAKQCADAFVQ 301

Query: 302 TPNGGH 307
           T  GGH
Sbjct: 302 TEAGGH 307


>gi|294638313|ref|ZP_06716566.1| glycyl-tRNA synthetase, alpha subunit [Edwardsiella tarda ATCC
           23685]
 gi|291088566|gb|EFE21127.1| glycyl-tRNA synthetase, alpha subunit [Edwardsiella tarda ATCC
           23685]
          Length = 302

 Score =  545 bits (1405), Expect = e-153,   Method: Composition-based stats.
 Identities = 181/301 (60%), Positives = 217/301 (72%), Gaps = 8/301 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +ILTL  YWA+QGCTI+QP DMEVGAGT HP T LRALGP     AYVQ
Sbjct: 1   MQKFDIKTFQGLILTLQDYWARQGCTIVQPLDMEVGAGTSHPMTCLRALGPEPMATAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQV+IKP+P N+Q LY+ SLK +G+DP +HD+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVVIKPSPDNIQELYLGSLKELGLDPTVHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLERLAMY+Q V SV
Sbjct: 121 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGLERLAMYIQGVESV 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V++        YGD+F Q+E E S YNFEYA+ + L   F   EKE           
Sbjct: 181 YDLVWSDGPLGKTTYGDVFHQNEVEQSTYNFEYADVDFLFACFDQYEKEAR--------L 232

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                +    PAY++ +KA+H FNLLDAR  IS TERQRYILRIR+L K   EA+  +  
Sbjct: 233 LLELENPLPLPAYERILKAAHSFNLLDARKAISVTERQRYILRIRTLTKMVAEAYYASRE 292

Query: 305 G 305
            
Sbjct: 293 A 293


>gi|218885394|ref|YP_002434715.1| glycyl-tRNA synthetase subunit alpha [Desulfovibrio vulgaris str.
           'Miyazaki F']
 gi|226737034|sp|B8DPG0|SYGA_DESVM RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|218756348|gb|ACL07247.1| glycyl-tRNA synthetase, alpha subunit [Desulfovibrio vulgaris str.
           'Miyazaki F']
          Length = 291

 Score =  545 bits (1405), Expect = e-153,   Method: Composition-based stats.
 Identities = 171/298 (57%), Positives = 220/298 (73%), Gaps = 15/298 (5%)

Query: 11  LSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPL 70
           + FQ++ILTL  +WA++GC I+QP D+E GAGTF+PST LR +GP  W  AYV+PSRRP 
Sbjct: 1   MHFQDVILTLQNFWAKRGCVIMQPIDVECGAGTFNPSTFLRVIGPEPWNVAYVEPSRRPT 60

Query: 71  DGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTL 130
           DGRY ENPNRLQHY+QFQVI+KP+P N+Q++Y++SL+A+GIDP  HD+RFVED+WESPTL
Sbjct: 61  DGRYGENPNRLQHYFQFQVILKPSPDNVQDIYLDSLRALGIDPAAHDIRFVEDDWESPTL 120

Query: 131 GAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFN 190
           GAWGLGWE W +GME++QFTYFQQV GI+ +P S EITYGLERL MY+Q   SVYD+ +N
Sbjct: 121 GAWGLGWEVWLNGMEVTQFTYFQQVGGIDLAPTSVEITYGLERLCMYLQGKESVYDLSWN 180

Query: 191 AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHH 250
                 V YG+I+ Q+E E S+YNFE +NP++L + F   E EC  L  +G+        
Sbjct: 181 ----DRVTYGNIYHQNEVEQSKYNFEASNPKMLLDQFNACEAECKRLCDEGL-------- 228

Query: 251 LCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAF-LMTPNGGH 307
             ++PAYD C+K SH FNLLDARG IS TER  YI R+R+LA A    + +     G+
Sbjct: 229 --LWPAYDYCLKCSHTFNLLDARGAISITERTGYIGRVRALASAVARLYAVQREELGY 284


>gi|264680351|ref|YP_003280261.1| glycyl-tRNA synthetase, subunit alpha [Comamonas testosteroni
           CNB-2]
 gi|262210867|gb|ACY34965.1| glycyl-tRNA synthetase, alpha subunit [Comamonas testosteroni
           CNB-2]
          Length = 321

 Score =  545 bits (1405), Expect = e-153,   Method: Composition-based stats.
 Identities = 176/304 (57%), Positives = 217/304 (71%), Gaps = 14/304 (4%)

Query: 1   MAPIHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKA 60
           M      +  L+FQ IIL L  YWA+QGC +LQPYDMEVGAGT H +T LRA+GP  WKA
Sbjct: 1   MQTRERIQVMLTFQQIILKLQSYWAEQGCALLQPYDMEVGAGTSHTATFLRAIGPEPWKA 60

Query: 61  AYVQPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRF 120
           AYVQPSRRP DGRY ENPNRLQHYYQFQV++KP P N+  LY+ SL+A+G D   +D+RF
Sbjct: 61  AYVQPSRRPKDGRYGENPNRLQHYYQFQVVLKPAPDNILELYLGSLEALGFDLKKNDIRF 120

Query: 121 VEDNWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQN 180
           VED+WE+PTLGAWGLGWE W +GME++QFTYFQQV GI+C P +GEITYGLERLAMY+Q 
Sbjct: 121 VEDDWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVAGIDCKPATGEITYGLERLAMYLQG 180

Query: 181 VNSVYDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKK 240
             SVYD+V+       + YGD+F Q+E E S YNFE++N E L + F   E     L+  
Sbjct: 181 KESVYDLVYT----DGLSYGDVFHQNEVEQSTYNFEHSNAEFLFSAFAAHEGTANQLIDA 236

Query: 241 GIPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFL 300
            +            PAY+Q +KA+H FNLLDARG IS TER  YI RIR+LA+A G+++L
Sbjct: 237 QL----------ALPAYEQVLKAAHTFNLLDARGAISVTERAAYIGRIRNLARAVGKSYL 286

Query: 301 MTPN 304
            +  
Sbjct: 287 DSRA 290


>gi|33591303|ref|NP_878947.1| glycyl-tRNA synthetase subunit alpha [Bordetella pertussis Tohama
           I]
 gi|81578884|sp|Q7W0Q6|SYGA_BORPE RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|33570945|emb|CAE40412.1| glycyl-tRNA synthetase alpha chain [Bordetella pertussis Tohama I]
 gi|332380705|gb|AEE65552.1| glycyl-tRNA synthetase subunit alpha [Bordetella pertussis CS]
          Length = 303

 Score =  545 bits (1405), Expect = e-153,   Method: Composition-based stats.
 Identities = 176/296 (59%), Positives = 219/296 (73%), Gaps = 11/296 (3%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ IILTL  YW +QGC +LQPYDMEVGAGT H +T LRA+GP  W+AAYVQPSRRP
Sbjct: 1   MLTFQQIILTLQDYWDKQGCALLQPYDMEVGAGTSHTATFLRAIGPEPWRAAYVQPSRRP 60

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNRLQHYYQ+QV++KP P  + +LYI SLKA+GIDP  HD+RFVED+WE+PT
Sbjct: 61  KDGRYGENPNRLQHYYQYQVVLKPAPPEILDLYIGSLKALGIDPTQHDIRFVEDDWENPT 120

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQQV G++C+P +GEITYGLERLAMY+Q+V SVYD+V+
Sbjct: 121 LGAWGLGWEVWLNGMEVTQFTYFQQVGGLDCTPTTGEITYGLERLAMYLQDVESVYDLVW 180

Query: 190 N-AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHR 248
                G  V Y D+F Q+E E S YNFE+A+ ++L  HF D E E   L+          
Sbjct: 181 TEGANGNRVYYRDVFHQNEVEQSTYNFEHASADMLFAHFNDYEAEAKRLMD--------- 231

Query: 249 HHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                 PAY+  +KA+H FN+LDARG IS TER  YI RIR+L++A  +A+  +  
Sbjct: 232 -VPLALPAYEAALKAAHTFNMLDARGAISVTERAAYIGRIRNLSRAVAQAYYDSRE 286


>gi|187477218|ref|YP_785242.1| glycyl-tRNA synthetase subunit alpha [Bordetella avium 197N]
 gi|123514249|sp|Q2KX74|SYGA_BORA1 RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|115421804|emb|CAJ48315.1| glycyl-tRNA synthetase alpha chain [Bordetella avium 197N]
          Length = 301

 Score =  545 bits (1405), Expect = e-153,   Method: Composition-based stats.
 Identities = 179/296 (60%), Positives = 223/296 (75%), Gaps = 11/296 (3%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ IILTL +YW +QGC +LQPYDMEVGAGT H +T LRA+GP  W+AAYVQPSRRP
Sbjct: 1   MLTFQQIILTLQEYWDKQGCALLQPYDMEVGAGTSHTATFLRAIGPEPWRAAYVQPSRRP 60

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNRLQHYYQ+QV++KP P  + +LYI SLKA+GIDP  HD+RFVED+WE+PT
Sbjct: 61  KDGRYGENPNRLQHYYQYQVVLKPAPPEILDLYIGSLKALGIDPAQHDIRFVEDDWENPT 120

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQQV G++C+P +GEITYGLERLAMY+QNV SVYD+V+
Sbjct: 121 LGAWGLGWEVWLNGMEVTQFTYFQQVGGLDCTPTTGEITYGLERLAMYLQNVESVYDLVW 180

Query: 190 N-AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHR 248
                GQ VLY D+F Q+E E S YNFE+++ E+L  HF D E E   L++         
Sbjct: 181 TEGANGQRVLYRDVFHQNEVEQSTYNFEHSSAEMLFAHFNDYEAEAKRLME--------- 231

Query: 249 HHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                 PAY+  +KA+H FN+LDARG IS TER  YI RIR+L++A  +A+  +  
Sbjct: 232 -VPLALPAYEAALKAAHTFNMLDARGAISVTERAAYIGRIRNLSRAVAQAYYDSRE 286


>gi|303253227|ref|ZP_07339376.1| glycyl-tRNA synthetase subunit alpha [Actinobacillus
           pleuropneumoniae serovar 2 str. 4226]
 gi|302647909|gb|EFL78116.1| glycyl-tRNA synthetase subunit alpha [Actinobacillus
           pleuropneumoniae serovar 2 str. 4226]
          Length = 292

 Score =  545 bits (1404), Expect = e-153,   Method: Composition-based stats.
 Identities = 177/290 (61%), Positives = 212/290 (73%), Gaps = 8/290 (2%)

Query: 16  IILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPLDGRYA 75
           +IL L  YWA  GCTI+QP+DMEVGAGT HP T LRALGP     AYVQPSRRP DGRY 
Sbjct: 1   MILALQDYWANVGCTIVQPFDMEVGAGTSHPMTALRALGPEPMAFAYVQPSRRPTDGRYG 60

Query: 76  ENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTLGAWGL 135
           ENPNRLQHYYQFQV+IKP+P N+Q LY+ SLK +G DP  HD+RFVEDNWE+PTLGAWGL
Sbjct: 61  ENPNRLQHYYQFQVVIKPSPDNIQELYLGSLKMLGFDPTQHDIRFVEDNWENPTLGAWGL 120

Query: 136 GWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFNAIEGQ 195
           GWE W +GME++QFTYFQQV G+EC P++GE+TYGLERLAMY+Q V+SVYD+V++     
Sbjct: 121 GWEVWLNGMEVTQFTYFQQVGGLECKPVTGEVTYGLERLAMYIQGVDSVYDLVWSDGPLG 180

Query: 196 NVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHHLCVFP 255
              YGD+F Q+E E S YNFEYA+ + L   F   EKE  +LL    P           P
Sbjct: 181 KTTYGDVFHQNEVEQSTYNFEYADVDFLFKAFEQYEKEATELLALEKP--------LPLP 232

Query: 256 AYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNG 305
           AY++ +KA+H FN+LDAR  IS TERQRYILRIR+L K   EA+  +   
Sbjct: 233 AYERILKAAHSFNMLDARKAISVTERQRYILRIRTLTKGVAEAYYASREA 282


>gi|254477251|ref|ZP_05090637.1| glycyl-tRNA synthetase, alpha subunit [Ruegeria sp. R11]
 gi|214031494|gb|EEB72329.1| glycyl-tRNA synthetase, alpha subunit [Ruegeria sp. R11]
          Length = 309

 Score =  545 bits (1404), Expect = e-153,   Method: Composition-based stats.
 Identities = 194/306 (63%), Positives = 237/306 (77%), Gaps = 2/306 (0%)

Query: 4   IHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYV 63
              K    SFQ IIL L  YWA +GC ++QPYDMEVGAGTFHP+TTLR+LG   W AAYV
Sbjct: 2   TETKGAPRSFQEIILRLQSYWAGKGCAVMQPYDMEVGAGTFHPATTLRSLGSKPWAAAYV 61

Query: 64  QPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVED 123
           QPSRRP DGRY ENPNRLQHYYQ+QV+IKP+P NLQ LY+ SL+A+G+D  +HD+RFVED
Sbjct: 62  QPSRRPTDGRYGENPNRLQHYYQYQVLIKPSPPNLQELYLGSLEAIGVDMAMHDIRFVED 121

Query: 124 NWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNS 183
           +WESPTLGAWGLGWE WCDGME+SQFTYFQQV G +C P+SGE+TYGLERLAMY+  V+ 
Sbjct: 122 DWESPTLGAWGLGWEVWCDGMEVSQFTYFQQVGGHDCHPVSGELTYGLERLAMYILGVDH 181

Query: 184 VYDIVFNAIEG-QNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKK-G 241
           V D+ FN  +    + YGD+F Q+E+EY+R+NF+ AN E+L  HF ++E EC  +L +  
Sbjct: 182 VMDMPFNDPDALIPLSYGDVFKQTEEEYARWNFDVANTEVLLRHFEEAEAECAAILAQDH 241

Query: 242 IPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLM 301
           I  +  +  +   PAYDQCIKASH+FNLLDARGVIS TERQ YI R+R+LAK C +AF+ 
Sbjct: 242 IDPKTGKRIIMAHPAYDQCIKASHVFNLLDARGVISVTERQAYIGRVRALAKQCADAFVQ 301

Query: 302 TPNGGH 307
           T  GGH
Sbjct: 302 TEAGGH 307


>gi|89902456|ref|YP_524927.1| glycyl-tRNA synthetase subunit alpha [Rhodoferax ferrireducens
           T118]
 gi|89347193|gb|ABD71396.1| Glycine--tRNA ligase [Rhodoferax ferrireducens T118]
          Length = 325

 Score =  545 bits (1404), Expect = e-153,   Method: Composition-based stats.
 Identities = 168/300 (56%), Positives = 218/300 (72%), Gaps = 14/300 (4%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
                 L+FQ IIL L  YWA QGC +LQPYDMEVGAGT H +T LRALGP  WKAAYVQ
Sbjct: 20  TRTPVMLTFQQIILKLQSYWADQGCALLQPYDMEVGAGTSHTATFLRALGPEPWKAAYVQ 79

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQ+QV++KP P N+  LY+ SL+A+G D   +D+RFVED+
Sbjct: 80  PSRRPKDGRYGENPNRLQHYYQYQVVLKPAPSNILELYLGSLEALGFDLKQNDIRFVEDD 139

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV GI+C PI+GEITYGLERLAMY+Q V++V
Sbjct: 140 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGIDCRPITGEITYGLERLAMYLQGVDNV 199

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           Y++ +       +LYGD++ Q+E+E S YNFE+++ + L   F   EK+   L+++ +  
Sbjct: 200 YNLQWT----DGLLYGDVYLQNEKEQSAYNFEHSDVDFLFTAFTAHEKQAKHLIEQQL-- 253

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     P+Y+Q +K +H FNLLDARG IS TER  Y+ RIR+LA+A  +++  +  
Sbjct: 254 --------ALPSYEQVLKCAHSFNLLDARGAISVTERAAYMGRIRNLARAVAQSYFESRE 305


>gi|219670262|ref|YP_002460697.1| glycyl-tRNA synthetase subunit alpha [Desulfitobacterium hafniense
           DCB-2]
 gi|254781821|sp|B8FUJ1|SYGA_DESHD RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|219540522|gb|ACL22261.1| glycyl-tRNA synthetase, alpha subunit [Desulfitobacterium hafniense
           DCB-2]
          Length = 296

 Score =  545 bits (1404), Expect = e-153,   Method: Composition-based stats.
 Identities = 175/294 (59%), Positives = 220/294 (74%), Gaps = 14/294 (4%)

Query: 11  LSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPL 70
           + FQ++IL+L Q+W +QGC I QPYDME GAGTF+P+T LRALGP  WK AY++PSRRP 
Sbjct: 1   MKFQDMILSLNQFWGEQGCIIAQPYDMEKGAGTFNPNTFLRALGPEPWKVAYIEPSRRPT 60

Query: 71  DGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTL 130
           DGRY ENPNRLQHY+Q+QVIIKP+P N+Q LY++SL+ +G++P  HD+RFVEDNWESPTL
Sbjct: 61  DGRYGENPNRLQHYFQYQVIIKPSPDNIQELYLQSLERLGVNPKEHDIRFVEDNWESPTL 120

Query: 131 GAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFN 190
           GAWGLGWE W DGME++QFTYFQQ  GI+C P+  EITYGLERLAMY+QN  SVYDI + 
Sbjct: 121 GAWGLGWEVWLDGMEVTQFTYFQQCGGIDCKPVCAEITYGLERLAMYIQNKESVYDIEYV 180

Query: 191 AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHH 250
                ++ YGDI+ Q+E +YS YNFE A+ E L   F   EKE + +++KG+        
Sbjct: 181 G----DITYGDIYLQNEIDYSHYNFEAADVEALQTWFEMYEKEAIRIVEKGL-------- 228

Query: 251 LCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
             V PAYD  +K SH FNLLDARG IS TER  YI R+R+LA+ C +A++    
Sbjct: 229 --VLPAYDYVLKCSHTFNLLDARGAISVTERTGYIARVRNLARLCAQAYVEQRE 280


>gi|91775000|ref|YP_544756.1| glycyl-tRNA synthetase subunit alpha [Methylobacillus flagellatus
           KT]
 gi|122400167|sp|Q1H3M2|SYGA_METFK RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|91708987|gb|ABE48915.1| glycyl-tRNA synthetase alpha chain [Methylobacillus flagellatus KT]
          Length = 312

 Score =  545 bits (1404), Expect = e-153,   Method: Composition-based stats.
 Identities = 176/297 (59%), Positives = 220/297 (74%), Gaps = 12/297 (4%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ IILTL QYW +QGC +LQPYDMEVGAGT H +T LRALGP  WKAAYVQPSRRP
Sbjct: 1   MLTFQQIILTLQQYWDKQGCALLQPYDMEVGAGTSHTATFLRALGPEPWKAAYVQPSRRP 60

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY +NPNRLQHYYQFQV++KP P N+  LY+ SL+A+G D   +D+RFVED+WE+PT
Sbjct: 61  KDGRYGDNPNRLQHYYQFQVVLKPAPGNILELYLGSLEALGFDLQQNDIRFVEDDWENPT 120

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQQV GI C PI+GEITYGLERLAMY+Q V +VYD+V+
Sbjct: 121 LGAWGLGWEVWLNGMEVTQFTYFQQVGGINCRPITGEITYGLERLAMYLQGVENVYDLVY 180

Query: 190 NAI--EGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHH 247
           +       ++ YGD+F Q+E E S YNFE+++ + L   F   EK+  +L++        
Sbjct: 181 SKGVNGAPDLKYGDVFHQNEVEQSAYNFEHSDADFLFTAFNAHEKKAQELME-------- 232

Query: 248 RHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
             H    PAY+Q +KA+H FNLLDARG IS TER  YI RIR+LA+A   ++L +  
Sbjct: 233 --HKLALPAYEQVLKAAHTFNLLDARGAISVTERATYIGRIRNLARAVAASYLDSRA 287


>gi|270157201|ref|ZP_06185858.1| glycyl-tRNA synthetase alpha subunit [Legionella longbeachae
           D-4968]
 gi|289164398|ref|YP_003454536.1| glycyl-tRNA synthetase alpha chain [Legionella longbeachae NSW150]
 gi|269989226|gb|EEZ95480.1| glycyl-tRNA synthetase alpha subunit [Legionella longbeachae
           D-4968]
 gi|288857571|emb|CBJ11409.1| glycyl-tRNA synthetase alpha chain [Legionella longbeachae NSW150]
          Length = 303

 Score =  544 bits (1403), Expect = e-153,   Method: Composition-based stats.
 Identities = 175/299 (58%), Positives = 221/299 (73%), Gaps = 10/299 (3%)

Query: 7   KKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPS 66
                +FQ+IILTL QYWA QGC ILQP+DMEVGAGTFHP+T LRA+GP  W AAYVQPS
Sbjct: 1   MTKPTTFQDIILTLQQYWAAQGCVILQPFDMEVGAGTFHPATFLRAIGPEPWYAAYVQPS 60

Query: 67  RRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWE 126
           RRP DGRY +NPNR+QHYYQFQV++KP+PL++Q+ Y++SL+A+G+DPL  D+RFVEDNWE
Sbjct: 61  RRPTDGRYGDNPNRVQHYYQFQVVLKPSPLDIQDKYLDSLRALGVDPLADDIRFVEDNWE 120

Query: 127 SPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYD 186
           SPTLGAWGLGWE W +GME+SQFTYFQQ  G+ C P++GE+TYGLERLAMY+  V++++D
Sbjct: 121 SPTLGAWGLGWEVWQNGMEVSQFTYFQQAGGLVCKPVTGELTYGLERLAMYLLGVDNLFD 180

Query: 187 IVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEH 246
           + ++      + YG++F Q+E E S YNFE+AN E L   F   E E   L+   +P   
Sbjct: 181 LPWSKTANGVITYGNVFHQNEVEMSAYNFEHANVEELFKQFDYYEGEAQKLISLQLP--- 237

Query: 247 HRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNG 305
                   PAY+  IKASH FNLLDAR  IS TERQRYILR+R L++A  +A+      
Sbjct: 238 -------LPAYEMVIKASHSFNLLDARKAISVTERQRYILRVRHLSRAVAQAYYQAREA 289


>gi|293603529|ref|ZP_06685950.1| glycyl-tRNA synthetase alpha subunit [Achromobacter piechaudii ATCC
           43553]
 gi|292817965|gb|EFF77025.1| glycyl-tRNA synthetase alpha subunit [Achromobacter piechaudii ATCC
           43553]
          Length = 303

 Score =  544 bits (1403), Expect = e-153,   Method: Composition-based stats.
 Identities = 176/296 (59%), Positives = 222/296 (75%), Gaps = 11/296 (3%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ IILTL +YW +QGC +LQPYDMEVGAGT H +T LRA+GP  W+AAYVQPSRRP
Sbjct: 1   MLTFQQIILTLQEYWDKQGCALLQPYDMEVGAGTSHTATFLRAIGPEPWRAAYVQPSRRP 60

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNRLQHYYQ+QV++KP P ++ +LYI SLKA+GIDP  HD+RFVED+WE+PT
Sbjct: 61  KDGRYGENPNRLQHYYQYQVVLKPAPPDILDLYIGSLKALGIDPTQHDIRFVEDDWENPT 120

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQQV G++C+P +GEITYGLERLAMY+Q+V SVYD+V+
Sbjct: 121 LGAWGLGWEVWLNGMEVTQFTYFQQVGGLDCTPTTGEITYGLERLAMYLQDVQSVYDLVW 180

Query: 190 N-AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHR 248
                G  VLY D+F Q+E E S YNFE+++ ++L  HF D E E   L+          
Sbjct: 181 TEGANGNRVLYRDVFHQNEVEQSTYNFEHSSADMLFAHFNDYEAEAKRLMD--------- 231

Query: 249 HHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                 PAY+  +KA+H FN+LDARG IS TER  YI RIR+L++A  +A+  +  
Sbjct: 232 -VPLALPAYEAALKAAHTFNMLDARGAISVTERAAYIGRIRNLSRAVAQAYFDSRE 286


>gi|296134525|ref|YP_003641767.1| glycyl-tRNA synthetase, alpha subunit [Thiomonas intermedia K12]
 gi|295794647|gb|ADG29437.1| glycyl-tRNA synthetase, alpha subunit [Thiomonas intermedia K12]
          Length = 331

 Score =  544 bits (1403), Expect = e-153,   Method: Composition-based stats.
 Identities = 173/314 (55%), Positives = 218/314 (69%), Gaps = 31/314 (9%)

Query: 12  SFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPLD 71
           +FQ++ILTL  YWA+QGC +LQPYDMEVGAGT H +T LRALGP  WKAAYVQPSRRP D
Sbjct: 3   TFQDLILTLQTYWARQGCAVLQPYDMEVGAGTSHTATFLRALGPEPWKAAYVQPSRRPKD 62

Query: 72  GRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTLG 131
           GRY +NPNRLQHYYQFQV++KP P N+ +LY+ SL+A+G D   +D+RFVED+WE+PTLG
Sbjct: 63  GRYGDNPNRLQHYYQFQVVLKPAPDNILDLYLGSLQALGFDLKTNDIRFVEDDWENPTLG 122

Query: 132 AWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFNA 191
           AWGLGWE W +GME++QFTYFQQV GI+C P++GEITYGLERLAMY+Q V SVYD+V+  
Sbjct: 123 AWGLGWEVWLNGMEVTQFTYFQQVGGIDCKPLTGEITYGLERLAMYLQGVQSVYDLVWTE 182

Query: 192 IEGQN---------------------VLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDS 230
            E                        + YGD+F Q+E E S YNFE+++ + L   F   
Sbjct: 183 TEVAGEVTAPPGGASALGRPGGARTLLKYGDVFHQNEVEQSAYNFEHSDVDFLLTAFAAH 242

Query: 231 EKECLDLLKKGIPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRS 290
           EK+   L+   +            PAY+Q +KA+H FNLLDARG IS TER  YI RIR+
Sbjct: 243 EKQAKALMAAQL----------ALPAYEQVLKAAHSFNLLDARGAISVTERAAYIGRIRN 292

Query: 291 LAKACGEAFLMTPN 304
           LA+   + +L +  
Sbjct: 293 LARGVAQEYLDSRA 306


>gi|332283304|ref|YP_004415215.1| glycyl-tRNA synthetase subunit alpha [Pusillimonas sp. T7-7]
 gi|330427257|gb|AEC18591.1| glycyl-tRNA synthetase subunit alpha [Pusillimonas sp. T7-7]
          Length = 302

 Score =  544 bits (1403), Expect = e-153,   Method: Composition-based stats.
 Identities = 177/296 (59%), Positives = 221/296 (74%), Gaps = 11/296 (3%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ IILTL QYW +QGC +LQPYDMEVGAGT H +T LR++GP  W+AAYVQPSRRP
Sbjct: 1   MLTFQQIILTLQQYWDRQGCALLQPYDMEVGAGTSHTATFLRSIGPEPWRAAYVQPSRRP 60

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNRLQHYYQ+QV++KP+P  +  LYI SLKA+GI+PL HD+RFVED+WE+PT
Sbjct: 61  KDGRYGENPNRLQHYYQYQVVLKPSPPEIIELYIGSLKALGINPLEHDIRFVEDDWENPT 120

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQQV G++CSP +GEITYGLERLAMY+Q V SVYD+V+
Sbjct: 121 LGAWGLGWEVWLNGMEVTQFTYFQQVGGLDCSPTTGEITYGLERLAMYLQGVESVYDLVW 180

Query: 190 NA-IEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHR 248
               +G+ VLY D+F Q+E E S YNFE+A+  +L  HF D E E   L+          
Sbjct: 181 TEAADGRKVLYRDVFHQNEVEQSTYNFEHASTTMLFAHFNDYETEAQRLI---------- 230

Query: 249 HHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                 PAY+  +KA+H FN+LDARG IS TER  YI RIR+L++   +A+  +  
Sbjct: 231 TVPLALPAYEATLKAAHTFNMLDARGAISVTERAAYIGRIRNLSRVVAQAYFNSRE 286


>gi|94502180|ref|ZP_01308677.1| Glycyl-tRNA synthetase, alpha subunit [Oceanobacter sp. RED65]
 gi|94425683|gb|EAT10694.1| Glycyl-tRNA synthetase, alpha subunit [Oceanobacter sp. RED65]
          Length = 336

 Score =  544 bits (1403), Expect = e-153,   Method: Composition-based stats.
 Identities = 179/300 (59%), Positives = 226/300 (75%), Gaps = 11/300 (3%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
            +K +  +FQ +I TL  YW+QQGC I QP D+EVGAGTFH ST LRA+GP +W AAYVQ
Sbjct: 3   ESKYDVKTFQGLIATLQDYWSQQGCVINQPIDLEVGAGTFHTSTFLRAIGPETWNAAYVQ 62

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           P RRP DGRY ENPNRLQHYYQFQV++KP+PL++Q  Y++SLK +GID  IHD+RFVEDN
Sbjct: 63  PCRRPTDGRYGENPNRLQHYYQFQVVMKPSPLDIQQKYLDSLKMIGIDSDIHDIRFVEDN 122

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WESPTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLER+AMY+Q V+S+
Sbjct: 123 WESPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECYPVTGEITYGLERIAMYLQGVDSI 182

Query: 185 YDIVFN-AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIP 243
           YD+V+    +G  V YGD+F Q+E E S YNFE+A+ + L   F   EK+C  L++ G+ 
Sbjct: 183 YDLVWCYGPDGSKVTYGDVFHQNEVEMSAYNFEHADVDFLFQAFNQHEKDCSRLIESGL- 241

Query: 244 NEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTP 303
                      PAY+Q +KASH FN+LDAR  IS TERQ YILR+R+LA+   EA+  + 
Sbjct: 242 ---------ALPAYEQVLKASHAFNMLDARHAISVTERQGYILRVRTLARQVAEAYFASR 292


>gi|294011765|ref|YP_003545225.1| glycyl-tRNA synthetase alpha chain [Sphingobium japonicum UT26S]
 gi|292675095|dbj|BAI96613.1| glycyl-tRNA synthetase alpha chain [Sphingobium japonicum UT26S]
          Length = 295

 Score =  544 bits (1402), Expect = e-153,   Method: Composition-based stats.
 Identities = 187/297 (62%), Positives = 226/297 (76%), Gaps = 12/297 (4%)

Query: 7   KKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPS 66
               LSFQ++ILTL  YW +QGC ILQPYDMEVGAGTFHP+TTLR+LGP +W AAYVQPS
Sbjct: 3   TSKALSFQDLILTLHAYWGRQGCVILQPYDMEVGAGTFHPATTLRSLGPDAWNAAYVQPS 62

Query: 67  RRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWE 126
           RRP DGRY ENPNRLQHYYQ+QVI+KP+P NLQ LY+ SL  +GIDPL+HD+RFVED+WE
Sbjct: 63  RRPTDGRYGENPNRLQHYYQYQVIMKPSPANLQELYLGSLAEIGIDPLVHDIRFVEDDWE 122

Query: 127 SPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYD 186
           SPTLGAWGLGWE WCDGME++QFTYFQQ+ G +C P++GE+TYGLERLAMY+Q V+SVYD
Sbjct: 123 SPTLGAWGLGWEVWCDGMEVTQFTYFQQMGGFDCKPVAGELTYGLERLAMYIQGVDSVYD 182

Query: 187 IVFNAIEG--QNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           + FN        V YGD+F ++E++ S++NFE A+ E L   F D+E EC   L+ G+P 
Sbjct: 183 LKFNDGVDGRGGVTYGDVFLENERQMSKWNFEIADTEKLFRWFRDAEAECKASLEAGVP- 241

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLM 301
                      AYDQ IKASH+FNLL ARGVIS  ER  YI R+R LAK   E ++ 
Sbjct: 242 ---------LAAYDQAIKASHVFNLLQARGVISVQERASYIGRVRDLAKGACEKWME 289


>gi|157959837|ref|YP_001499871.1| glycyl-tRNA synthetase subunit alpha [Shewanella pealeana ATCC
           700345]
 gi|157844837|gb|ABV85336.1| glycyl-tRNA synthetase, alpha subunit [Shewanella pealeana ATCC
           700345]
          Length = 287

 Score =  544 bits (1402), Expect = e-153,   Method: Composition-based stats.
 Identities = 183/288 (63%), Positives = 217/288 (75%), Gaps = 8/288 (2%)

Query: 18  LTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPLDGRYAEN 77
           +TL +YWAQQGC I+QP DMEVGAGTFHP T LR+LGP    +AYVQP RRP DGRY EN
Sbjct: 1   MTLQEYWAQQGCAIVQPLDMEVGAGTFHPMTFLRSLGPEPMSSAYVQPCRRPTDGRYGEN 60

Query: 78  PNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTLGAWGLGW 137
           PNRLQHYYQFQV++KP+P N+Q LY+ SL+AVG+D  +HDVRFVEDNWESPTLGAWGLGW
Sbjct: 61  PNRLQHYYQFQVVLKPSPSNIQELYLGSLEAVGVDMNVHDVRFVEDNWESPTLGAWGLGW 120

Query: 138 ECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFNAIEGQNV 197
           E W +GME+SQFTYFQQV G+EC P++GEITYGLERLAMY+Q V+SVYD+V+       V
Sbjct: 121 EIWLNGMEVSQFTYFQQVGGLECKPVTGEITYGLERLAMYIQEVDSVYDLVWTDGPMGKV 180

Query: 198 LYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHHLCVFPAY 257
           +YGDIF Q+E E S YNFE+AN E+L   F D E+ C  LL    P           PAY
Sbjct: 181 MYGDIFHQNEVEQSTYNFEHANVEVLFKMFDDCEQACERLLTLEKP--------LPLPAY 232

Query: 258 DQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNG 305
           +Q +KASH FNLLDAR  IS TERQRYILR+R++AK   E++      
Sbjct: 233 EQVMKASHAFNLLDARHAISVTERQRYILRVRTMAKGVAESYYQAREA 280


>gi|190576419|ref|YP_001974264.1| glycyl-tRNA synthetase subunit alpha [Stenotrophomonas maltophilia
           K279a]
 gi|229558523|sp|B2FP48|SYGA_STRMK RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|190014341|emb|CAQ47988.1| putative glycyl-tRNA synthetase alpha subunit [Stenotrophomonas
           maltophilia K279a]
          Length = 303

 Score =  544 bits (1402), Expect = e-153,   Method: Composition-based stats.
 Identities = 180/296 (60%), Positives = 225/296 (76%), Gaps = 11/296 (3%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            ++FQ +I TL Q+WAQQGC ++QP D+EVGAGTFHP+T LRA+GP  W AAYVQPSRRP
Sbjct: 8   PITFQGLIQTLNQFWAQQGCVLIQPLDLEVGAGTFHPATFLRAIGPEGWNAAYVQPSRRP 67

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNRLQ YYQ+QV +KP P N+Q LY++SLKA+GIDPL+HD+RFVEDNWESPT
Sbjct: 68  TDGRYGENPNRLQRYYQYQVAMKPAPDNIQQLYLDSLKALGIDPLVHDLRFVEDNWESPT 127

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQQ  G+EC P+ GEITYGLERL MY+QN ++VYD+++
Sbjct: 128 LGAWGLGWEVWLNGMEVTQFTYFQQAGGLECRPVLGEITYGLERLCMYLQNCDNVYDLIW 187

Query: 190 N-AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHR 248
               +GQ V YGD++ Q+E E S YNFEYA+ E + + F   E+E   L++  +P     
Sbjct: 188 TYGPDGQPVTYGDVYHQNEVEQSTYNFEYADVEEMFHRFDACEREAQKLVEVNLP----- 242

Query: 249 HHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                 PAY+Q +KASH FNLLDAR  IS TERQRYILR+R+LA+A   A+     
Sbjct: 243 -----LPAYEQVMKASHTFNLLDARRAISVTERQRYILRVRALAQAVARAYYEQRE 293


>gi|90415372|ref|ZP_01223306.1| glycyl-tRNA synthetase, alpha subunit [marine gamma proteobacterium
           HTCC2207]
 gi|90332695|gb|EAS47865.1| glycyl-tRNA synthetase, alpha subunit [marine gamma proteobacterium
           HTCC2207]
          Length = 333

 Score =  543 bits (1401), Expect = e-153,   Method: Composition-based stats.
 Identities = 172/292 (58%), Positives = 218/292 (74%), Gaps = 10/292 (3%)

Query: 12  SFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPLD 71
           +FQ +I+ L QYWA QGC +LQP DMEVGAGTFHP+T LRA+GP +W +AYVQ  RRP D
Sbjct: 10  TFQELIIRLQQYWADQGCVVLQPLDMEVGAGTFHPATFLRAIGPENWNSAYVQGCRRPTD 69

Query: 72  GRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTLG 131
           GRY ENPNRLQHYYQFQV +KP+P   Q LY+ SL+++GID  IHDVRFVEDNWESPTLG
Sbjct: 70  GRYGENPNRLQHYYQFQVAMKPSPPEFQELYLGSLRSLGIDTQIHDVRFVEDNWESPTLG 129

Query: 132 AWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFNA 191
           AWG+GWE W +GMEI+QFTYFQQ  G+EC P++GEI YGLER+AMY+Q V+S+YD+V+  
Sbjct: 130 AWGIGWEVWLNGMEITQFTYFQQAGGLECYPVTGEIAYGLERIAMYLQGVDSIYDLVWAH 189

Query: 192 IEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHHL 251
                V YGD+F Q+E E S +NFE+A+ + L   F   EK+ + L + G+P        
Sbjct: 190 GPQGKVTYGDVFHQNEVEMSTFNFEHADVDALFTQFDQYEKDSVRLTEAGLP-------- 241

Query: 252 CVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTP 303
              PAY+  +KASH+FNLLDAR  IS TERQRYILR+R+L++A  + +  + 
Sbjct: 242 --LPAYEMVMKASHVFNLLDARHAISVTERQRYILRVRTLSRAVTQGYFDSR 291


>gi|170691403|ref|ZP_02882568.1| glycyl-tRNA synthetase, alpha subunit [Burkholderia graminis C4D1M]
 gi|170143608|gb|EDT11771.1| glycyl-tRNA synthetase, alpha subunit [Burkholderia graminis C4D1M]
          Length = 335

 Score =  543 bits (1401), Expect = e-152,   Method: Composition-based stats.
 Identities = 168/303 (55%), Positives = 214/303 (70%), Gaps = 18/303 (5%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ IILTL  YW +QGC +LQP DMEVGAGT H  T LRA+GP  W+AAYVQPSRRP
Sbjct: 1   MLTFQQIILTLQSYWDKQGCALLQPIDMEVGAGTSHVHTFLRAIGPEPWRAAYVQPSRRP 60

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNRLQHYYQ+QV++KP P N+ +LY+ SL+A+G D   +DVRFVED+WE+PT
Sbjct: 61  KDGRYGENPNRLQHYYQYQVVLKPAPENILDLYLGSLEALGFDLKQNDVRFVEDDWENPT 120

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQQV G++C P+ GEITYGLERLAMY+Q V +VYD+++
Sbjct: 121 LGAWGLGWEVWLNGMEVTQFTYFQQVGGLDCKPVLGEITYGLERLAMYLQKVENVYDLIW 180

Query: 190 --------NAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKG 241
                   N  E + + YGD++ Q+E E S YNFE+AN ++L   F   E E   +++  
Sbjct: 181 TEWEEQGPNGPETRRLTYGDVYHQNEVEQSTYNFEHANVDLLFTFFNSYEAEAKRMIEAQ 240

Query: 242 IPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLM 301
                        PAY+  +KA H FNLLDARG IS TER  YI RIR+L++   +A+  
Sbjct: 241 ----------IALPAYELVLKAGHTFNLLDARGAISVTERAAYIGRIRALSRLVAQAYYD 290

Query: 302 TPN 304
           +  
Sbjct: 291 SRE 293


>gi|238787799|ref|ZP_04631596.1| Glycyl-tRNA synthetase alpha subunit [Yersinia frederiksenii ATCC
           33641]
 gi|238724142|gb|EEQ15785.1| Glycyl-tRNA synthetase alpha subunit [Yersinia frederiksenii ATCC
           33641]
          Length = 304

 Score =  543 bits (1401), Expect = e-152,   Method: Composition-based stats.
 Identities = 185/301 (61%), Positives = 219/301 (72%), Gaps = 8/301 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +ILTL  YWA+QGCTI+QP DMEVGAGT HP T LRALGP    AAYVQ
Sbjct: 1   MQKFDTKTFQGLILTLQDYWARQGCTIVQPLDMEVGAGTSHPMTCLRALGPEPIAAAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQVIIKP+P N+Q LY+ SLK +G+DP IHD+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVIIKPSPDNIQELYLGSLKELGLDPTIHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLERLAMY+Q V+SV
Sbjct: 121 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGLERLAMYIQGVDSV 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+++         YGDI+ Q+E E S YNFEYA+ + L + F   EKE   LL    P 
Sbjct: 181 YDLIWCDGPLGKTTYGDIYHQNEVEQSTYNFEYADVDFLFSCFEQYEKEAQSLLALEAPL 240

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                       Y++ +KA H FNLLDAR  IS TERQRYILRIR+L KA  EA+  +  
Sbjct: 241 PLPA--------YERILKAGHTFNLLDARKAISVTERQRYILRIRTLTKAVAEAYYASRE 292

Query: 305 G 305
            
Sbjct: 293 A 293


>gi|238019250|ref|ZP_04599676.1| hypothetical protein VEIDISOL_01114 [Veillonella dispar ATCC 17748]
 gi|237863949|gb|EEP65239.1| hypothetical protein VEIDISOL_01114 [Veillonella dispar ATCC 17748]
          Length = 295

 Score =  543 bits (1400), Expect = e-152,   Method: Composition-based stats.
 Identities = 158/298 (53%), Positives = 206/298 (69%), Gaps = 14/298 (4%)

Query: 7   KKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPS 66
            +  ++FQ IIL L ++W+ QGC +  PYD+E GAGT +P+T L A+GP  W   YV+PS
Sbjct: 1   MEAAMTFQEIILNLQKFWSDQGCIVQNPYDIEKGAGTMNPATFLHAIGPEPWAVCYVEPS 60

Query: 67  RRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWE 126
           RRP DGRY +NPNRL  ++QFQVI+KP+P N+Q LY++SL  +GI    HD+RFVEDNWE
Sbjct: 61  RRPADGRYGDNPNRLFQHHQFQVIVKPSPDNIQELYLQSLATLGIHAEDHDIRFVEDNWE 120

Query: 127 SPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYD 186
           SPTLGAWGLGWE W DGME++QFTYFQQV  I+C P+S EITYGLERLAMY+Q V +VYD
Sbjct: 121 SPTLGAWGLGWEVWLDGMEVTQFTYFQQVGSIDCKPVSVEITYGLERLAMYIQGVENVYD 180

Query: 187 IVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEH 246
           + +N    +NV YGD++  +E E S YNFE A+ ++L   F   E E   + + G     
Sbjct: 181 LKWN----ENVTYGDVWHANEVEQSVYNFELADTDMLFKLFDMYEAEAKRVCEAGY---- 232

Query: 247 HRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                 V PAYD  +K SH FNLLD+RG IS +ER  +I R+R+LA+ C + +L    
Sbjct: 233 ------VLPAYDYVLKCSHTFNLLDSRGAISISERTAFIGRVRALARICAQQYLAKRE 284


>gi|289666196|ref|ZP_06487777.1| glycyl-tRNA synthetase subunit alpha [Xanthomonas campestris pv.
           vasculorum NCPPB702]
          Length = 302

 Score =  543 bits (1400), Expect = e-152,   Method: Composition-based stats.
 Identities = 179/300 (59%), Positives = 226/300 (75%), Gaps = 11/300 (3%)

Query: 6   NKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQP 65
           +++  ++FQ +I TL QYWA+QGC ++QP D+EVGAGTFHP+T LRALGP  W AAYVQP
Sbjct: 4   SRRVPITFQGLIQTLNQYWAEQGCVLIQPLDLEVGAGTFHPATFLRALGPEPWNAAYVQP 63

Query: 66  SRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNW 125
           SRRP DGRY ENPNRLQ YYQ+QV +KPNP N+Q+LY+ SL+A+GIDPL+HD+RFVEDNW
Sbjct: 64  SRRPTDGRYGENPNRLQRYYQYQVAMKPNPDNIQDLYLGSLQALGIDPLVHDLRFVEDNW 123

Query: 126 ESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVY 185
           ESPTLGAWGLGWE W +GME++QFTYFQQ  G+EC P+ GEITYGLERL MY+Q+ ++VY
Sbjct: 124 ESPTLGAWGLGWEVWLNGMEVTQFTYFQQAGGLECKPVLGEITYGLERLCMYLQSCDNVY 183

Query: 186 DIVFN-AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           ++V+    +G  V YGD++ Q+E E S YNFE+AN   L + F   E E   L++ G+P 
Sbjct: 184 ELVWTYGPDGTAVTYGDVYHQNEVEQSTYNFEHANVAELFHRFDACEAEARHLVEVGLP- 242

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY+Q  KASH FNLLDAR  IS TERQRYILR+R+LA+   +A+     
Sbjct: 243 ---------LPAYEQVTKASHAFNLLDARRAISVTERQRYILRVRALAQGVAQAYYAQRE 293


>gi|49473964|ref|YP_032006.1| glycyl-tRNA synthetase subunit alpha [Bartonella quintana str.
           Toulouse]
 gi|49239467|emb|CAF25818.1| Glycyl-tRNA synthetase alpha chain [Bartonella quintana str.
           Toulouse]
          Length = 314

 Score =  543 bits (1400), Expect = e-152,   Method: Composition-based stats.
 Identities = 213/306 (69%), Positives = 251/306 (82%), Gaps = 1/306 (0%)

Query: 1   MAPIHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKA 60
           M          SFQ +I TL  YWA  GC ILQPYDMEVGAGTFHP+TTLR+LGP  WK 
Sbjct: 1   MKLSEYLNPTRSFQGLIFTLQNYWAHYGCAILQPYDMEVGAGTFHPATTLRSLGPRPWKV 60

Query: 61  AYVQPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRF 120
           AYVQP RRP DGRY +NPNRLQHYYQFQV++KP+P NLQ LYI+SL+A+G+D  +HD+RF
Sbjct: 61  AYVQPCRRPTDGRYGKNPNRLQHYYQFQVLLKPSPPNLQELYIKSLQAIGLDTKLHDIRF 120

Query: 121 VEDNWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQN 180
           VED+WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIEC+P+SGE+TYGLERLAMY+Q 
Sbjct: 121 VEDDWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECAPVSGELTYGLERLAMYIQG 180

Query: 181 VNSVYDIVFNAIEGQN-VLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLK 239
           V+++Y++ FN+ +G+N + Y DIF Q+EQEYS YNFE+A+ ++LH HFID+E EC+ +LK
Sbjct: 181 VDNIYNLNFNSSDGENQISYRDIFLQTEQEYSYYNFEFADTKLLHQHFIDAECECIAILK 240

Query: 240 KGIPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAF 299
            G PN  +  HLCVFPAYDQCIKASHIFNLL ARGVIS TERQ YI R+R LA+ CGEAF
Sbjct: 241 AGKPNTENGLHLCVFPAYDQCIKASHIFNLLQARGVISVTERQSYIFRVRDLARQCGEAF 300

Query: 300 LMTPNG 305
           L T   
Sbjct: 301 LRTKAA 306


>gi|224824603|ref|ZP_03697710.1| glycyl-tRNA synthetase, alpha subunit [Lutiella nitroferrum 2002]
 gi|224603096|gb|EEG09272.1| glycyl-tRNA synthetase, alpha subunit [Lutiella nitroferrum 2002]
          Length = 296

 Score =  543 bits (1400), Expect = e-152,   Method: Composition-based stats.
 Identities = 172/297 (57%), Positives = 217/297 (73%), Gaps = 11/297 (3%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ IILTL  YW +QGC +LQPYD EVGAGT H +T LRALGP  W AAYVQPSRRP
Sbjct: 1   MLTFQEIILTLQNYWNRQGCALLQPYDTEVGAGTSHTATFLRALGPEPWAAAYVQPSRRP 60

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNRL  ++Q+QV+IKP+P NLQ+LY+ SLK +GIDP +HD+RFVED+WE+PT
Sbjct: 61  KDGRYGENPNRLFQHHQYQVVIKPSPPNLQDLYLGSLKELGIDPTVHDIRFVEDDWENPT 120

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQQV G+EC P+ GE+TYGLERLAMY+Q V +VYD+V+
Sbjct: 121 LGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVLGELTYGLERLAMYLQGVENVYDLVW 180

Query: 190 NA-IEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHR 248
               +G+ + YG++F Q+E E S++ FE++N  +L   F D E E   LL  G+P     
Sbjct: 181 ARMPDGRELSYGNVFLQNEVEQSKFAFEHSNVALLFQQFTDYEAEAKRLLDAGLP----- 235

Query: 249 HHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNG 305
                 P Y+  +KA H FNLLDARG IS TER  YI RIR+LA+   +A+  +   
Sbjct: 236 -----LPGYETILKAGHTFNLLDARGAISVTERAAYIGRIRNLARQVAQAYYDSREA 287


>gi|163794402|ref|ZP_02188373.1| Glycine--tRNA ligase [alpha proteobacterium BAL199]
 gi|159180126|gb|EDP64649.1| Glycine--tRNA ligase [alpha proteobacterium BAL199]
          Length = 304

 Score =  543 bits (1400), Expect = e-152,   Method: Composition-based stats.
 Identities = 194/308 (62%), Positives = 237/308 (76%), Gaps = 11/308 (3%)

Query: 1   MAPIHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLS-WK 59
           M       + L+FQ++ILTL  YWA +GC ILQPYDMEVGAGTFHP+TTLR+LGP   WK
Sbjct: 1   MPDGDRPDSRLAFQSLILTLQTYWASKGCVILQPYDMEVGAGTFHPATTLRSLGPDDIWK 60

Query: 60  AAYVQPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVR 119
           AAYVQPSRRP DGRY ENPNRLQHYYQFQV++KP+P++ Q LY+ SL+A+G+DP+ HD+R
Sbjct: 61  AAYVQPSRRPTDGRYGENPNRLQHYYQFQVLVKPSPVDSQELYLGSLRAIGLDPMQHDIR 120

Query: 120 FVEDNWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQ 179
           FVED+WESPTLGAWGLGWE WCDGME+SQ+TYFQQV GI+C+P+S E+TYGLERLAMY+Q
Sbjct: 121 FVEDDWESPTLGAWGLGWEVWCDGMEVSQYTYFQQVGGIDCAPVSLELTYGLERLAMYIQ 180

Query: 180 NVNSVYDIVFNAIEGQ--NVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDL 237
            V+ VYD+ ++ +       +YGDI+ Q+E E+S YNFEYA+ E+L  HF D+E  C  L
Sbjct: 181 EVDDVYDLDWDGVPKDEGGKVYGDIYKQAELEFSTYNFEYADTEVLFQHFRDAEMACAAL 240

Query: 238 LKKGIPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGE 297
           L    P           PAYDQC+KASH FNLLDARGVIS TERQ YI R+R+LAKAC E
Sbjct: 241 LAAEKP--------MPLPAYDQCMKASHAFNLLDARGVISVTERQAYIGRVRTLAKACCE 292

Query: 298 AFLMTPNG 305
            ++ T   
Sbjct: 293 KWVETSTA 300


>gi|163733325|ref|ZP_02140768.1| glycyl-tRNA synthetase subunit alpha [Roseobacter litoralis Och
           149]
 gi|161393113|gb|EDQ17439.1| glycyl-tRNA synthetase subunit alpha [Roseobacter litoralis Och
           149]
          Length = 313

 Score =  543 bits (1400), Expect = e-152,   Method: Composition-based stats.
 Identities = 188/300 (62%), Positives = 229/300 (76%), Gaps = 2/300 (0%)

Query: 9   NDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRR 68
              SFQ IIL L  YWA +GC ILQPYDMEVGAGTFHP+TTLR+LG   W AAYVQPSRR
Sbjct: 7   TPKSFQEIILRLQDYWAGKGCAILQPYDMEVGAGTFHPATTLRSLGNRPWAAAYVQPSRR 66

Query: 69  PLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESP 128
           P DGRY ++PNR QHYYQFQVIIKP+P +LQ LY+ SL+A+GID  +HD+RFVED+WESP
Sbjct: 67  PTDGRYGDSPNRWQHYYQFQVIIKPSPPDLQELYLGSLRAIGIDMDLHDIRFVEDDWESP 126

Query: 129 TLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIV 188
           TLGAWGLGWE WCDGME+SQFTYFQQV G +C P+SGE+TYGLERLAMY+   +    + 
Sbjct: 127 TLGAWGLGWEVWCDGMEVSQFTYFQQVGGHDCHPVSGELTYGLERLAMYILGADDGNKMP 186

Query: 189 FNAIEGQ-NVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLL-KKGIPNEH 246
           FN       + YGD+F ++E +Y+R+NF+ A+ ++L  HF+D+E EC  +L +     + 
Sbjct: 187 FNDPGCPIPLTYGDVFQEAEAQYARWNFDVADTDVLLQHFVDAEAECARILAQAPDDPKT 246

Query: 247 HRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNGG 306
            R  +   PAYDQCIKASHIFNLLDARGVIS TERQ YI R+R+LAK C +AF+ T  GG
Sbjct: 247 GRRIVMAQPAYDQCIKASHIFNLLDARGVISVTERQAYIGRVRALAKQCADAFVQTRAGG 306


>gi|90581118|ref|ZP_01236917.1| glycyl-tRNA synthetase alpha subunit [Vibrio angustum S14]
 gi|90437639|gb|EAS62831.1| glycyl-tRNA synthetase alpha subunit [Vibrio angustum S14]
          Length = 303

 Score =  543 bits (1400), Expect = e-152,   Method: Composition-based stats.
 Identities = 181/301 (60%), Positives = 220/301 (73%), Gaps = 8/301 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +IL L  YW QQGCTI+QP DMEVGAGT HP T LRALGP    AAYVQ
Sbjct: 1   MQKYDIKTFQGMILALQDYWGQQGCTIVQPLDMEVGAGTSHPMTCLRALGPEPIAAAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQV++KP+P N+Q LY+ SL+ +GID  +HD+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVMLKPSPDNIQELYLGSLEVLGIDTKVHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYG+ERLAMY+QNV+SV
Sbjct: 121 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGIERLAMYIQNVDSV 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V+       V YGDIF Q+E E S YNFE+A+ + L   F   EKE + LL+   P 
Sbjct: 181 YDLVWTDGPLGKVTYGDIFHQNEVEQSTYNFEHADVDFLFTFFDQCEKESIKLLELEQPL 240

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                      AY++ +KA+H FNLLDAR  IS TERQRYILRIR++ K   EA+  +  
Sbjct: 241 PLP--------AYERILKAAHAFNLLDARKAISVTERQRYILRIRNVTKQVAEAYYASRE 292

Query: 305 G 305
            
Sbjct: 293 A 293


>gi|94309393|ref|YP_582603.1| glycyl-tRNA synthetase subunit alpha [Cupriavidus metallidurans
           CH34]
 gi|122988060|sp|Q1LR92|SYGA_RALME RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|93353245|gb|ABF07334.1| glycine tRNA synthetase, alpha subunit [Cupriavidus metallidurans
           CH34]
          Length = 317

 Score =  543 bits (1400), Expect = e-152,   Method: Composition-based stats.
 Identities = 170/305 (55%), Positives = 218/305 (71%), Gaps = 9/305 (2%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ +ILTL  YW +QGC +LQP D+EVGAGT H  T LRA+GP  W+AAYVQPSRRP
Sbjct: 1   MLTFQQMILTLQAYWDRQGCALLQPIDLEVGAGTSHVHTFLRAIGPEPWRAAYVQPSRRP 60

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNRLQHYYQ+QV++KP P N+  LY+ SL+A+G+D   +D+RFVED+WE+PT
Sbjct: 61  KDGRYGENPNRLQHYYQYQVVLKPAPENILELYLGSLEALGLDLKQNDIRFVEDDWENPT 120

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQQV GI+C PI+GEITYG+ERLAMY+Q V ++YD+V+
Sbjct: 121 LGAWGLGWEVWLNGMEVTQFTYFQQVGGIDCKPITGEITYGIERLAMYLQKVENIYDLVW 180

Query: 190 NAIEGQN----VLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLL-----KK 240
              +       + YGD++ Q+E E S YNFE++N EIL  HF + E E   L+     K 
Sbjct: 181 TEWQENGETRRLTYGDVYHQNEVEQSTYNFEHSNTEILFRHFAEHESEAKRLMGDTGEKA 240

Query: 241 GIPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFL 300
               E         PAY+Q +KA+H FNLLDARG IS TER  YI RIR+L++   +A+ 
Sbjct: 241 EGAQEKAAGTRLALPAYEQVLKAAHTFNLLDARGAISVTERAAYIGRIRNLSRQVAQAYY 300

Query: 301 MTPNG 305
            +   
Sbjct: 301 DSREA 305


>gi|78049867|ref|YP_366042.1| glycyl-tRNA synthetase subunit alpha [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|325929022|ref|ZP_08190180.1| glycyl-tRNA synthetase alpha chain [Xanthomonas perforans 91-118]
 gi|123583785|sp|Q3BMH1|SYGA_XANC5 RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|78038297|emb|CAJ26042.1| glycyl-tRNA synthetase alpha chain [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|325540622|gb|EGD12206.1| glycyl-tRNA synthetase alpha chain [Xanthomonas perforans 91-118]
          Length = 302

 Score =  543 bits (1400), Expect = e-152,   Method: Composition-based stats.
 Identities = 179/300 (59%), Positives = 226/300 (75%), Gaps = 11/300 (3%)

Query: 6   NKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQP 65
           +++  ++FQ +I TL QYWA+QGC ++QP D+EVGAGTFHP+T LRALGP  W AAYVQP
Sbjct: 4   SRRVPITFQGLIQTLNQYWAEQGCVLIQPLDLEVGAGTFHPATFLRALGPEPWNAAYVQP 63

Query: 66  SRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNW 125
           SRRP DGRY ENPNRLQ YYQ+QV +KPNP N+Q+LY+ SL+A+GIDPL+HD+RFVEDNW
Sbjct: 64  SRRPTDGRYGENPNRLQRYYQYQVAMKPNPDNIQDLYLGSLQALGIDPLVHDLRFVEDNW 123

Query: 126 ESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVY 185
           ESPTLGAWGLGWE W +GME++QFTYFQQ  G+EC P+ GEITYGLERL MY+Q+ ++VY
Sbjct: 124 ESPTLGAWGLGWEVWLNGMEVTQFTYFQQAGGLECKPVLGEITYGLERLCMYLQSCDNVY 183

Query: 186 DIVFN-AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           ++V+    +G  V YGD++ Q+E E S YNFE+AN   L + F   E E   L++ G+P 
Sbjct: 184 ELVWTYGPDGAAVTYGDVYHQNEVEQSTYNFEHANVAELFHRFDACEAEARHLVEVGLP- 242

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY+Q  KASH FNLLDAR  IS TERQRYILR+R+LA+   +A+     
Sbjct: 243 ---------LPAYEQVTKASHAFNLLDARRAISVTERQRYILRVRALAQGVAQAYYAQRE 293


>gi|269798038|ref|YP_003311938.1| glycyl-tRNA synthetase, subunit alpha [Veillonella parvula DSM
           2008]
 gi|269094667|gb|ACZ24658.1| glycyl-tRNA synthetase, alpha subunit [Veillonella parvula DSM
           2008]
          Length = 291

 Score =  543 bits (1400), Expect = e-152,   Method: Composition-based stats.
 Identities = 159/294 (54%), Positives = 205/294 (69%), Gaps = 14/294 (4%)

Query: 11  LSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPL 70
           ++FQ IIL L ++W+ QGC +  PYD+E GAGT +P+T L A+GP  W   YV+PSRRP 
Sbjct: 1   MTFQEIILNLQKFWSDQGCIVQNPYDIEKGAGTMNPATFLHAIGPEPWSVCYVEPSRRPA 60

Query: 71  DGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTL 130
           DGRY +NPNRL  ++QFQVI+KP+P N+Q LY++SL A+GI    HD+RFVEDNWESPTL
Sbjct: 61  DGRYGDNPNRLFQHHQFQVIVKPSPDNIQELYLQSLAALGIHAEDHDIRFVEDNWESPTL 120

Query: 131 GAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFN 190
           GAWGLGWE W DGME++QFTYFQQV  I+C P+S EITYGLERLAMY+Q V +VYD+ +N
Sbjct: 121 GAWGLGWEVWLDGMEVTQFTYFQQVGSIDCKPVSVEITYGLERLAMYIQGVENVYDLKWN 180

Query: 191 AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHH 250
               +NV YGD++  +E E S YNFE A+ ++L   F   E E   +   G         
Sbjct: 181 ----ENVTYGDVWHANEVEQSVYNFELADTDMLFKLFDMYEAEAKRVCGAGY-------- 228

Query: 251 LCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
             V PAYD  +K SH FNLLD+RG IS +ER  +I R+R+LA+ C + +L    
Sbjct: 229 --VLPAYDYVLKCSHTFNLLDSRGAISISERTAFIGRVRALARICAQQYLAKRE 280


>gi|21244928|ref|NP_644510.1| glycyl-tRNA synthetase subunit alpha [Xanthomonas axonopodis pv.
           citri str. 306]
 gi|25009298|sp|Q8PEX9|SYGA_XANAC RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|21110643|gb|AAM39046.1| glycyl-tRNA synthetase alpha chain [Xanthomonas axonopodis pv.
           citri str. 306]
          Length = 302

 Score =  543 bits (1399), Expect = e-152,   Method: Composition-based stats.
 Identities = 179/300 (59%), Positives = 226/300 (75%), Gaps = 11/300 (3%)

Query: 6   NKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQP 65
           +++  ++FQ +I TL QYWA+QGC ++QP D+EVGAGTFHP+T LRALGP  W AAYVQP
Sbjct: 4   SRRVPITFQGLIQTLNQYWAEQGCVLIQPLDLEVGAGTFHPATFLRALGPEPWNAAYVQP 63

Query: 66  SRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNW 125
           SRRP DGRY ENPNRLQ YYQ+QV +KPNP N+Q+LY+ SL+A+GIDPL+HD+RFVEDNW
Sbjct: 64  SRRPTDGRYGENPNRLQRYYQYQVAMKPNPDNIQDLYLGSLQALGIDPLVHDLRFVEDNW 123

Query: 126 ESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVY 185
           ESPTLGAWGLGWE W +GME++QFTYFQQ  G+EC P+ GEITYGLERL MY+Q+ ++VY
Sbjct: 124 ESPTLGAWGLGWEVWLNGMEVTQFTYFQQAGGLECKPVLGEITYGLERLCMYLQSCDNVY 183

Query: 186 DIVFN-AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           ++V+    +G  V YGD++ Q+E E S YNFE+AN   L + F   E E   L++ G+P 
Sbjct: 184 ELVWTYGPDGAAVTYGDVYHQNEVEQSTYNFEHANVAELFHRFDACEAEARHLVEVGLP- 242

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY+Q  KASH FNLLDAR  IS TERQRYILR+R+LA+   +A+     
Sbjct: 243 ---------LPAYEQVTKASHAFNLLDARRAISVTERQRYILRVRALAQGVAQAYYAQRE 293


>gi|170724383|ref|YP_001758409.1| glycyl-tRNA synthetase subunit alpha [Shewanella woodyi ATCC 51908]
 gi|169809730|gb|ACA84314.1| glycyl-tRNA synthetase, alpha subunit [Shewanella woodyi ATCC
           51908]
          Length = 287

 Score =  543 bits (1399), Expect = e-152,   Method: Composition-based stats.
 Identities = 181/288 (62%), Positives = 217/288 (75%), Gaps = 8/288 (2%)

Query: 18  LTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPLDGRYAEN 77
           +TL +YWAQQGC I+QP DMEVGAGTFHP T LR+LGP    +AYVQP RRP DGRY EN
Sbjct: 1   MTLQEYWAQQGCAIVQPLDMEVGAGTFHPQTFLRSLGPEPMSSAYVQPCRRPTDGRYGEN 60

Query: 78  PNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTLGAWGLGW 137
           PNRLQHYYQ+QV++KP+P N+Q LY+ SL+A+G+D  +HDVRFVEDNWESPTLGAWGLGW
Sbjct: 61  PNRLQHYYQYQVVLKPSPSNIQELYLGSLEALGVDMNVHDVRFVEDNWESPTLGAWGLGW 120

Query: 138 ECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFNAIEGQNV 197
           E W +GME+SQFTYFQQV G+ECSP++GEITYGLERLAMY+Q V+SVYD+V+       V
Sbjct: 121 EVWLNGMEVSQFTYFQQVGGLECSPVTGEITYGLERLAMYIQEVDSVYDLVWTDGPMGKV 180

Query: 198 LYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHHLCVFPAY 257
           +YGDIF Q+E E S YNFE+AN ++L   F D E  C  LL    P           PAY
Sbjct: 181 MYGDIFHQNEVEQSTYNFEHANVDVLFKMFDDCEVACQRLLTLEKP--------LPLPAY 232

Query: 258 DQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNG 305
           +Q +KASH FNLLDAR  IS TERQRYILR+R++AK   E++      
Sbjct: 233 EQVMKASHAFNLLDARHAISVTERQRYILRVRTMAKGVAESYYQAREA 280


>gi|325267960|ref|ZP_08134608.1| glycyl-tRNA synthetase alpha subunit [Kingella denitrificans ATCC
           33394]
 gi|324980563|gb|EGC16227.1| glycyl-tRNA synthetase alpha subunit [Kingella denitrificans ATCC
           33394]
          Length = 298

 Score =  543 bits (1399), Expect = e-152,   Method: Composition-based stats.
 Identities = 170/297 (57%), Positives = 213/297 (71%), Gaps = 8/297 (2%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ II  L  YWA QGC ++QP+D+EVGAGT HPST LRALGP  W  AYVQPSRRP
Sbjct: 1   MLTFQQIIFKLQTYWANQGCAVIQPFDIEVGAGTSHPSTCLRALGPEPWNVAYVQPSRRP 60

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY +NPNRLQHYYQFQV +KP P N+Q+LY+ SL+ +GIDP +HD+RFVED+WE+PT
Sbjct: 61  KDGRYGDNPNRLQHYYQFQVALKPAPDNIQDLYLGSLQELGIDPTVHDIRFVEDDWENPT 120

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQQV GI+CSP+ GEITYG+ERLAMY+Q V +VYD+V+
Sbjct: 121 LGAWGLGWEVWLNGMEVTQFTYFQQVGGIDCSPVLGEITYGIERLAMYLQGVENVYDLVW 180

Query: 190 N-AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHR 248
               +G  + YGD++ Q+E E S YNFEY++   L + F   E +   LL          
Sbjct: 181 TITPQGTPLTYGDVYRQNEVEQSTYNFEYSDVAWLLDQFNGFEAQAKRLLD-------TE 233

Query: 249 HHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNG 305
                 PAY+  +KA H FNLLDARG IS TER  YI RIR+L++   + F+ +   
Sbjct: 234 DAQLALPAYELVLKAGHTFNLLDARGAISVTERATYIGRIRALSRQVAQKFVASREA 290


>gi|152983462|ref|YP_001352116.1| glycyl-tRNA synthetase subunit alpha [Janthinobacterium sp.
           Marseille]
 gi|166200227|sp|A6SV19|SYGA_JANMA RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|151283539|gb|ABR91949.1| glycyl-tRNA synthetase, alpha chain [Janthinobacterium sp.
           Marseille]
          Length = 305

 Score =  543 bits (1399), Expect = e-152,   Method: Composition-based stats.
 Identities = 170/295 (57%), Positives = 217/295 (73%), Gaps = 14/295 (4%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ IILTL +YW  QGC +LQPYDMEVGAGT H +T LRA+GP  W+AAYVQPSRRP
Sbjct: 1   MLTFQQIILTLQKYWDAQGCALLQPYDMEVGAGTSHTATFLRAIGPEPWRAAYVQPSRRP 60

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNRLQHYYQ+QV++KP P N+  LY+ SL+A+G D   +D+RFVED+WE+PT
Sbjct: 61  KDGRYGENPNRLQHYYQYQVVLKPAPANILELYLGSLEALGFDLKANDIRFVEDDWENPT 120

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQQV GI C PI+GEITYGLERLAMY+Q V++VYD+ +
Sbjct: 121 LGAWGLGWEVWLNGMEVTQFTYFQQVGGINCKPITGEITYGLERLAMYLQGVDNVYDLRW 180

Query: 190 NAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRH 249
                  + YGD++ Q+E E S YNFE+++ + L   F   EK+ L+L+           
Sbjct: 181 T----DKLSYGDVYKQNEIEQSTYNFEHSDADFLFTAFGAHEKQALNLID---------- 226

Query: 250 HLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
           +    PAY+Q +KA+H FNLLDARG IS TER  YI RIR+LA++   ++L +  
Sbjct: 227 NKLALPAYEQVLKAAHTFNLLDARGAISVTERAAYIGRIRNLARSVARSYLDSRA 281


>gi|157373156|ref|YP_001471756.1| glycyl-tRNA synthetase subunit alpha [Shewanella sediminis HAW-EB3]
 gi|157315530|gb|ABV34628.1| Glycine--tRNA ligase [Shewanella sediminis HAW-EB3]
          Length = 287

 Score =  543 bits (1399), Expect = e-152,   Method: Composition-based stats.
 Identities = 183/288 (63%), Positives = 215/288 (74%), Gaps = 8/288 (2%)

Query: 18  LTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPLDGRYAEN 77
           +TL ++WAQQGC I+QP DMEVGAGTFHP T LRALGP     AYVQPSRRP DGRY +N
Sbjct: 1   MTLQEFWAQQGCAIVQPLDMEVGAGTFHPMTFLRALGPEPMSCAYVQPSRRPTDGRYGDN 60

Query: 78  PNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTLGAWGLGW 137
           PNRLQH+YQFQV++KP+P N+Q LY+ SL A GID  IHDVRFVEDNWESPTLGAWGLGW
Sbjct: 61  PNRLQHFYQFQVVLKPSPDNIQELYLGSLAAAGIDMDIHDVRFVEDNWESPTLGAWGLGW 120

Query: 138 ECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFNAIEGQNV 197
           E W +GME+SQFTYFQQV G+EC P++GEITYGLERLAMY+Q V++VYD+V+       V
Sbjct: 121 EVWLNGMEVSQFTYFQQVGGLECKPVTGEITYGLERLAMYIQEVDNVYDLVWTDGPMGKV 180

Query: 198 LYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHHLCVFPAY 257
           +YGDIF Q+E E S YNFE+AN E+L   F D EK C  LL    P           PAY
Sbjct: 181 MYGDIFHQNEVEQSAYNFEHANVEVLFRTFDDCEKACQHLLNLEKP--------LPLPAY 232

Query: 258 DQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNG 305
           +Q +KASH FNLLDAR  IS TERQRYILR+R++AK   E++      
Sbjct: 233 EQVMKASHAFNLLDARHAISVTERQRYILRVRTMAKGVAESYYQAREA 280


>gi|186475175|ref|YP_001856645.1| glycyl-tRNA synthetase subunit alpha [Burkholderia phymatum STM815]
 gi|184191634|gb|ACC69599.1| glycyl-tRNA synthetase, alpha subunit [Burkholderia phymatum
           STM815]
          Length = 335

 Score =  543 bits (1399), Expect = e-152,   Method: Composition-based stats.
 Identities = 168/303 (55%), Positives = 215/303 (70%), Gaps = 18/303 (5%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ IILTL  YW +QGC +LQP DMEVGAGT H  T LRA+GP  W+AAYVQPSRRP
Sbjct: 1   MLTFQQIILTLQSYWDKQGCALLQPIDMEVGAGTSHVHTFLRAVGPEPWRAAYVQPSRRP 60

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNRLQHYYQ+QV++KP P N+ +LY+ SL+A+G D   +DVRFVED+WE+PT
Sbjct: 61  KDGRYGENPNRLQHYYQYQVVLKPAPENILDLYLGSLEALGFDLKQNDVRFVEDDWENPT 120

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQQV G++C P+ GEITYGLERLAMY+Q V +VYD+++
Sbjct: 121 LGAWGLGWEVWLNGMEVTQFTYFQQVGGLDCKPVLGEITYGLERLAMYLQKVENVYDLIW 180

Query: 190 --------NAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKG 241
                   N  E + + YGD++ Q+E E S YNFE+AN ++L   F   E E   +++  
Sbjct: 181 TEWEEQGPNGPEMRRLTYGDVYHQNEVEQSTYNFEHANTDLLFTFFNSYESEAKRMIE-- 238

Query: 242 IPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLM 301
                        PAY+  +KA+H FNLLDARG IS TER  YI RIR+L++   +A+  
Sbjct: 239 --------VPLALPAYELVLKAAHTFNLLDARGAISVTERAAYIGRIRALSRLVAQAYYD 290

Query: 302 TPN 304
           +  
Sbjct: 291 SRE 293


>gi|323524768|ref|YP_004226921.1| glycyl-tRNA synthetase subunit alpha [Burkholderia sp. CCGE1001]
 gi|323381770|gb|ADX53861.1| glycyl-tRNA synthetase, alpha subunit [Burkholderia sp. CCGE1001]
          Length = 335

 Score =  543 bits (1399), Expect = e-152,   Method: Composition-based stats.
 Identities = 169/303 (55%), Positives = 215/303 (70%), Gaps = 18/303 (5%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ IILTL  YW +QGC +LQP DMEVGAGT H  T LRA+GP  W+AAYVQPSRRP
Sbjct: 1   MLTFQQIILTLQSYWDKQGCALLQPIDMEVGAGTSHVHTFLRAVGPEPWRAAYVQPSRRP 60

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNRLQHYYQ+QV++KP P N+ +LY+ SL+A+G D   +DVRFVED+WE+PT
Sbjct: 61  KDGRYGENPNRLQHYYQYQVVLKPAPENILDLYLGSLEALGFDLKQNDVRFVEDDWENPT 120

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQQV G++C P+ GEITYGLERLAMY+Q V +VYD+V+
Sbjct: 121 LGAWGLGWEVWLNGMEVTQFTYFQQVGGLDCKPVLGEITYGLERLAMYLQKVENVYDLVW 180

Query: 190 --------NAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKG 241
                   N  E + + YGD++ Q+E E S YNFE+AN ++L + F   E E   +++  
Sbjct: 181 TEWEEQGPNGPEMRRLTYGDVYHQNEVEQSTYNFEHANVDLLFSFFNSYEAEAKRMIEAQ 240

Query: 242 IPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLM 301
                        PAY+  +KA H FNLLDARG IS TER  YI RIR+L++   +A+  
Sbjct: 241 ----------IALPAYELVLKAGHTFNLLDARGAISVTERAAYIGRIRALSRLVAQAYYD 290

Query: 302 TPN 304
           +  
Sbjct: 291 SRE 293


>gi|221065031|ref|ZP_03541136.1| glycyl-tRNA synthetase, alpha subunit [Comamonas testosteroni KF-1]
 gi|220710054|gb|EED65422.1| glycyl-tRNA synthetase, alpha subunit [Comamonas testosteroni KF-1]
          Length = 312

 Score =  543 bits (1399), Expect = e-152,   Method: Composition-based stats.
 Identities = 175/295 (59%), Positives = 215/295 (72%), Gaps = 14/295 (4%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ IIL L  YWA+QGC +LQPYDMEVGAGT H +T LRA+GP  WKAAYVQPSRRP
Sbjct: 1   MLTFQQIILKLQSYWAEQGCALLQPYDMEVGAGTSHTATFLRAIGPEPWKAAYVQPSRRP 60

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNRLQHYYQFQV++KP P N+  LY+ SL+A+G D   +D+RFVED+WE+PT
Sbjct: 61  KDGRYGENPNRLQHYYQFQVVLKPAPDNILELYLGSLEALGFDLKKNDIRFVEDDWENPT 120

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQQV GI+C P +GEITYGLERLAMY+Q   SVYD+V+
Sbjct: 121 LGAWGLGWEVWLNGMEVTQFTYFQQVAGIDCKPATGEITYGLERLAMYLQGKESVYDLVY 180

Query: 190 NAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRH 249
                  + YGD+F Q+E E S YNFE++N E L + F   E     L+   +       
Sbjct: 181 T----DGLSYGDVFHQNEVEQSTYNFEHSNAEFLFSAFAAHEGTANQLIDAQL------- 229

Query: 250 HLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                PAY+Q +KA+H FNLLDARG IS TER  YI RIR+LA+A G+++L +  
Sbjct: 230 ---ALPAYEQVLKAAHTFNLLDARGAISVTERAAYIGRIRNLARAVGKSYLDSRA 281


>gi|299532683|ref|ZP_07046071.1| glycyl-tRNA synthetase subunit alpha [Comamonas testosteroni S44]
 gi|298719318|gb|EFI60287.1| glycyl-tRNA synthetase subunit alpha [Comamonas testosteroni S44]
          Length = 312

 Score =  543 bits (1399), Expect = e-152,   Method: Composition-based stats.
 Identities = 175/295 (59%), Positives = 215/295 (72%), Gaps = 14/295 (4%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ IIL L  YWA+QGC +LQPYDMEVGAGT H +T LRA+GP  WKAAYVQPSRRP
Sbjct: 1   MLTFQQIILKLQSYWAEQGCALLQPYDMEVGAGTSHTATFLRAIGPEPWKAAYVQPSRRP 60

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNRLQHYYQFQV++KP P N+  LY+ SL+A+G D   +D+RFVED+WE+PT
Sbjct: 61  KDGRYGENPNRLQHYYQFQVVLKPAPDNILELYLGSLEALGFDLKKNDIRFVEDDWENPT 120

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQQV GI+C P +GEITYGLERLAMY+Q   SVYD+V+
Sbjct: 121 LGAWGLGWEVWLNGMEVTQFTYFQQVAGIDCKPATGEITYGLERLAMYLQGKESVYDLVY 180

Query: 190 NAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRH 249
                  + YGD+F Q+E E S YNFE++N E L + F   E     L+   +       
Sbjct: 181 T----DGLSYGDVFHQNEVEQSTYNFEHSNAEFLFSAFAAHEGTANQLIDAQL------- 229

Query: 250 HLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                PAY+Q +KA+H FNLLDARG IS TER  YI RIR+LA+A G+++L +  
Sbjct: 230 ---ALPAYEQVLKAAHTFNLLDARGAISVTERAAYIGRIRNLARAVGKSYLDSRA 281


>gi|325577398|ref|ZP_08147805.1| glycyl-tRNA synthetase alpha subunit [Haemophilus parainfluenzae
           ATCC 33392]
 gi|301154909|emb|CBW14372.1| glycine tRNA synthetase, alpha subunit [Haemophilus parainfluenzae
           T3T1]
 gi|325160627|gb|EGC72750.1| glycyl-tRNA synthetase alpha subunit [Haemophilus parainfluenzae
           ATCC 33392]
          Length = 302

 Score =  543 bits (1399), Expect = e-152,   Method: Composition-based stats.
 Identities = 177/302 (58%), Positives = 216/302 (71%), Gaps = 8/302 (2%)

Query: 4   IHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYV 63
           +  K N  +FQ +IL L +YWA QGCT++QP+DMEVGAGT HP T LRALGP     AYV
Sbjct: 1   MSTKFNVKTFQGMILALQEYWANQGCTVVQPFDMEVGAGTSHPMTALRALGPEPMAFAYV 60

Query: 64  QPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVED 123
           QPSRRP DGRY ENPNRLQHYYQFQV+IKP+P N+Q LY+ SL+ +G DP  +D+RFVED
Sbjct: 61  QPSRRPTDGRYGENPNRLQHYYQFQVVIKPSPDNIQELYLGSLEMLGFDPTQNDIRFVED 120

Query: 124 NWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNS 183
           NWE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GE+TYGLERLAMY+Q V+S
Sbjct: 121 NWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEVTYGLERLAMYIQGVDS 180

Query: 184 VYDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIP 243
           VYD+V++        YGD+F Q+E E S YNFEYA+ + L   F   EKE          
Sbjct: 181 VYDLVWSDGPLGKTTYGDVFHQNEVEQSTYNFEYADTDFLFYCFDQYEKEAKS------- 233

Query: 244 NEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTP 303
                      PAY++ +KA+H FNLLDAR  IS TERQRYILRIR+L K   EA+  + 
Sbjct: 234 -LLELERPLPLPAYERILKAAHSFNLLDARKAISVTERQRYILRIRALTKGVAEAYYASR 292

Query: 304 NG 305
             
Sbjct: 293 EA 294


>gi|295675500|ref|YP_003604024.1| glycyl-tRNA synthetase, alpha subunit [Burkholderia sp. CCGE1002]
 gi|295435343|gb|ADG14513.1| glycyl-tRNA synthetase, alpha subunit [Burkholderia sp. CCGE1002]
          Length = 335

 Score =  543 bits (1399), Expect = e-152,   Method: Composition-based stats.
 Identities = 169/303 (55%), Positives = 213/303 (70%), Gaps = 18/303 (5%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ IILTL  YW +QGC +LQP DMEVGAGT H  T LRA+GP  W+AAYVQPSRRP
Sbjct: 1   MLTFQQIILTLQSYWDKQGCALLQPIDMEVGAGTSHVHTFLRAIGPEPWRAAYVQPSRRP 60

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNRLQHYYQ+QV++KP P N+ +LY+ SL+A+G D   +DVRFVED+WE+PT
Sbjct: 61  KDGRYGENPNRLQHYYQYQVVLKPAPENILDLYLGSLEALGFDLKQNDVRFVEDDWENPT 120

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQQV G++C P+ GEITYGLERLAMY+Q V +VYD+V+
Sbjct: 121 LGAWGLGWEVWLNGMEVTQFTYFQQVGGLDCKPVLGEITYGLERLAMYLQKVENVYDLVW 180

Query: 190 --------NAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKG 241
                   N  E + + YGD++ Q+E E S YNFE+AN ++L   F   E E   ++   
Sbjct: 181 TEWEEQGPNGPELRRLTYGDVYHQNEVEQSTYNFEHANVDLLFTFFNSYEAEAKRMIDAQ 240

Query: 242 IPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLM 301
                        PAY+  +KA H FNLLDARG IS TER  YI RIR+L++   +A+  
Sbjct: 241 ----------IALPAYELVLKAGHTFNLLDARGAISVTERAAYIGRIRALSRLVAQAYYD 290

Query: 302 TPN 304
           +  
Sbjct: 291 SRE 293


>gi|167835499|ref|ZP_02462382.1| glycyl-tRNA synthetase subunit alpha [Burkholderia thailandensis
           MSMB43]
          Length = 335

 Score =  543 bits (1399), Expect = e-152,   Method: Composition-based stats.
 Identities = 169/303 (55%), Positives = 215/303 (70%), Gaps = 18/303 (5%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ IILTL  YW +QGC +LQP DMEVGAGT H  T LRA+GP  W+AAYVQPSRRP
Sbjct: 1   MLTFQQIILTLQSYWDRQGCALLQPIDMEVGAGTSHVHTFLRAIGPEPWRAAYVQPSRRP 60

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNRLQHYYQ+QV++KP P N+ +LY+ SL+A+G D   +DVRFVED+WE+PT
Sbjct: 61  KDGRYGENPNRLQHYYQYQVVLKPAPENILDLYLGSLEALGFDLKQNDVRFVEDDWENPT 120

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQQV G++C P+ GEITYGLERLAMY+Q V +VYD+++
Sbjct: 121 LGAWGLGWEVWLNGMEVTQFTYFQQVGGLDCKPVLGEITYGLERLAMYLQKVENVYDLIW 180

Query: 190 --------NAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKG 241
                   N  E + + YGD++ Q+E E S YNFE+AN E+L   F   E E   +++  
Sbjct: 181 TEWEEPGPNGPELRRLTYGDVYHQNEVEQSTYNFEHANVELLFTFFNSYESEAKRMIEAQ 240

Query: 242 IPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLM 301
           +            PAY+  +KA H FNLLDARG IS TER  YI RIR+L++   +A+  
Sbjct: 241 L----------ALPAYELVLKAGHTFNLLDARGAISVTERAAYIGRIRALSRLVAQAYYD 290

Query: 302 TPN 304
           +  
Sbjct: 291 SRE 293


>gi|300705115|ref|YP_003746718.1| glycine tRNA synthetase subunit alpha [Ralstonia solanacearum
           CFBP2957]
 gi|299072779|emb|CBJ44134.1| glycine tRNA synthetase, alpha subunit [Ralstonia solanacearum
           CFBP2957]
          Length = 325

 Score =  542 bits (1398), Expect = e-152,   Method: Composition-based stats.
 Identities = 166/306 (54%), Positives = 216/306 (70%), Gaps = 11/306 (3%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ +IL L  YW  QGC +LQP D+EVGAGT H  T LRA+GP  W+AAYVQPSRRP
Sbjct: 1   MLTFQQLILKLQSYWDAQGCALLQPIDLEVGAGTSHVHTFLRAIGPEPWRAAYVQPSRRP 60

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNRLQHYYQ+QV++KP P N+ +LY+ SL A+G+D   +DVRFVED+WE+PT
Sbjct: 61  KDGRYGENPNRLQHYYQYQVVLKPAPENILDLYLGSLAALGLDLKQNDVRFVEDDWENPT 120

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQQV G++C PI+GEITYG+ERLAMY+Q V ++YD+V+
Sbjct: 121 LGAWGLGWEVWLNGMEVTQFTYFQQVGGLDCKPITGEITYGIERLAMYLQQVENIYDLVW 180

Query: 190 NAIEGQN--------VLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLL--- 238
              E           + YGD++ Q+E E S YNFE+A+  +L   F + E E   L+   
Sbjct: 181 TEWEEPGPNGPVKRRLTYGDVYHQNEVEQSTYNFEHADTAVLFRRFAEHEAEAKRLMGVR 240

Query: 239 KKGIPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEA 298
           ++G  ++         PAY+Q +KA H FNLLDARG IS TER  YI RIR+L++   +A
Sbjct: 241 EEGAADDGTPVRQLALPAYEQVLKAGHTFNLLDARGAISVTERAAYIGRIRNLSRLVAQA 300

Query: 299 FLMTPN 304
           +  +  
Sbjct: 301 YYDSRE 306


>gi|188591267|ref|YP_001795867.1| glycyl-tRNA synthetase subunit alpha [Cupriavidus taiwanensis LMG
           19424]
 gi|238692936|sp|B2AH98|SYGA_CUPTR RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|170938161|emb|CAP63147.1| glycine tRNA synthetase, alpha subunit [Cupriavidus taiwanensis LMG
           19424]
          Length = 316

 Score =  542 bits (1398), Expect = e-152,   Method: Composition-based stats.
 Identities = 170/302 (56%), Positives = 216/302 (71%), Gaps = 6/302 (1%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ +ILTL  YW +QGC +LQP D+EVGAGT H  T LRA+GP  W+AAYVQPSRRP
Sbjct: 1   MLTFQQMILTLQAYWDRQGCALLQPIDLEVGAGTSHVHTFLRAIGPEPWRAAYVQPSRRP 60

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNRLQHYYQ+QV++KP P N+  LY+ SL+A+G+D   +D+RFVED+WE+PT
Sbjct: 61  KDGRYGENPNRLQHYYQYQVVLKPAPENILVLYLGSLEALGLDLKQNDIRFVEDDWENPT 120

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQQV GI+C PI+GEITYG+ERLAMY+Q V +VYD+V+
Sbjct: 121 LGAWGLGWEVWLNGMEVTQFTYFQQVGGIDCKPITGEITYGIERLAMYLQKVENVYDLVW 180

Query: 190 NAIEGQN----VLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGI--P 243
                      + YGD++ Q+E E S YNFE++N EIL  HF + E E   L+  G    
Sbjct: 181 TEWVENGETRRLTYGDVYHQNEVEQSTYNFEHSNTEILFRHFAEHEGEAKRLMGNGDGAD 240

Query: 244 NEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTP 303
                      PAY+Q +KA+H FNLLDARG IS TER  YI RIR+L++   +A+  + 
Sbjct: 241 AAAETGTRLALPAYEQVLKAAHTFNLLDARGAISVTERAAYIGRIRNLSRQVAQAYYDSR 300

Query: 304 NG 305
             
Sbjct: 301 EA 302


>gi|294624285|ref|ZP_06702991.1| glycyl-tRNA synthetase alpha subunit [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|292601415|gb|EFF45446.1| glycyl-tRNA synthetase alpha subunit [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
          Length = 302

 Score =  542 bits (1398), Expect = e-152,   Method: Composition-based stats.
 Identities = 179/300 (59%), Positives = 225/300 (75%), Gaps = 11/300 (3%)

Query: 6   NKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQP 65
           +++  ++FQ +I TL QYWA+QGC ++QP D+EVGAGTFHP+T LRALGP  W AAYVQP
Sbjct: 4   SRRVPITFQGLIQTLNQYWAEQGCVLIQPLDLEVGAGTFHPATFLRALGPEPWNAAYVQP 63

Query: 66  SRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNW 125
           SRRP DGRY ENPNRLQ YYQ+QV +KPNP N+Q+LY+ SL+A+GIDPL+HD+RFVEDNW
Sbjct: 64  SRRPTDGRYGENPNRLQRYYQYQVAMKPNPDNIQDLYLGSLQALGIDPLVHDLRFVEDNW 123

Query: 126 ESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVY 185
           ESPTLGAWGLGWE W +GME++QFTYFQQ  G+EC P+ GEITYGLERL MY+Q+ ++VY
Sbjct: 124 ESPTLGAWGLGWEVWLNGMEVTQFTYFQQAGGLECKPVLGEITYGLERLCMYLQSCDNVY 183

Query: 186 DIVFN-AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           ++V+    +G  V YGD++ Q+E E S YNFE+AN   L + F   E E   L++ G+P 
Sbjct: 184 ELVWTYGPDGAAVTYGDVYHQNEVEQSTYNFEHANVAELFHRFDACEAEARHLVEVGLP- 242

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY+Q  KASH FNLLDAR  IS TERQRYILR+R+LA+    A+     
Sbjct: 243 ---------LPAYEQVTKASHAFNLLDARRAISVTERQRYILRVRALAQGVARAYYAQRE 293


>gi|307728480|ref|YP_003905704.1| glycyl-tRNA synthetase subunit alpha [Burkholderia sp. CCGE1003]
 gi|307583015|gb|ADN56413.1| glycyl-tRNA synthetase, alpha subunit [Burkholderia sp. CCGE1003]
          Length = 335

 Score =  542 bits (1398), Expect = e-152,   Method: Composition-based stats.
 Identities = 169/303 (55%), Positives = 214/303 (70%), Gaps = 18/303 (5%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ IILTL  YW +QGC +LQP DMEVGAGT H  T LRA+GP  W+AAYVQPSRRP
Sbjct: 1   MLTFQQIILTLQSYWDKQGCALLQPIDMEVGAGTSHVHTFLRAVGPEPWRAAYVQPSRRP 60

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNRLQHYYQ+QV++KP P N+ +LY+ SL+A+G D   +DVRFVED+WE+PT
Sbjct: 61  KDGRYGENPNRLQHYYQYQVVLKPAPENILDLYLGSLEALGFDLQQNDVRFVEDDWENPT 120

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQQV G++C P+ GEITYGLERLAMY+Q V +VYD+V+
Sbjct: 121 LGAWGLGWEVWLNGMEVTQFTYFQQVGGLDCKPVLGEITYGLERLAMYLQKVENVYDLVW 180

Query: 190 --------NAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKG 241
                   N  E + + YGD++ Q+E E S YNFE+AN ++L   F   E E   +++  
Sbjct: 181 TEWEEQGPNGPEMRRLTYGDVYHQNEVEQSTYNFEHANVDLLFTFFNSYEAEAKRMIEAQ 240

Query: 242 IPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLM 301
                        PAY+  +KA H FNLLDARG IS TER  YI RIR+L++   +A+  
Sbjct: 241 ----------IALPAYELVLKAGHTFNLLDARGAISVTERAAYIGRIRALSRLVAQAYYD 290

Query: 302 TPN 304
           +  
Sbjct: 291 SRE 293


>gi|330839433|ref|YP_004414013.1| Glycyl-tRNA synthetase alpha subunit [Selenomonas sputigena ATCC
           35185]
 gi|329747197|gb|AEC00554.1| Glycyl-tRNA synthetase alpha subunit [Selenomonas sputigena ATCC
           35185]
          Length = 293

 Score =  542 bits (1398), Expect = e-152,   Method: Composition-based stats.
 Identities = 163/294 (55%), Positives = 211/294 (71%), Gaps = 14/294 (4%)

Query: 11  LSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPL 70
           + FQ IIL L ++W++QGC + QPYD+E GAGT +PST LR LGP  W  AYV+PSRRP 
Sbjct: 1   MKFQEIILALQKFWSEQGCILAQPYDVEKGAGTMNPSTFLRVLGPEPWNVAYVEPSRRPA 60

Query: 71  DGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTL 130
           DGRY +NPNRL  ++QFQVI+KP+P N+Q LY+ESL+++GIDP  HD+RFVEDNWESPTL
Sbjct: 61  DGRYGDNPNRLYQHHQFQVIMKPSPDNIQELYLESLESLGIDPKQHDIRFVEDNWESPTL 120

Query: 131 GAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFN 190
           GAWGLGWE W DGMEI+QFTYFQQV  ++  P+S EITYGLERLAMY+Q V +V+DI + 
Sbjct: 121 GAWGLGWEVWLDGMEITQFTYFQQVGSVDVKPVSSEITYGLERLAMYIQGVENVFDIQWT 180

Query: 191 AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHH 250
           A    +  YGD+F Q+E E S Y+F+ ++  +L + F   EKE + +++ G         
Sbjct: 181 A----DYTYGDVFHQNEVEQSAYSFDLSDEALLFDLFDKYEKEAVRIIELGR-------- 228

Query: 251 LCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
             V PAYD  +K SH FNLLDARG IS +ER  +I R+R LA+ C + +L    
Sbjct: 229 --VHPAYDYVLKCSHAFNLLDARGAISVSERTAFIGRVRRLARLCAQCYLKQRE 280


>gi|209519015|ref|ZP_03267823.1| glycyl-tRNA synthetase, alpha subunit [Burkholderia sp. H160]
 gi|209500527|gb|EEA00575.1| glycyl-tRNA synthetase, alpha subunit [Burkholderia sp. H160]
          Length = 335

 Score =  542 bits (1398), Expect = e-152,   Method: Composition-based stats.
 Identities = 169/303 (55%), Positives = 213/303 (70%), Gaps = 18/303 (5%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ IILTL  YW +QGC +LQP DMEVGAGT H  T LRA+GP  W+AAYVQPSRRP
Sbjct: 1   MLTFQQIILTLQSYWDKQGCALLQPIDMEVGAGTSHVHTFLRAIGPEPWRAAYVQPSRRP 60

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNRLQHYYQ+QV++KP P N+ +LY+ SL+A+G D   +DVRFVED+WE+PT
Sbjct: 61  KDGRYGENPNRLQHYYQYQVVLKPAPENILDLYLGSLEALGFDLKQNDVRFVEDDWENPT 120

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQQV G++C P+ GEITYGLERLAMY+Q V +VYD+V+
Sbjct: 121 LGAWGLGWEVWLNGMEVTQFTYFQQVGGLDCKPVLGEITYGLERLAMYLQKVENVYDLVW 180

Query: 190 --------NAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKG 241
                   N  E + + YGD++ Q+E E S YNFE+AN ++L   F   E E   ++   
Sbjct: 181 TEWEEQGPNGPELRRLTYGDVYHQNEVEQSTYNFEHANVDLLFTFFNSYEAEAKRMIDAQ 240

Query: 242 IPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLM 301
                        PAY+  +KA H FNLLDARG IS TER  YI RIR+L++   +A+  
Sbjct: 241 ----------IALPAYELVLKAGHTFNLLDARGAISVTERAAYIGRIRALSRLVAQAYYD 290

Query: 302 TPN 304
           +  
Sbjct: 291 SRE 293


>gi|323143407|ref|ZP_08078092.1| glycine--tRNA ligase, alpha subunit [Succinatimonas hippei YIT
           12066]
 gi|322416812|gb|EFY07461.1| glycine--tRNA ligase, alpha subunit [Succinatimonas hippei YIT
           12066]
          Length = 307

 Score =  542 bits (1398), Expect = e-152,   Method: Composition-based stats.
 Identities = 183/302 (60%), Positives = 222/302 (73%), Gaps = 8/302 (2%)

Query: 4   IHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYV 63
           + NK +  +FQ +I TL  YW +QGC I QP+DMEVGAGT HP T LR+LGP     AYV
Sbjct: 1   MPNKYDLQTFQGLIFTLQDYWMRQGCMIAQPFDMEVGAGTSHPMTFLRSLGPEPICCAYV 60

Query: 64  QPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVED 123
           QPSRRP DGRY ENPNRLQHYYQFQVI+KP+P N+Q+LY+ SLK +G DP ++D+RFVED
Sbjct: 61  QPSRRPTDGRYGENPNRLQHYYQFQVILKPSPDNIQDLYLGSLKELGFDPTVNDIRFVED 120

Query: 124 NWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNS 183
           NWE+PTLGAWGLGWE W +GME+SQFTYFQQV G+EC P++GE+TYGLERLAMY+Q  NS
Sbjct: 121 NWENPTLGAWGLGWEVWLNGMEVSQFTYFQQVGGLECYPVTGELTYGLERLAMYIQGKNS 180

Query: 184 VYDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIP 243
           +YD+V+   +   V YGDI+ Q+E E S YNFEYA+ E L N F   EKE   LL    P
Sbjct: 181 IYDLVWAHTKTGVVTYGDIYHQNEVEQSAYNFEYADTEFLFNMFDKMEKESSALLNLEKP 240

Query: 244 NEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTP 303
                      PAY++ +KA+H FNLLDAR  IS TERQRYILRIR+L+KA  EA+  + 
Sbjct: 241 --------LPLPAYERILKAAHCFNLLDARHAISVTERQRYILRIRTLSKAVAEAYYKSR 292

Query: 304 NG 305
             
Sbjct: 293 EA 294


>gi|258593378|emb|CBE69717.1| glycine tRNA synthetase, alpha subunit [NC10 bacterium 'Dutch
           sediment']
          Length = 300

 Score =  542 bits (1398), Expect = e-152,   Method: Composition-based stats.
 Identities = 166/301 (55%), Positives = 220/301 (73%), Gaps = 14/301 (4%)

Query: 4   IHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYV 63
             +    ++FQ +IL L +++A+QGC I QPYD+EVGAGT +P+T LR LGP  W  AYV
Sbjct: 2   KSSAGQVMTFQELILALQRFYAEQGCVIQQPYDVEVGAGTMNPATFLRVLGPEPWNVAYV 61

Query: 64  QPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVED 123
           + +RRP DGRY ENPNRLQHYYQ+QVI+KP+P N+Q +Y++SL+++GIDPL HD+RFVED
Sbjct: 62  ESTRRPADGRYGENPNRLQHYYQYQVIMKPSPDNIQEIYLDSLRSLGIDPLKHDIRFVED 121

Query: 124 NWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNS 183
           +WESPTLGAWGLGWE W DG+EI+QFTYFQQ  G++  PIS E+TYG+ER+AM++Q V+S
Sbjct: 122 DWESPTLGAWGLGWEVWLDGLEITQFTYFQQAGGVDLKPISAELTYGIERIAMFLQGVDS 181

Query: 184 VYDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIP 243
           VYD+ +     + V YGDI  +SE E+S +NFE A+  +    F   E+E L L++KG+ 
Sbjct: 182 VYDLTWV----KGVTYGDIHHKSEVEWSIHNFEEADVALQFQLFDQYEREGLRLIEKGL- 236

Query: 244 NEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTP 303
                    V PAYD C+K+SH FNLLDARG I  TER  +I R+R+LA+ C EA+L   
Sbjct: 237 ---------VLPAYDYCLKSSHTFNLLDARGAIGVTERTSFIGRVRNLARRCAEAYLKQR 287

Query: 304 N 304
            
Sbjct: 288 E 288


>gi|262277440|ref|ZP_06055233.1| glycyl-tRNA synthetase, alpha subunit [alpha proteobacterium
           HIMB114]
 gi|262224543|gb|EEY75002.1| glycyl-tRNA synthetase, alpha subunit [alpha proteobacterium
           HIMB114]
          Length = 311

 Score =  542 bits (1398), Expect = e-152,   Method: Composition-based stats.
 Identities = 189/293 (64%), Positives = 227/293 (77%), Gaps = 13/293 (4%)

Query: 11  LSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPL 70
           L+FQ II  L ++W+ QGC ILQPYD+EVGAGTFHP+TTLR+LGP  WKAAYVQPSRRP 
Sbjct: 32  LTFQEIIFKLQKFWSDQGCVILQPYDIEVGAGTFHPATTLRSLGPQHWKAAYVQPSRRPT 91

Query: 71  DGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTL 130
           DGRY ENPNRLQHYYQFQVIIKP+P ++Q LY++SL A+GI    HD+RFVED+WESPTL
Sbjct: 92  DGRYGENPNRLQHYYQFQVIIKPSPEDIQKLYLKSLTALGIIYKDHDIRFVEDDWESPTL 151

Query: 131 GAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFN 190
           GA GLGWE WCDGMEI+QFTYFQQ+ G EC P+S EITYGLER+ M++QN N+VYD+ +N
Sbjct: 152 GASGLGWEVWCDGMEITQFTYFQQMAGFECKPVSSEITYGLERICMFIQNKNNVYDLDWN 211

Query: 191 AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHH 250
               + V YGD+F Q+E+E+S YNFE+AN E L + F   EKE  DL +K +        
Sbjct: 212 H---EGVKYGDVFLQAEKEFSAYNFEHANTESLFDQFNKVEKESKDLAEKKL-------- 260

Query: 251 LCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTP 303
               PAYDQC+KASH+FNLLDARGVIS  ER  YI RIR+LAKACGE ++   
Sbjct: 261 --CLPAYDQCLKASHLFNLLDARGVISVAERANYITRIRALAKACGELWIEKQ 311


>gi|332529554|ref|ZP_08405511.1| glycyl-tRNA synthetase subunit alpha [Hylemonella gracilis ATCC
           19624]
 gi|332040992|gb|EGI77361.1| glycyl-tRNA synthetase subunit alpha [Hylemonella gracilis ATCC
           19624]
          Length = 301

 Score =  542 bits (1398), Expect = e-152,   Method: Composition-based stats.
 Identities = 169/295 (57%), Positives = 218/295 (73%), Gaps = 14/295 (4%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ IILTL  YW QQGC +LQPYDMEVGAGT H +T LRA+GP  WKAAYVQPSRRP
Sbjct: 1   MLTFQQIILTLQSYWDQQGCALLQPYDMEVGAGTSHTATFLRAIGPEPWKAAYVQPSRRP 60

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNRLQHYYQ+QV++KP P N+  LY+ SL+A+G D   +D+RFVED+WE+PT
Sbjct: 61  KDGRYGENPNRLQHYYQYQVVLKPAPSNILELYLGSLEALGFDLKKNDIRFVEDDWENPT 120

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQQV GI+C PI+GEITYGLERLAMY+Q V++VY++V+
Sbjct: 121 LGAWGLGWEVWLNGMEVTQFTYFQQVGGIDCKPITGEITYGLERLAMYLQGVDNVYNLVW 180

Query: 190 NAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRH 249
                + + YGD++ Q+E E S YNFE+++ + L   F   EK+   L++  +       
Sbjct: 181 T----EGLSYGDVYKQNEVEQSTYNFEHSDADFLFTAFTAHEKQAKHLMEAQL------- 229

Query: 250 HLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                PAY+Q +K +H FNLLDARG IS TER  YI RIR+LA++  +++  +  
Sbjct: 230 ---ALPAYEQVLKCAHSFNLLDARGAISVTERAAYIGRIRNLARSVAQSYYDSRE 281


>gi|307292914|ref|ZP_07572760.1| glycyl-tRNA synthetase, alpha subunit [Sphingobium chlorophenolicum
           L-1]
 gi|306880980|gb|EFN12196.1| glycyl-tRNA synthetase, alpha subunit [Sphingobium chlorophenolicum
           L-1]
          Length = 290

 Score =  542 bits (1398), Expect = e-152,   Method: Composition-based stats.
 Identities = 187/295 (63%), Positives = 226/295 (76%), Gaps = 13/295 (4%)

Query: 7   KKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPS 66
               LSFQ++ILTL  YW +QGC ILQPYDMEVGAGTFHP+TTLR+LGP +W AAYVQPS
Sbjct: 3   NSEALSFQDLILTLHAYWGKQGCVILQPYDMEVGAGTFHPATTLRSLGPNAWNAAYVQPS 62

Query: 67  RRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWE 126
           RRP DGRY ENPNRLQHYYQ+QVI+KP+P NLQ LY+ SL  +GIDPL+HD+RFVED+WE
Sbjct: 63  RRPTDGRYGENPNRLQHYYQYQVIMKPSPANLQELYLGSLAEIGIDPLVHDIRFVEDDWE 122

Query: 127 SPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYD 186
           SPTLGAWGLGWE WCDGME++QFTYFQQ+ G +C P++GE+TYGLERLAMY+Q V+SVYD
Sbjct: 123 SPTLGAWGLGWEVWCDGMEVTQFTYFQQMGGFDCKPVAGELTYGLERLAMYIQGVDSVYD 182

Query: 187 IVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEH 246
           + FN      V YGD+F ++E++ S++NFE A+ E L   F D+E EC   L+ G+P   
Sbjct: 183 LKFNDA---GVTYGDVFLENERQMSKWNFEIADTEKLFRWFKDAEAECKASLEAGVP--- 236

Query: 247 HRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLM 301
                    AYDQ IKASH+FNLL ARGVIS  ER  YI R+R LAK   E ++ 
Sbjct: 237 -------LAAYDQAIKASHVFNLLQARGVISVQERASYIGRVRDLAKGACEKWME 284


>gi|17545245|ref|NP_518647.1| glycyl-tRNA synthetase subunit alpha [Ralstonia solanacearum
           GMI1000]
 gi|30316256|sp|Q8Y211|SYGA_RALSO RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|17427536|emb|CAD14054.1| probable glycyl-trna synthetase alpha chain protein [Ralstonia
           solanacearum GMI1000]
          Length = 325

 Score =  542 bits (1398), Expect = e-152,   Method: Composition-based stats.
 Identities = 167/306 (54%), Positives = 217/306 (70%), Gaps = 11/306 (3%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ +IL L  YW  QGC +LQP D+EVGAGT H  T LRA+GP  W+AAYVQPSRRP
Sbjct: 1   MLTFQQLILKLQSYWDAQGCALLQPIDLEVGAGTSHVHTFLRAIGPEPWRAAYVQPSRRP 60

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNRLQHYYQ+QV++KP P N+ +LY+ SL+A+G+D   +DVRFVED+WE+PT
Sbjct: 61  KDGRYGENPNRLQHYYQYQVVLKPAPENILDLYLGSLQALGLDLKQNDVRFVEDDWENPT 120

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQQV G++C PI+GEITYG+ERLAMY+Q V +VYD+V+
Sbjct: 121 LGAWGLGWEVWLNGMEVTQFTYFQQVGGLDCKPITGEITYGIERLAMYLQQVENVYDLVW 180

Query: 190 NAIEGQN--------VLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLL--- 238
              E           + YGD++ Q+E E S YNFE+A+  +L   F + E E   L+   
Sbjct: 181 TEWEEPGPNGPVKRRLTYGDVYHQNEVEQSTYNFEHADTAVLFRRFAEHEAEAKRLMGVR 240

Query: 239 KKGIPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEA 298
           ++G  ++         PAY+Q +KA H FNLLDARG IS TER  YI RIR+L++   +A
Sbjct: 241 EEGAADDGAAVPQLALPAYEQVLKAGHTFNLLDARGAISVTERAAYIGRIRNLSRLVAQA 300

Query: 299 FLMTPN 304
           +  +  
Sbjct: 301 YYDSRE 306


>gi|88801021|ref|ZP_01116570.1| Glycyl-tRNA synthetase, alpha subunit [Reinekea sp. MED297]
 gi|88776224|gb|EAR07450.1| Glycyl-tRNA synthetase, alpha subunit [Reinekea sp. MED297]
          Length = 325

 Score =  542 bits (1398), Expect = e-152,   Method: Composition-based stats.
 Identities = 177/299 (59%), Positives = 224/299 (74%), Gaps = 11/299 (3%)

Query: 6   NKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQP 65
              +  +FQ +ILTL QYWA QGC ILQP DMEVGAGT HP+T LRALGP +W AAYVQP
Sbjct: 4   KTPDTQTFQGLILTLQQYWADQGCVILQPLDMEVGAGTSHPATFLRALGPETWNAAYVQP 63

Query: 66  SRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNW 125
           SRRP DGRY ENPNRLQHYYQ+QV++KPNP N+Q LY+ SL A+GID   +D+RFVEDNW
Sbjct: 64  SRRPTDGRYGENPNRLQHYYQYQVVLKPNPDNIQELYLGSLAAIGIDLETNDIRFVEDNW 123

Query: 126 ESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVY 185
           E+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLERLAMY+Q V+SVY
Sbjct: 124 ENPTLGAWGLGWEVWMNGMEVTQFTYFQQVGGLECYPVTGEITYGLERLAMYIQGVDSVY 183

Query: 186 DIVFN-AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           D+++  + +G  V YGD++ Q+E E S YNFEYA+ + L + F     E   L+   +P 
Sbjct: 184 DLIWTISPDGTPVTYGDVYLQNEVEQSTYNFEYADVKELFHQFDYHAGEAQKLIDAELP- 242

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTP 303
                     PAY+Q +K++H FNLLDAR  IS TERQRYIL+IR+L++   +++  + 
Sbjct: 243 ---------LPAYEQILKSAHTFNLLDARKAISVTERQRYILQIRTLSRLVAKSYFDSR 292


>gi|260886750|ref|ZP_05898013.1| glycyl-tRNA synthetase, alpha subunit [Selenomonas sputigena ATCC
           35185]
 gi|260863602|gb|EEX78102.1| glycyl-tRNA synthetase, alpha subunit [Selenomonas sputigena ATCC
           35185]
          Length = 304

 Score =  542 bits (1398), Expect = e-152,   Method: Composition-based stats.
 Identities = 165/295 (55%), Positives = 212/295 (71%), Gaps = 14/295 (4%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
           DL FQ IIL L ++W++QGC + QPYD+E GAGT +PST LR LGP  W  AYV+PSRRP
Sbjct: 11  DLKFQEIILALQKFWSEQGCILAQPYDVEKGAGTMNPSTFLRVLGPEPWNVAYVEPSRRP 70

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY +NPNRL  ++QFQVI+KP+P N+Q LY+ESL+++GIDP  HD+RFVEDNWESPT
Sbjct: 71  ADGRYGDNPNRLYQHHQFQVIMKPSPDNIQELYLESLESLGIDPKQHDIRFVEDNWESPT 130

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W DGMEI+QFTYFQQV  ++  P+S EITYGLERLAMY+Q V +V+DI +
Sbjct: 131 LGAWGLGWEVWLDGMEITQFTYFQQVGSVDVKPVSSEITYGLERLAMYIQGVENVFDIQW 190

Query: 190 NAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRH 249
            A    +  YGD+F Q+E E S Y+F+ ++  +L + F   EKE + +++ G        
Sbjct: 191 TA----DYTYGDVFHQNEVEQSAYSFDLSDEALLFDLFDKYEKEAVRIIELGR------- 239

Query: 250 HLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
              V PAYD  +K SH FNLLDARG IS +ER  +I R+R LA+ C + +L    
Sbjct: 240 ---VHPAYDYVLKCSHAFNLLDARGAISVSERTAFIGRVRRLARLCAQCYLKQRE 291


>gi|294338461|emb|CAZ86787.1| glycine tRNA synthetase, alpha subunit [Thiomonas sp. 3As]
          Length = 331

 Score =  542 bits (1398), Expect = e-152,   Method: Composition-based stats.
 Identities = 173/314 (55%), Positives = 218/314 (69%), Gaps = 31/314 (9%)

Query: 12  SFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPLD 71
           +FQ++ILTL  YWA+QGC +LQPYDMEVGAGT H +T LRALGP  WKAAYVQPSRRP D
Sbjct: 3   TFQDLILTLQTYWARQGCAVLQPYDMEVGAGTSHTATFLRALGPEPWKAAYVQPSRRPKD 62

Query: 72  GRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTLG 131
           GRY +NPNRLQHYYQFQV++KP P N+ +LY+ SL+A+G D   +D+RFVED+WE+PTLG
Sbjct: 63  GRYGDNPNRLQHYYQFQVVLKPAPDNILDLYLGSLQALGFDLKTNDIRFVEDDWENPTLG 122

Query: 132 AWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFNA 191
           AWGLGWE W +GME++QFTYFQQV GI+C P++GEITYGLERLAMY+Q V SVYD+V+  
Sbjct: 123 AWGLGWEVWLNGMEVTQFTYFQQVGGIDCKPLTGEITYGLERLAMYLQGVQSVYDLVWTE 182

Query: 192 IEGQN---------------------VLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDS 230
            E                        + YGD+F Q+E E S YNFE+++ + L   F   
Sbjct: 183 TEVAGEAAAPPGGASALGRPGGARTLLKYGDVFHQNEVEQSAYNFEHSDVDFLLTAFAAH 242

Query: 231 EKECLDLLKKGIPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRS 290
           EK+   L+   +            PAY+Q +KA+H FNLLDARG IS TER  YI RIR+
Sbjct: 243 EKQAKALMAAQL----------ALPAYEQVLKAAHSFNLLDARGAISVTERAAYIGRIRN 292

Query: 291 LAKACGEAFLMTPN 304
           LA+   + +L +  
Sbjct: 293 LARGVAQEYLDSRA 306


>gi|319796020|ref|YP_004157660.1| glycyL-tRNA synthetase, alpha subunit [Variovorax paradoxus EPS]
 gi|315598483|gb|ADU39549.1| glycyl-tRNA synthetase, alpha subunit [Variovorax paradoxus EPS]
          Length = 302

 Score =  542 bits (1398), Expect = e-152,   Method: Composition-based stats.
 Identities = 170/295 (57%), Positives = 217/295 (73%), Gaps = 14/295 (4%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ IIL L  YWA QGC +LQPYDMEVGAGT H +T LRALGP  WKAAYVQPSRRP
Sbjct: 1   MLNFQQIILKLQSYWADQGCALLQPYDMEVGAGTSHTATFLRALGPEPWKAAYVQPSRRP 60

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNRLQHYYQ+QV++KP P N+  LY+ SL+A+G D   +D+RFVED+WE+PT
Sbjct: 61  KDGRYGENPNRLQHYYQYQVVLKPAPANILELYLGSLEALGFDLKKNDIRFVEDDWENPT 120

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQQV GI+C PI+GEITYGLERLAMY+Q V++VY++ +
Sbjct: 121 LGAWGLGWEVWLNGMEVTQFTYFQQVGGIDCKPITGEITYGLERLAMYLQGVDNVYNLTW 180

Query: 190 NAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRH 249
                + + YGD++ Q+E E S YNFE+++ E L   F   EK+   L+ + +       
Sbjct: 181 T----EGLSYGDVYKQNEVEQSTYNFEHSDAEFLFTAFNAHEKQAKHLMTEQL------- 229

Query: 250 HLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                PAY+Q +KA+H FNLLDARG IS TER  YI RIR+LA++  +++  +  
Sbjct: 230 ---ALPAYEQVLKAAHSFNLLDARGAISVTERAAYIGRIRNLARSVAQSYYDSRE 281


>gi|207727977|ref|YP_002256371.1| glycyl-trna synthetase alpha chain protein [Ralstonia solanacearum
           MolK2]
 gi|206591220|emb|CAQ56832.1| glycyl-trna synthetase alpha chain protein [Ralstonia solanacearum
           MolK2]
          Length = 325

 Score =  542 bits (1397), Expect = e-152,   Method: Composition-based stats.
 Identities = 166/306 (54%), Positives = 216/306 (70%), Gaps = 11/306 (3%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ +IL L  YW  QGC +LQP D+EVGAGT H  T LRA+GP  W+AAYVQPSRRP
Sbjct: 1   MLTFQQLILKLQSYWDAQGCALLQPIDLEVGAGTSHVHTFLRAIGPEPWRAAYVQPSRRP 60

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNRLQHYYQ+QV++KP P N+ +LY+ SL A+G+D   +DVRFVED+WE+PT
Sbjct: 61  KDGRYGENPNRLQHYYQYQVVLKPAPENILDLYLGSLAALGLDLKQNDVRFVEDDWENPT 120

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQQV G++C PI+GEITYG+ERLAMY+Q V ++YD+V+
Sbjct: 121 LGAWGLGWEVWLNGMEVTQFTYFQQVGGLDCKPITGEITYGIERLAMYLQQVENIYDLVW 180

Query: 190 NAIEGQN--------VLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLL--- 238
              E           + YGD++ Q+E E S YNFE+A+  +L   F + E E   L+   
Sbjct: 181 TEWEEPGPNGPVKRRLTYGDVYHQNEVEQSTYNFEHADTAVLFRRFAEHEAEAKRLMGVR 240

Query: 239 KKGIPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEA 298
           ++G  ++         PAY+Q +KA H FNLLDARG IS TER  YI RIR+L++   +A
Sbjct: 241 EEGAADDGTPVPQLALPAYEQVLKAGHTFNLLDARGAISVTERAAYIGRIRNLSRLVAQA 300

Query: 299 FLMTPN 304
           +  +  
Sbjct: 301 YYDSRE 306


>gi|83746122|ref|ZP_00943177.1| Glycyl-tRNA synthetase alpha chain [Ralstonia solanacearum UW551]
 gi|207742378|ref|YP_002258770.1| glycyl-trna synthetase alpha chain protein [Ralstonia solanacearum
           IPO1609]
 gi|83727305|gb|EAP74428.1| Glycyl-tRNA synthetase alpha chain [Ralstonia solanacearum UW551]
 gi|206593768|emb|CAQ60695.1| glycyl-trna synthetase alpha chain protein [Ralstonia solanacearum
           IPO1609]
          Length = 325

 Score =  542 bits (1397), Expect = e-152,   Method: Composition-based stats.
 Identities = 166/306 (54%), Positives = 216/306 (70%), Gaps = 11/306 (3%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ +IL L  YW  QGC +LQP D+EVGAGT H  T LRA+GP  W+AAYVQPSRRP
Sbjct: 1   MLTFQQLILKLQSYWDAQGCALLQPIDLEVGAGTSHVHTFLRAIGPEPWRAAYVQPSRRP 60

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNRLQHYYQ+QV++KP P N+ +LY+ SL A+G+D   +DVRFVED+WE+PT
Sbjct: 61  KDGRYGENPNRLQHYYQYQVVLKPAPENILDLYLGSLAALGLDLKQNDVRFVEDDWENPT 120

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQQV G++C PI+GEITYG+ERLAMY+Q V ++YD+V+
Sbjct: 121 LGAWGLGWEVWLNGMEVTQFTYFQQVGGLDCKPITGEITYGIERLAMYLQQVENIYDLVW 180

Query: 190 NAIEGQN--------VLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLL--- 238
              E           + YGD++ Q+E E S YNFE+A+  +L   F + E E   L+   
Sbjct: 181 TEWEEPGPNGPVKRRLTYGDVYHQNEVEQSTYNFEHADTAVLFRRFAEHEAEAKRLMGVR 240

Query: 239 KKGIPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEA 298
           ++G  ++         PAY+Q +KA H FNLLDARG IS TER  YI RIR+L++   +A
Sbjct: 241 EEGAADDGTPVPQLALPAYEQVLKAGHTFNLLDARGAISVTERAAYIGRIRNLSRLVAQA 300

Query: 299 FLMTPN 304
           +  +  
Sbjct: 301 YYDSRE 306


>gi|289668589|ref|ZP_06489664.1| glycyl-tRNA synthetase subunit alpha [Xanthomonas campestris pv.
           musacearum NCPPB4381]
          Length = 302

 Score =  541 bits (1396), Expect = e-152,   Method: Composition-based stats.
 Identities = 179/300 (59%), Positives = 226/300 (75%), Gaps = 11/300 (3%)

Query: 6   NKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQP 65
           +++  ++FQ +I TL QYWA+QGC ++QP D+EVGAGTFHP+T LRALGP  W AAYVQP
Sbjct: 4   SRRVPITFQGLIQTLNQYWAEQGCVLIQPLDLEVGAGTFHPATLLRALGPEPWNAAYVQP 63

Query: 66  SRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNW 125
           SRRP DGRY ENPNRLQ YYQ+QV +KPNP N+Q+LY+ SL+A+GIDPL+HD+RFVEDNW
Sbjct: 64  SRRPTDGRYGENPNRLQRYYQYQVAMKPNPDNIQDLYLGSLQALGIDPLVHDLRFVEDNW 123

Query: 126 ESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVY 185
           ESPTLGAWGLGWE W +GME++QFTYFQQ  G+EC P+ GEITYGLERL MY+Q+ ++VY
Sbjct: 124 ESPTLGAWGLGWEVWLNGMEVTQFTYFQQAGGLECKPVLGEITYGLERLCMYLQSCDNVY 183

Query: 186 DIVFN-AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           ++V+    +G  V YGD++ Q+E E S YNFE+AN   L + F   E E   L++ G+P 
Sbjct: 184 ELVWTYGPDGAAVTYGDVYHQNEVEQSTYNFEHANVAELFHRFDACEAEARHLVEVGLP- 242

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY+Q  KASH FNLLDAR  IS TERQRYILR+R+LA+   +A+     
Sbjct: 243 ---------LPAYEQVTKASHAFNLLDARRAISVTERQRYILRVRALAQGVAQAYYAQRE 293


>gi|167585509|ref|ZP_02377897.1| glycyl-tRNA synthetase subunit alpha [Burkholderia ubonensis Bu]
          Length = 334

 Score =  541 bits (1396), Expect = e-152,   Method: Composition-based stats.
 Identities = 168/303 (55%), Positives = 213/303 (70%), Gaps = 18/303 (5%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ IILTL  YW +QGC +LQP DMEVGAGT H  T LRA+GP  W+AAYVQPSRRP
Sbjct: 1   MLTFQQIILTLQSYWDKQGCALLQPIDMEVGAGTSHVHTFLRAVGPEPWRAAYVQPSRRP 60

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNRLQHYYQ+QV++KP P N+ +LY+ SL+A+G D   +DVRFVED+WE+PT
Sbjct: 61  KDGRYGENPNRLQHYYQYQVVLKPAPENILDLYLGSLEALGFDLKQNDVRFVEDDWENPT 120

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQQV G++C P+ GEITYGLERLAMY+Q V +VYD+++
Sbjct: 121 LGAWGLGWEVWLNGMEVTQFTYFQQVGGLDCKPVLGEITYGLERLAMYLQKVENVYDLIW 180

Query: 190 NAIEGQN--------VLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKG 241
              E Q         + YGD++ Q+E E S YNFE+AN ++L   F   E E   ++   
Sbjct: 181 TEWEEQGPDGPELRRLTYGDVYHQNEVEQSTYNFEHANVDLLFTFFNSYEAEAKRMIDAQ 240

Query: 242 IPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLM 301
           +            PAY+  +KA H FNLLDARG IS TER  YI RIR+L++   +A+  
Sbjct: 241 L----------ALPAYELVLKAGHTFNLLDARGAISVTERAAYIGRIRALSRLVAQAYYE 290

Query: 302 TPN 304
           +  
Sbjct: 291 SRE 293


>gi|148557750|ref|YP_001265332.1| glycyl-tRNA synthetase subunit alpha [Sphingomonas wittichii RW1]
 gi|254781831|sp|A5VFX8|SYGA_SPHWW RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|148502940|gb|ABQ71194.1| Glycine--tRNA ligase [Sphingomonas wittichii RW1]
          Length = 291

 Score =  541 bits (1396), Expect = e-152,   Method: Composition-based stats.
 Identities = 189/293 (64%), Positives = 223/293 (76%), Gaps = 11/293 (3%)

Query: 9   NDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRR 68
             LSFQ +ILTL  YW+ QGC ILQPYDME+GAGTFHPSTTLRALGP  WKAAYVQPSRR
Sbjct: 4   KPLSFQRLILTLHDYWSDQGCLILQPYDMEMGAGTFHPSTTLRALGPQPWKAAYVQPSRR 63

Query: 69  PLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESP 128
           P DGRY ENPNRL HYYQ+QVI+KP+P NLQ LY+ SL+ +GIDPL HD+RFVED+WESP
Sbjct: 64  PTDGRYGENPNRLGHYYQYQVILKPSPANLQELYLGSLERIGIDPLAHDIRFVEDDWESP 123

Query: 129 TLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIV 188
           TLGAWGLGWE WCDGME++QFTYFQQV G +C P++GE+TYGLERLAMY+Q V+ VYD+ 
Sbjct: 124 TLGAWGLGWEVWCDGMEVTQFTYFQQVGGFDCKPVAGELTYGLERLAMYIQGVDRVYDLA 183

Query: 189 FNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHR 248
           FN    + V YGD+F ++E+++S YNFE AN + L   F  +  EC  LL++  P     
Sbjct: 184 FND---EGVTYGDVFLENERQFSAYNFEAANTDTLFKQFTQAADECRALLERDRP----- 235

Query: 249 HHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLM 301
                 PAYDQ IKASHIFN L ARGVIS  ERQ YI R+R LAK    A++ 
Sbjct: 236 ---LPLPAYDQAIKASHIFNTLQARGVISVAERQAYIGRVRDLAKGACAAWMA 285


>gi|110679232|ref|YP_682239.1| glycyl-tRNA synthetase subunit alpha [Roseobacter denitrificans OCh
           114]
 gi|109455348|gb|ABG31553.1| glycyl-tRNA synthetase, alpha subunit [Roseobacter denitrificans
           OCh 114]
          Length = 313

 Score =  541 bits (1396), Expect = e-152,   Method: Composition-based stats.
 Identities = 189/299 (63%), Positives = 230/299 (76%), Gaps = 2/299 (0%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
             SFQ IIL L  YWA +GC ILQPYDMEVGAGTFHP+TTLR+LG   W AAYVQPSRRP
Sbjct: 8   PKSFQEIILRLQDYWAGKGCAILQPYDMEVGAGTFHPATTLRSLGNRPWAAAYVQPSRRP 67

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ++PNR QHYYQFQVIIKP+P +LQ+LY+ SL+A+GID  +HD+RFVED+WESPT
Sbjct: 68  TDGRYGDSPNRWQHYYQFQVIIKPSPPDLQDLYLGSLRAIGIDMDLHDIRFVEDDWESPT 127

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE WCDGME+SQFTYFQQV G +C P+SGE+TYGLERLAMY+   +    + F
Sbjct: 128 LGAWGLGWEVWCDGMEVSQFTYFQQVGGHDCHPVSGELTYGLERLAMYILGADDGNKMPF 187

Query: 190 NAIEGQ-NVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLL-KKGIPNEHH 247
           N  +    + YGD+F ++E +Y+R+NF+ A+ ++L  HFID+E EC  +L +     +  
Sbjct: 188 NDPDCPIPLTYGDVFQEAEAQYARWNFDVADTDVLLQHFIDAEAECARILAQAPDDPKTG 247

Query: 248 RHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNGG 306
           R  +   PAYDQCIKASHIFNLLDARGVIS TERQ YI R+R LAK C +AF+ T  GG
Sbjct: 248 RRIVMAQPAYDQCIKASHIFNLLDARGVISVTERQAYIGRVRDLAKQCADAFVQTQAGG 306


>gi|53718311|ref|YP_107297.1| glycyl-tRNA synthetase subunit alpha [Burkholderia pseudomallei
           K96243]
 gi|53724674|ref|YP_102053.1| glycyl-tRNA synthetase subunit alpha [Burkholderia mallei ATCC
           23344]
 gi|67641461|ref|ZP_00440239.1| glycyl-tRNA synthetase, alpha subunit [Burkholderia mallei GB8
           horse 4]
 gi|121600406|ref|YP_994023.1| glycyl-tRNA synthetase subunit alpha [Burkholderia mallei SAVP1]
 gi|126441236|ref|YP_001057754.1| glycyl-tRNA synthetase subunit alpha [Burkholderia pseudomallei
           668]
 gi|126451115|ref|YP_001081957.1| glycyl-tRNA synthetase subunit alpha [Burkholderia mallei NCTC
           10247]
 gi|126451946|ref|YP_001064999.1| glycyl-tRNA synthetase subunit alpha [Burkholderia pseudomallei
           1106a]
 gi|134279523|ref|ZP_01766235.1| glycyl-tRNA synthetase, alpha subunit [Burkholderia pseudomallei
           305]
 gi|167718174|ref|ZP_02401410.1| glycyl-tRNA synthetase subunit alpha [Burkholderia pseudomallei
           DM98]
 gi|167737205|ref|ZP_02409979.1| glycyl-tRNA synthetase subunit alpha [Burkholderia pseudomallei 14]
 gi|167814336|ref|ZP_02446016.1| glycyl-tRNA synthetase subunit alpha [Burkholderia pseudomallei 91]
 gi|167822813|ref|ZP_02454284.1| glycyl-tRNA synthetase subunit alpha [Burkholderia pseudomallei 9]
 gi|167844387|ref|ZP_02469895.1| glycyl-tRNA synthetase subunit alpha [Burkholderia pseudomallei
           B7210]
 gi|167909615|ref|ZP_02496706.1| glycyl-tRNA synthetase subunit alpha [Burkholderia pseudomallei
           112]
 gi|167917630|ref|ZP_02504721.1| glycyl-tRNA synthetase subunit alpha [Burkholderia pseudomallei
           BCC215]
 gi|217420283|ref|ZP_03451789.1| glycyl-tRNA synthetase, alpha subunit [Burkholderia pseudomallei
           576]
 gi|226196750|ref|ZP_03792330.1| glycyl-tRNA synthetase, alpha subunit [Burkholderia pseudomallei
           Pakistan 9]
 gi|237810905|ref|YP_002895356.1| glycyl-tRNA synthetase, alpha subunit [Burkholderia pseudomallei
           MSHR346]
 gi|242317910|ref|ZP_04816926.1| glycyl-tRNA synthetase, alpha subunit [Burkholderia pseudomallei
           1106b]
 gi|254176882|ref|ZP_04883539.1| glycyl-tRNA synthetase, alpha chain [Burkholderia mallei ATCC
           10399]
 gi|254181747|ref|ZP_04888344.1| glycyl-tRNA synthetase, alpha subunit [Burkholderia pseudomallei
           1655]
 gi|254187676|ref|ZP_04894188.1| glycyl-tRNA synthetase, alpha subunit [Burkholderia pseudomallei
           Pasteur 52237]
 gi|254196806|ref|ZP_04903230.1| glycyl-tRNA synthetase, alpha subunit [Burkholderia pseudomallei
           S13]
 gi|254203738|ref|ZP_04910098.1| glycyl-tRNA synthetase, alpha chain [Burkholderia mallei FMH]
 gi|254208713|ref|ZP_04915061.1| glycyl-tRNA synthetase, alpha chain [Burkholderia mallei JHU]
 gi|254257982|ref|ZP_04949036.1| glycyl-tRNA synthetase, alpha subunit [Burkholderia pseudomallei
           1710a]
 gi|254296212|ref|ZP_04963669.1| glycyl-tRNA synthetase, alpha subunit [Burkholderia pseudomallei
           406e]
 gi|254360234|ref|ZP_04976504.1| glycyl-tRNA synthetase, alpha chain [Burkholderia mallei
           2002721280]
 gi|52208725|emb|CAH34661.1| Probable glycyl-tRNA synthetase alpha chain [Burkholderia
           pseudomallei K96243]
 gi|52428097|gb|AAU48690.1| glycyl-tRNA synthetase, alpha chain [Burkholderia mallei ATCC
           23344]
 gi|121229216|gb|ABM51734.1| glycyl-tRNA synthetase, alpha chain [Burkholderia mallei SAVP1]
 gi|126220729|gb|ABN84235.1| glycyl-tRNA synthetase, alpha subunit [Burkholderia pseudomallei
           668]
 gi|126225588|gb|ABN89128.1| glycyl-tRNA synthetase, alpha subunit [Burkholderia pseudomallei
           1106a]
 gi|126243985|gb|ABO07078.1| glycyl-tRNA synthetase, alpha chain [Burkholderia mallei NCTC
           10247]
 gi|134248723|gb|EBA48805.1| glycyl-tRNA synthetase, alpha subunit [Burkholderia pseudomallei
           305]
 gi|147745250|gb|EDK52330.1| glycyl-tRNA synthetase, alpha chain [Burkholderia mallei FMH]
 gi|147750589|gb|EDK57658.1| glycyl-tRNA synthetase, alpha chain [Burkholderia mallei JHU]
 gi|148029474|gb|EDK87379.1| glycyl-tRNA synthetase, alpha chain [Burkholderia mallei
           2002721280]
 gi|157806106|gb|EDO83276.1| glycyl-tRNA synthetase, alpha subunit [Burkholderia pseudomallei
           406e]
 gi|157935356|gb|EDO91026.1| glycyl-tRNA synthetase, alpha subunit [Burkholderia pseudomallei
           Pasteur 52237]
 gi|160697923|gb|EDP87893.1| glycyl-tRNA synthetase, alpha chain [Burkholderia mallei ATCC
           10399]
 gi|169653549|gb|EDS86242.1| glycyl-tRNA synthetase, alpha subunit [Burkholderia pseudomallei
           S13]
 gi|184212285|gb|EDU09328.1| glycyl-tRNA synthetase, alpha subunit [Burkholderia pseudomallei
           1655]
 gi|217397587|gb|EEC37603.1| glycyl-tRNA synthetase, alpha subunit [Burkholderia pseudomallei
           576]
 gi|225931281|gb|EEH27288.1| glycyl-tRNA synthetase, alpha subunit [Burkholderia pseudomallei
           Pakistan 9]
 gi|237503061|gb|ACQ95379.1| glycyl-tRNA synthetase, alpha subunit [Burkholderia pseudomallei
           MSHR346]
 gi|238522401|gb|EEP85845.1| glycyl-tRNA synthetase, alpha subunit [Burkholderia mallei GB8
           horse 4]
 gi|242141149|gb|EES27551.1| glycyl-tRNA synthetase, alpha subunit [Burkholderia pseudomallei
           1106b]
 gi|254216671|gb|EET06055.1| glycyl-tRNA synthetase, alpha subunit [Burkholderia pseudomallei
           1710a]
          Length = 335

 Score =  541 bits (1396), Expect = e-152,   Method: Composition-based stats.
 Identities = 170/303 (56%), Positives = 214/303 (70%), Gaps = 18/303 (5%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ IILTL  YW +QGC +LQP DMEVGAGT H  T LRA+GP  W+AAYVQPSRRP
Sbjct: 1   MLTFQQIILTLQSYWDRQGCALLQPIDMEVGAGTSHVHTFLRAIGPEPWRAAYVQPSRRP 60

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNRLQHYYQ+QV++KP P N+ +LY+ SL+A+G D   +DVRFVED+WE+PT
Sbjct: 61  KDGRYGENPNRLQHYYQYQVVLKPAPENILDLYLGSLEALGFDLKQNDVRFVEDDWENPT 120

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQQV G++C P+ GEITYGLERLAMY+Q V +VYD+V+
Sbjct: 121 LGAWGLGWEVWLNGMEVTQFTYFQQVGGLDCKPVLGEITYGLERLAMYLQKVENVYDLVW 180

Query: 190 --------NAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKG 241
                   N  E + + YGD++ Q+E E S YNFE AN E+L   F   E E   +++  
Sbjct: 181 TEWEEPGPNGPELRRLTYGDVYHQNEVEQSTYNFEQANVELLFTFFNSYEAEAKRMIEAQ 240

Query: 242 IPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLM 301
           +            PAY+  +KA H FNLLDARG IS TER  YI RIR+L++   +A+  
Sbjct: 241 L----------ALPAYELVLKAGHTFNLLDARGAISVTERAAYIGRIRALSRLVAQAYYD 290

Query: 302 TPN 304
           +  
Sbjct: 291 SRE 293


>gi|332524721|ref|ZP_08400919.1| glycyl-tRNA synthetase subunit alpha [Rubrivivax benzoatilyticus
           JA2]
 gi|332108028|gb|EGJ09252.1| glycyl-tRNA synthetase subunit alpha [Rubrivivax benzoatilyticus
           JA2]
          Length = 305

 Score =  541 bits (1396), Expect = e-152,   Method: Composition-based stats.
 Identities = 169/295 (57%), Positives = 218/295 (73%), Gaps = 14/295 (4%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ IIL L  YW  QGC +LQPYDMEVGAGT H +T LR++GP  WKAAYVQPSRRP
Sbjct: 1   MLTFQQIILKLQSYWDAQGCALLQPYDMEVGAGTSHTATFLRSIGPEPWKAAYVQPSRRP 60

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNRLQHYYQ+QV++KP P N+ +LY+ SL+A+G D   +DVRFVED+WE+PT
Sbjct: 61  KDGRYGENPNRLQHYYQYQVVLKPAPANILDLYLGSLEALGFDLKSNDVRFVEDDWENPT 120

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LG WGLGWE W +GME++QFTYFQQV GI+C PI+GEITYGLERLAMY+Q V++VYD+ +
Sbjct: 121 LGCWGLGWEVWLNGMEVTQFTYFQQVGGIDCKPITGEITYGLERLAMYLQGVDNVYDLQW 180

Query: 190 NAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRH 249
                  + YGD++ Q+E E S YNFE+++ + L + F   EK+   L+++ +       
Sbjct: 181 T----DTLKYGDVYHQNEVEQSTYNFEHSDVDFLLSAFSAHEKQSKYLMEQQL------- 229

Query: 250 HLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                PAY+Q +KA+H FNLLDARG IS TER  YI RIR+LA+A  +++L +  
Sbjct: 230 ---ALPAYEQLLKAAHTFNLLDARGAISVTERAAYIGRIRNLARAVAQSYLDSRA 281


>gi|294085842|ref|YP_003552602.1| glycine--tRNA ligase [Candidatus Puniceispirillum marinum IMCC1322]
 gi|292665417|gb|ADE40518.1| Glycine--tRNA ligase [Candidatus Puniceispirillum marinum IMCC1322]
          Length = 306

 Score =  541 bits (1396), Expect = e-152,   Method: Composition-based stats.
 Identities = 190/303 (62%), Positives = 231/303 (76%), Gaps = 11/303 (3%)

Query: 1   MAPIHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLS-WK 59
           M   H  +    FQ+IIL L  YWA+QG  ILQPYDMEVGAGTFHP+TTLRALGP   W+
Sbjct: 1   MTKTHISEAGTDFQSIILNLQLYWAKQGAVILQPYDMEVGAGTFHPATTLRALGPDKVWR 60

Query: 60  AAYVQPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVR 119
           AAYVQPSRRP DGRY ENPNRLQHYYQFQ I KP+P + Q +Y+ SL+A+G+DP  HD+R
Sbjct: 61  AAYVQPSRRPTDGRYGENPNRLQHYYQFQAIFKPSPADSQAMYLGSLRAIGLDPDAHDIR 120

Query: 120 FVEDNWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQ 179
           FVED+WESPTLGAWGLGWE WCDGME+SQFTYFQQV GIEC+P+  E+TYGLERLAM++Q
Sbjct: 121 FVEDDWESPTLGAWGLGWEVWCDGMEVSQFTYFQQVGGIECNPVPLELTYGLERLAMFIQ 180

Query: 180 NVNSVYDIVFNAIEGQ--NVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDL 237
            V++VYD+ ++ +  +     YGDIF ++E E+S +NFE+A  +IL  HF D+E EC  L
Sbjct: 181 GVDNVYDLDWDGVAAEDGGKCYGDIFHRAEVEFSSWNFEHAETDILLQHFKDAEAECGAL 240

Query: 238 LKKGIPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGE 297
           L   +P           PAYDQC+KASH+FNLLDARGVIS TER  YI R+R+LAK C E
Sbjct: 241 LDHDVP--------LALPAYDQCMKASHLFNLLDARGVISVTERASYIGRVRALAKGCCE 292

Query: 298 AFL 300
           A++
Sbjct: 293 AWI 295


>gi|167892901|ref|ZP_02480303.1| glycyl-tRNA synthetase subunit alpha [Burkholderia pseudomallei
           7894]
          Length = 335

 Score =  541 bits (1396), Expect = e-152,   Method: Composition-based stats.
 Identities = 170/303 (56%), Positives = 214/303 (70%), Gaps = 18/303 (5%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ IILTL  YW +QGC +LQP DMEVGAGT H  T LRA+GP  W+AAYVQPSRRP
Sbjct: 1   MLTFQQIILTLQSYWDRQGCALLQPIDMEVGAGTSHVHTFLRAIGPEPWRAAYVQPSRRP 60

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNRLQHYYQ+QV++KP P N+ +LY+ SL+A+G D   +DVRFVED+WE+PT
Sbjct: 61  KDGRYGENPNRLQHYYQYQVVLKPAPENILDLYLGSLEALGFDLKQNDVRFVEDDWENPT 120

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQQV G++C P+ GEITYGLERLAMY+Q V +VYD+V+
Sbjct: 121 LGAWGLGWEVWLNGMEVTQFTYFQQVGGLDCKPVLGEITYGLERLAMYLQKVENVYDLVW 180

Query: 190 --------NAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKG 241
                   N  E + + YGD++ Q+E E S YNFE AN E+L   F   E E   +++  
Sbjct: 181 TEWEEPGPNGPELRRLTYGDVYHQNEVEQSTYNFEQANVELLFTFFNSYEAEAKRMIEAQ 240

Query: 242 IPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLM 301
           +            PAY+  +KA H FNLLDARG IS TER  YI RIR+L++   +A+  
Sbjct: 241 L----------ALPAYELVLKAGHTFNLLDARGAISVTERAAYIGRIRALSRLVAQAYYD 290

Query: 302 TPN 304
           +  
Sbjct: 291 SRE 293


>gi|254251461|ref|ZP_04944779.1| Glycyl-tRNA synthetase alpha subunit [Burkholderia dolosa AUO158]
 gi|124894070|gb|EAY67950.1| Glycyl-tRNA synthetase alpha subunit [Burkholderia dolosa AUO158]
          Length = 334

 Score =  541 bits (1395), Expect = e-152,   Method: Composition-based stats.
 Identities = 168/303 (55%), Positives = 214/303 (70%), Gaps = 18/303 (5%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ IILTL  YW +QGC +LQP DMEVGAGT H  T LRA+GP  W+AAYVQPSRRP
Sbjct: 1   MLTFQQIILTLQSYWDKQGCALLQPIDMEVGAGTSHVHTFLRAVGPEPWRAAYVQPSRRP 60

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNRLQHYYQ+QV++KP P N+ +LY+ SL+A+G D   +DVRFVED+WE+PT
Sbjct: 61  KDGRYGENPNRLQHYYQYQVVLKPAPENILDLYLGSLEALGFDLQQNDVRFVEDDWENPT 120

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQQV G++C P+ GEITYGLERLAMY+Q V +VYD+++
Sbjct: 121 LGAWGLGWEVWLNGMEVTQFTYFQQVGGLDCKPVLGEITYGLERLAMYLQKVENVYDLIW 180

Query: 190 --------NAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKG 241
                   N  E + + YGD++ Q+E E S YNFE+AN ++L   F   E E   ++   
Sbjct: 181 TEWEEPGPNGPEIRRLTYGDVYHQNEVEQSTYNFEHANVDLLFTFFNSYEAEAKRMIDAQ 240

Query: 242 IPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLM 301
           +            PAY+  +KA H FNLLDARG IS TER  YI RIR+L++   +A+  
Sbjct: 241 L----------ALPAYELVLKAGHTFNLLDARGAISVTERAAYIGRIRALSRLVAQAYYD 290

Query: 302 TPN 304
           +  
Sbjct: 291 SRE 293


>gi|56707567|ref|YP_169463.1| glycyl-tRNA synthetase subunit alpha [Francisella tularensis subsp.
           tularensis SCHU S4]
 gi|110670038|ref|YP_666595.1| glycyl-tRNA synthetase subunit alpha [Francisella tularensis subsp.
           tularensis FSC198]
 gi|254368737|ref|ZP_04984750.1| hypothetical protein FTAG_00535 [Francisella tularensis subsp.
           holarctica FSC022]
 gi|254874386|ref|ZP_05247096.1| glycyl-tRNA synthetase alpha subunit [Francisella tularensis subsp.
           tularensis MA00-2987]
 gi|54113763|gb|AAV29515.1| NT02FT1664 [synthetic construct]
 gi|56604059|emb|CAG45052.1| Glycyl-tRNA synthetase alpha chain [Francisella tularensis subsp.
           tularensis SCHU S4]
 gi|110320371|emb|CAL08435.1| Glycyl-tRNA synthetase alpha chain [Francisella tularensis subsp.
           tularensis FSC198]
 gi|157121658|gb|EDO65828.1| hypothetical protein FTAG_00535 [Francisella tularensis subsp.
           holarctica FSC022]
 gi|254840385|gb|EET18821.1| glycyl-tRNA synthetase alpha subunit [Francisella tularensis subsp.
           tularensis MA00-2987]
          Length = 302

 Score =  541 bits (1395), Expect = e-152,   Method: Composition-based stats.
 Identities = 180/295 (61%), Positives = 217/295 (73%), Gaps = 10/295 (3%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ IIL L  YWA +GC I+QP DMEVGAGTFHP+TTLRA+GP  W AAYVQPSRRP
Sbjct: 7   MLTFQEIILKLHHYWASKGCAIVQPLDMEVGAGTFHPATTLRAIGPEPWTAAYVQPSRRP 66

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNR QHYYQ+QV++KP+P ++Q LY+ SL+ +GIDPL +D+RFVEDNWESPT
Sbjct: 67  TDGRYGENPNRTQHYYQYQVVMKPSPDDIQELYLGSLRELGIDPLENDIRFVEDNWESPT 126

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GMEI+QFTYFQQV G+EC P+ GEITYGLERLAMY+QNV+S+YDI++
Sbjct: 127 LGAWGLGWEVWSNGMEITQFTYFQQVGGLECKPVMGEITYGLERLAMYIQNVDSMYDILW 186

Query: 190 NAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRH 249
              +   + Y D+F Q+E E S YNFE AN E L   F   EKE   L++K +P      
Sbjct: 187 ANTQNGPLYYRDVFLQNEVEMSTYNFEEANVEELFKQFDLLEKEGYRLVEKNLP------ 240

Query: 250 HLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                PAY+  +KASH FNLLDAR  IS TERQ YILR+R LA    + +     
Sbjct: 241 ----IPAYEFVLKASHTFNLLDARHAISVTERQGYILRVRKLALEVAKEYYSARE 291


>gi|238757317|ref|ZP_04618503.1| Glycyl-tRNA synthetase alpha subunit [Yersinia aldovae ATCC 35236]
 gi|238704356|gb|EEP96887.1| Glycyl-tRNA synthetase alpha subunit [Yersinia aldovae ATCC 35236]
          Length = 304

 Score =  541 bits (1395), Expect = e-152,   Method: Composition-based stats.
 Identities = 185/301 (61%), Positives = 220/301 (73%), Gaps = 8/301 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +ILTL  YWA+QGCTI+QP DMEVGAGT HP T LRALGP    AAYVQ
Sbjct: 1   MQKFDTKTFQGLILTLQDYWARQGCTIVQPLDMEVGAGTSHPMTCLRALGPEPIAAAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQVIIKP+P N+Q LY+ SL+ +G+DPLIHD+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVIIKPSPDNIQELYLGSLQELGLDPLIHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLERLAMY+Q V+SV
Sbjct: 121 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGLERLAMYIQGVDSV 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+++         YGDI+ Q+E E S YNFEYA+ + L + F   EKE   LL    P 
Sbjct: 181 YDLIWCDGPLGTTTYGDIYHQNEVEQSTYNFEYADVDFLFSCFEQYEKEAQSLLALEAPL 240

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                       Y++ +KA H FNLLDAR  IS TERQRYILRIR+L KA  EA+  +  
Sbjct: 241 PLPA--------YERILKAGHTFNLLDARKAISVTERQRYILRIRTLTKAVAEAYYASRE 292

Query: 305 G 305
            
Sbjct: 293 A 293


>gi|163742179|ref|ZP_02149567.1| glycyl-tRNA synthetase subunit alpha [Phaeobacter gallaeciensis
           2.10]
 gi|161384509|gb|EDQ08890.1| glycyl-tRNA synthetase subunit alpha [Phaeobacter gallaeciensis
           2.10]
          Length = 309

 Score =  541 bits (1395), Expect = e-152,   Method: Composition-based stats.
 Identities = 194/306 (63%), Positives = 239/306 (78%), Gaps = 2/306 (0%)

Query: 4   IHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYV 63
              K    SFQ IIL L  YWA +GC ++QPYDMEVGAGTFHP+TTLR+LG  +W AAYV
Sbjct: 2   TDTKGAPRSFQEIILRLQNYWAAKGCAVMQPYDMEVGAGTFHPATTLRSLGSKAWAAAYV 61

Query: 64  QPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVED 123
           QPSRRP DGRY ENPNRLQHYYQ+QV+IKP+P NLQ LY+ SL+A+G+D  +HD+RFVED
Sbjct: 62  QPSRRPTDGRYGENPNRLQHYYQYQVLIKPSPPNLQELYLGSLEAIGVDMDMHDIRFVED 121

Query: 124 NWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNS 183
           +WESPTLGAWGLGWE WCDGME+SQFTYFQQV G +C P+SGE+TYGLERLAMY+  V+ 
Sbjct: 122 DWESPTLGAWGLGWEVWCDGMEVSQFTYFQQVGGHDCHPVSGELTYGLERLAMYILGVDH 181

Query: 184 VYDIVFNAIEG-QNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLL-KKG 241
           V D+ FN  +    + YGD+F Q+E+EY+R+NF+ AN E+L  HF ++E EC  +L ++ 
Sbjct: 182 VMDMPFNDPDALIPLSYGDVFKQTEEEYARWNFDVANTEVLLRHFEEAEAECAAILAQEH 241

Query: 242 IPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLM 301
           I  +  +  +   PAYDQCIKASH+FNLLDARGVIS TERQ YI R+R+LAK C +AF+ 
Sbjct: 242 IDPKTGKRIIMAHPAYDQCIKASHVFNLLDARGVISVTERQAYIGRVRALAKQCADAFVQ 301

Query: 302 TPNGGH 307
           T  GGH
Sbjct: 302 TEAGGH 307


>gi|237746626|ref|ZP_04577106.1| glycyl-tRNA synthetase [Oxalobacter formigenes HOxBLS]
 gi|229377977|gb|EEO28068.1| glycyl-tRNA synthetase [Oxalobacter formigenes HOxBLS]
          Length = 320

 Score =  541 bits (1395), Expect = e-152,   Method: Composition-based stats.
 Identities = 169/310 (54%), Positives = 217/310 (70%), Gaps = 15/310 (4%)

Query: 1   MAPIHNKKNDL-SFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWK 59
           M      + D+ +FQ II TL QYW+Q+GC +LQ YDMEVGAGT H +T LRA+GP  W+
Sbjct: 8   MTKNAATETDMITFQQIIFTLQQYWSQKGCALLQSYDMEVGAGTSHTATFLRAIGPEPWR 67

Query: 60  AAYVQPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVR 119
           AAYVQPSRRP DGRY ENPNR+QHYYQFQV++KP P ++ +LY+ SL A+G+D   +DVR
Sbjct: 68  AAYVQPSRRPKDGRYGENPNRMQHYYQFQVVLKPAPEDILDLYLGSLAALGLDLKQNDVR 127

Query: 120 FVEDNWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQ 179
           FVED+WE+PTLGAWGLGWE W +GME++QFTYFQQV GI+C PI GEITYGLERLAMY+Q
Sbjct: 128 FVEDDWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGIDCKPILGEITYGLERLAMYLQ 187

Query: 180 NVNSVYDIVFNAIEGQNV----LYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECL 235
            V +VYD+++     + V     YGD++ Q+E E S YNFE AN   L   F + E E  
Sbjct: 188 GVENVYDLIWTEWVDRGVKKYLTYGDVYHQNEVEQSAYNFEQANAPFLFTLFTNFESEAK 247

Query: 236 DLLKKGIPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKAC 295
            L++  +            PAY+  +KA+H FNLLDARG +S TER  YI RIR+L++  
Sbjct: 248 RLIEAKLT----------LPAYEMILKAAHTFNLLDARGALSVTERAAYIGRIRTLSRLV 297

Query: 296 GEAFLMTPNG 305
            +A+  +   
Sbjct: 298 AQAYYESREA 307


>gi|251793738|ref|YP_003008468.1| glycyl-tRNA synthetase subunit alpha [Aggregatibacter aphrophilus
           NJ8700]
 gi|247535135|gb|ACS98381.1| hypothetical protein NT05HA_2066 [Aggregatibacter aphrophilus
           NJ8700]
          Length = 301

 Score =  541 bits (1395), Expect = e-152,   Method: Composition-based stats.
 Identities = 180/301 (59%), Positives = 216/301 (71%), Gaps = 8/301 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K N  +FQ +IL L +YWA QGCTI+QP+DMEVGAGT HP T LRALGP     AYVQ
Sbjct: 1   MTKFNVKTFQGMILALQEYWANQGCTIVQPFDMEVGAGTSHPMTALRALGPEPMAFAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQV+IKP+P N+Q LY+ SL+ +G DP  +D+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVVIKPSPDNIQELYLGSLEMLGFDPTKNDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME+SQFTYFQQV G+EC P++GE+TYGLERLAMY+Q V+SV
Sbjct: 121 WENPTLGAWGLGWEVWLNGMEVSQFTYFQQVGGLECKPVTGEVTYGLERLAMYIQGVDSV 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V++        YGD+F Q+E E S YNFEYA+ + L + F   EKE           
Sbjct: 181 YDLVWSDGPLGKTTYGDVFHQNEVEQSTYNFEYADTDFLFHCFDQYEKEAKS-------- 232

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY++ +KA+H FNLLDAR  IS TERQRYILRIRSL K   EA+  +  
Sbjct: 233 LLELERPLPLPAYERILKAAHSFNLLDARKAISVTERQRYILRIRSLTKGVAEAYYASRK 292

Query: 305 G 305
            
Sbjct: 293 A 293


>gi|161523778|ref|YP_001578790.1| glycyl-tRNA synthetase subunit alpha [Burkholderia multivorans ATCC
           17616]
 gi|189351461|ref|YP_001947089.1| glycyl-tRNA synthetase subunit alpha [Burkholderia multivorans ATCC
           17616]
 gi|221200099|ref|ZP_03573142.1| glycyl-tRNA synthetase, alpha subunit [Burkholderia multivorans
           CGD2M]
 gi|221206748|ref|ZP_03579760.1| glycyl-tRNA synthetase, alpha subunit [Burkholderia multivorans
           CGD2]
 gi|221211280|ref|ZP_03584259.1| glycyl-tRNA synthetase, alpha subunit [Burkholderia multivorans
           CGD1]
 gi|160341207|gb|ABX14293.1| glycyl-tRNA synthetase, alpha subunit [Burkholderia multivorans
           ATCC 17616]
 gi|189335483|dbj|BAG44553.1| glycyl-tRNA synthetase alpha chain [Burkholderia multivorans ATCC
           17616]
 gi|221168641|gb|EEE01109.1| glycyl-tRNA synthetase, alpha subunit [Burkholderia multivorans
           CGD1]
 gi|221173403|gb|EEE05838.1| glycyl-tRNA synthetase, alpha subunit [Burkholderia multivorans
           CGD2]
 gi|221180338|gb|EEE12742.1| glycyl-tRNA synthetase, alpha subunit [Burkholderia multivorans
           CGD2M]
          Length = 334

 Score =  541 bits (1395), Expect = e-152,   Method: Composition-based stats.
 Identities = 169/303 (55%), Positives = 215/303 (70%), Gaps = 18/303 (5%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ IILTL  YW +QGC +LQP DMEVGAGT H  T LRA+GP  W+AAYVQPSRRP
Sbjct: 1   MLTFQQIILTLQSYWDKQGCALLQPIDMEVGAGTSHVHTFLRAVGPEPWRAAYVQPSRRP 60

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNRLQHYYQ+QV++KP P N+ +LY+ SL+A+G D   +DVRFVED+WE+PT
Sbjct: 61  KDGRYGENPNRLQHYYQYQVVLKPAPENILDLYLGSLEALGFDLKQNDVRFVEDDWENPT 120

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQQV G++C P+ GEITYGLERLAMY+Q V +VYD+++
Sbjct: 121 LGAWGLGWEVWLNGMEVTQFTYFQQVGGLDCKPVLGEITYGLERLAMYLQKVENVYDLIW 180

Query: 190 --------NAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKG 241
                   N  E + + YGD++ Q+E E S YNFEYAN ++L   F   E E   +++  
Sbjct: 181 TEWEEQGPNGPEIRRLTYGDVYHQNEVEQSTYNFEYANVDLLFTFFNSYEAEAKRMIEAQ 240

Query: 242 IPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLM 301
           +            PAY+  +KA H FNLLDARG IS TER  YI RIR+L++   +A+  
Sbjct: 241 L----------ALPAYELVLKAGHTFNLLDARGAISVTERAAYIGRIRALSRLVAQAYYD 290

Query: 302 TPN 304
           +  
Sbjct: 291 SRE 293


>gi|303228958|ref|ZP_07315768.1| glycine--tRNA ligase, alpha subunit [Veillonella atypica
           ACS-134-V-Col7a]
 gi|302516372|gb|EFL58304.1| glycine--tRNA ligase, alpha subunit [Veillonella atypica
           ACS-134-V-Col7a]
          Length = 291

 Score =  541 bits (1395), Expect = e-152,   Method: Composition-based stats.
 Identities = 157/294 (53%), Positives = 205/294 (69%), Gaps = 14/294 (4%)

Query: 11  LSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPL 70
           ++FQ IIL L ++W++QGC +  PYD+E GAGT +P+T L A+GP  W   YV+PSRRP 
Sbjct: 1   MTFQEIILNLQKFWSEQGCIVQNPYDIEKGAGTMNPATFLHAIGPEPWAVCYVEPSRRPA 60

Query: 71  DGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTL 130
           DGRY +NPNRL  ++QFQVI+KP+P N+Q LY++SL  +GI    HD+RFVEDNWESPTL
Sbjct: 61  DGRYGDNPNRLFQHHQFQVIVKPSPDNIQELYLQSLATLGIHAEDHDIRFVEDNWESPTL 120

Query: 131 GAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFN 190
           GAWGLGWE W DGME++QFTYFQQV  I+C P+S EITYGLERLAMY+Q V +VYD+ +N
Sbjct: 121 GAWGLGWEVWLDGMEVTQFTYFQQVGSIDCKPVSVEITYGLERLAMYIQGVENVYDLKWN 180

Query: 191 AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHH 250
               ++V YGD++  +E E S YNFE A+ ++L   F   E E   +   G         
Sbjct: 181 ----EHVTYGDVWHANEVEQSVYNFELADTDMLFKLFDMYEAEAKRVCGAGY-------- 228

Query: 251 LCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
             V PAYD  +K SH FNLLD+RG IS +ER  +I R+R+LA+ C + +L    
Sbjct: 229 --VLPAYDYVLKCSHTFNLLDSRGAISISERTAFIGRVRALARICAQQYLAKRE 280


>gi|89055224|ref|YP_510675.1| glycyl-tRNA synthetase subunit alpha [Jannaschia sp. CCS1]
 gi|88864773|gb|ABD55650.1| glycyl-tRNA synthetase alpha chain [Jannaschia sp. CCS1]
          Length = 309

 Score =  541 bits (1395), Expect = e-152,   Method: Composition-based stats.
 Identities = 185/305 (60%), Positives = 230/305 (75%), Gaps = 2/305 (0%)

Query: 4   IHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYV 63
           +       SFQ IIL L  YWA +GC +LQPYDMEVGAGTFHP+TTLR+LG   W AAYV
Sbjct: 1   MTEPTAPRSFQEIILRLQAYWASKGCAVLQPYDMEVGAGTFHPATTLRSLGTRPWTAAYV 60

Query: 64  QPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVED 123
           QPSRRP DGRY ++PNR QHYYQ+QVIIKP+P +LQ LY+ SL+A+GID  +HD+RFVED
Sbjct: 61  QPSRRPTDGRYGDSPNRWQHYYQYQVIIKPSPPDLQELYLGSLRAIGIDMDLHDIRFVED 120

Query: 124 NWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNS 183
           +WESPTLGAWGLGWE WCDGME+SQFTYFQQV G +C P+SGE+TYGLERLAMYV + + 
Sbjct: 121 DWESPTLGAWGLGWEVWCDGMEVSQFTYFQQVGGHDCHPVSGELTYGLERLAMYVLDCDD 180

Query: 184 VYDIVFNAIEGQ-NVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGI 242
             ++ FN  +    + YGD+F ++E +Y+R+NF+ A+ +IL  HF D+E EC  +L +  
Sbjct: 181 GNEMPFNDPDAPIPLTYGDVFREAEAQYARWNFDVADTDILFQHFKDAEAECARILDQPD 240

Query: 243 -PNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLM 301
              +  R  +   PAYDQ IKASH+FNLLDARGVIS TERQ YI R+R+L K C +AF+ 
Sbjct: 241 TDPKTGRRIVMALPAYDQAIKASHVFNLLDARGVISVTERQAYIGRVRTLTKKCADAFVQ 300

Query: 302 TPNGG 306
           T  GG
Sbjct: 301 TAAGG 305


>gi|301631338|ref|XP_002944755.1| PREDICTED: glycyl-tRNA synthetase alpha subunit-like [Xenopus
           (Silurana) tropicalis]
          Length = 329

 Score =  541 bits (1395), Expect = e-152,   Method: Composition-based stats.
 Identities = 169/297 (56%), Positives = 216/297 (72%), Gaps = 14/297 (4%)

Query: 8   KNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSR 67
           +  L+FQ+IIL L  YWA+QGC +LQPYDMEVGAGT H +T LRA+GP  WKAAYVQPSR
Sbjct: 16  RAMLTFQHIILKLQSYWAEQGCALLQPYDMEVGAGTSHTATFLRAIGPEPWKAAYVQPSR 75

Query: 68  RPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWES 127
           RP DGRY ENPNRLQHYYQ+QV++KP P N+  LY+ SL+A+G D   +D+RFVED+WE+
Sbjct: 76  RPKDGRYGENPNRLQHYYQYQVVLKPAPANILALYLGSLEALGFDLKKNDIRFVEDDWEN 135

Query: 128 PTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDI 187
           PTLGAWGLGWE W +GME++QFTYFQQ+ GI+C P +GEITYGLERLAMY+Q+V+ VY++
Sbjct: 136 PTLGAWGLGWEVWLNGMEVTQFTYFQQIGGIDCKPATGEITYGLERLAMYLQDVDKVYNL 195

Query: 188 VFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHH 247
           V+       + YGD++ Q+E E S YNFE ++   L   F   E++   L+         
Sbjct: 196 VWT----DGLTYGDVYHQNEVEQSTYNFEQSDAAFLFTAFDAHERQAQHLIA-------- 243

Query: 248 RHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                  PAY+Q +KA+H FNLLDARG IS TER  YI RIR+LA+A  +A+L +  
Sbjct: 244 --GQLALPAYEQVLKAAHTFNLLDARGAISVTERAAYIGRIRNLARAVAKAYLDSRA 298


>gi|317402365|gb|EFV82938.1| glycyl-tRNA synthetase alpha subunit [Achromobacter xylosoxidans
           C54]
          Length = 303

 Score =  541 bits (1395), Expect = e-152,   Method: Composition-based stats.
 Identities = 178/296 (60%), Positives = 222/296 (75%), Gaps = 11/296 (3%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ IILTL +YW +QGC +LQPYDMEVGAGT H +T LRA+GP  W+AAYVQPSRRP
Sbjct: 1   MLTFQQIILTLQEYWDKQGCALLQPYDMEVGAGTSHTATFLRAIGPEPWRAAYVQPSRRP 60

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNRLQHYYQ+QV++KP P  + +LYI SLKA+GIDP  HD+RFVED+WE+PT
Sbjct: 61  KDGRYGENPNRLQHYYQYQVVLKPAPPEILDLYIGSLKALGIDPTQHDIRFVEDDWENPT 120

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQQV G++C+P +GEITYGLERLAMY+Q+V SVYD+V+
Sbjct: 121 LGAWGLGWEVWLNGMEVTQFTYFQQVGGLDCTPTTGEITYGLERLAMYLQDVQSVYDLVW 180

Query: 190 N-AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHR 248
                G+ VLY D+F Q+E E S YNFEY++ E+L  HF D E E   L+          
Sbjct: 181 TEGANGRRVLYRDVFHQNEVEQSTYNFEYSSAEMLFAHFNDYEAEAKRLMD--------- 231

Query: 249 HHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                 PAY+  +KA+H FN+LDARG IS TER  YI RIR+L++A  +A+  +  
Sbjct: 232 -VPLALPAYEATLKAAHTFNMLDARGAISVTERAAYIGRIRNLSRAVAQAYYDSRE 286


>gi|323697787|ref|ZP_08109699.1| glycyl-tRNA synthetase, alpha subunit [Desulfovibrio sp. ND132]
 gi|323457719|gb|EGB13584.1| glycyl-tRNA synthetase, alpha subunit [Desulfovibrio desulfuricans
           ND132]
          Length = 289

 Score =  541 bits (1395), Expect = e-152,   Method: Composition-based stats.
 Identities = 166/294 (56%), Positives = 212/294 (72%), Gaps = 14/294 (4%)

Query: 11  LSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPL 70
           ++FQ++IL L  +WA  GC ++QP D+E GAGTF+PST  R +GP  WK AYV+PSRRP 
Sbjct: 1   MNFQDVILKLQAFWADYGCAVVQPMDIECGAGTFNPSTFFRVIGPEPWKTAYVEPSRRPT 60

Query: 71  DGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTL 130
           DGRY ENPNRLQHYYQFQVI+KP+P N+Q LY++SL A+GID   HD+RFVED+WESPTL
Sbjct: 61  DGRYGENPNRLQHYYQFQVILKPSPDNVQELYLQSLAALGIDAAAHDIRFVEDDWESPTL 120

Query: 131 GAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFN 190
           GAWGLGWE W +GME++QFTYFQQV GI+  P+S EITYGLER++MY+Q   SVYD+ +N
Sbjct: 121 GAWGLGWEVWLNGMEVTQFTYFQQVGGIDLKPVSVEITYGLERISMYLQEKESVYDLRWN 180

Query: 191 AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHH 250
                 + YGD++ Q+E E S+YNFE ++ ++L + F   E ECL L + G+P       
Sbjct: 181 ----DTITYGDVYHQNEVEMSKYNFELSDADMLFDLFNKFEGECLKLCEAGLP------- 229

Query: 251 LCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
              +PAYD C+K SH FNLLDARG IS TER  YI R+R+LA      +     
Sbjct: 230 ---WPAYDYCLKCSHSFNLLDARGAISITERATYIGRVRNLASKIARLYADQRE 280


>gi|300692463|ref|YP_003753458.1| glycine tRNA synthetase, alpha subunit [Ralstonia solanacearum
           PSI07]
 gi|299079523|emb|CBJ52201.1| glycine tRNA synthetase, alpha subunit [Ralstonia solanacearum
           PSI07]
          Length = 325

 Score =  541 bits (1394), Expect = e-152,   Method: Composition-based stats.
 Identities = 166/306 (54%), Positives = 217/306 (70%), Gaps = 11/306 (3%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ +IL L  YW  QGC +LQP D+EVGAGT H  T LRA+GP  W+AAYVQPSRRP
Sbjct: 1   MLTFQQLILKLQSYWDAQGCALLQPIDLEVGAGTSHVHTFLRAIGPEPWRAAYVQPSRRP 60

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNRLQHYYQ+QV++KP P N+ +LY+ SL+A+G+D   +DVRFVED+WE+PT
Sbjct: 61  KDGRYGENPNRLQHYYQYQVVLKPAPENILDLYLGSLQALGLDLKQNDVRFVEDDWENPT 120

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQQV G++C PI+GEITYG+ERLAMY+Q V ++YD+V+
Sbjct: 121 LGAWGLGWEVWLNGMEVTQFTYFQQVGGLDCKPITGEITYGIERLAMYLQQVENIYDLVW 180

Query: 190 NAIEGQN--------VLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLL--- 238
              E           + YGD++ Q+E E S YNFE+A+  +L   F + E E   L+   
Sbjct: 181 TEWEEPGPNGPVKRRLTYGDVYHQNEVEQSTYNFEHADTTVLFRRFAEHEAEAKRLMGVR 240

Query: 239 KKGIPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEA 298
           ++G  ++         PAY+Q +KA H FNLLDARG IS TER  YI RIR+L++   +A
Sbjct: 241 EEGAADDGAPVPQLALPAYEQVLKAGHTFNLLDARGAISVTERAAYIGRIRNLSRLVAQA 300

Query: 299 FLMTPN 304
           +  +  
Sbjct: 301 YYDSRE 306


>gi|167561613|ref|ZP_02354529.1| glycyl-tRNA synthetase subunit alpha [Burkholderia oklahomensis
           EO147]
 gi|167568848|ref|ZP_02361722.1| glycyl-tRNA synthetase subunit alpha [Burkholderia oklahomensis
           C6786]
          Length = 335

 Score =  541 bits (1394), Expect = e-152,   Method: Composition-based stats.
 Identities = 168/303 (55%), Positives = 214/303 (70%), Gaps = 18/303 (5%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ IILTL  YW +QGC +LQP DMEVGAGT H  T LRA+GP  W+AAYVQPSRRP
Sbjct: 1   MLTFQQIILTLQSYWDRQGCALLQPIDMEVGAGTSHVHTFLRAIGPEPWRAAYVQPSRRP 60

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNRLQHYYQ+QV++KP P N+ +LY+ SL+A+G D   +DVRFVED+WE+PT
Sbjct: 61  KDGRYGENPNRLQHYYQYQVVLKPAPENILDLYLGSLEALGFDLKQNDVRFVEDDWENPT 120

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQQV G++C P+ GEITYGLERLAMY+Q V +VYD+++
Sbjct: 121 LGAWGLGWEVWLNGMEVTQFTYFQQVGGLDCKPVLGEITYGLERLAMYLQKVENVYDLIW 180

Query: 190 --------NAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKG 241
                   N  E + + YGD++ Q+E E S YNFE AN ++L   F   E E   +++  
Sbjct: 181 TEWEEQGPNGPELRRLTYGDVYHQNEVEQSTYNFEQANVDLLFTFFNSYEAEAKRMIEAR 240

Query: 242 IPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLM 301
           +            PAY+  +KA H FNLLDARG IS TER  YI RIR+L++   +A+  
Sbjct: 241 L----------ALPAYELVLKAGHTFNLLDARGAISVTERAAYIGRIRALSRLVAQAYYD 290

Query: 302 TPN 304
           +  
Sbjct: 291 SRE 293


>gi|303231458|ref|ZP_07318189.1| glycine--tRNA ligase, alpha subunit [Veillonella atypica
           ACS-049-V-Sch6]
 gi|302513895|gb|EFL55906.1| glycine--tRNA ligase, alpha subunit [Veillonella atypica
           ACS-049-V-Sch6]
          Length = 291

 Score =  541 bits (1394), Expect = e-152,   Method: Composition-based stats.
 Identities = 158/294 (53%), Positives = 205/294 (69%), Gaps = 14/294 (4%)

Query: 11  LSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPL 70
           ++FQ IIL L ++W++QGC +  PYD+E GAGT +P+T L A+GP  W   YV+PSRRP 
Sbjct: 1   MTFQEIILNLQKFWSEQGCIVQNPYDIEKGAGTMNPATFLHAIGPEPWAVCYVEPSRRPA 60

Query: 71  DGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTL 130
           DGRY +NPNRL  ++QFQVI+KP+P N+Q LY++SL  +GI    HD+RFVEDNWESPTL
Sbjct: 61  DGRYGDNPNRLFQHHQFQVIVKPSPDNIQELYLQSLATLGIHAEDHDIRFVEDNWESPTL 120

Query: 131 GAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFN 190
           GAWGLGWE W DGME++QFTYFQQV  I+C P+S EITYGLERLAMY+Q V +VYD+ +N
Sbjct: 121 GAWGLGWEVWLDGMEVTQFTYFQQVGSIDCKPVSVEITYGLERLAMYIQGVENVYDLKWN 180

Query: 191 AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHH 250
               +NV YGD++  +E E S YNFE A+ ++L   F   E E   +   G         
Sbjct: 181 ----ENVTYGDVWHANEVEQSVYNFELADTDMLFKLFDMYEAEAKRVCGAGY-------- 228

Query: 251 LCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
             V PAYD  +K SH FNLLD+RG IS +ER  +I R+R+LA+ C + +L    
Sbjct: 229 --VLPAYDYVLKCSHTFNLLDSRGAISISERTAFIGRVRALARICAQQYLAKRE 280


>gi|91790041|ref|YP_550993.1| glycyl-tRNA synthetase subunit alpha [Polaromonas sp. JS666]
 gi|123164360|sp|Q124E7|SYGA_POLSJ RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|91699266|gb|ABE46095.1| glycyl-tRNA synthetase alpha chain [Polaromonas sp. JS666]
          Length = 301

 Score =  541 bits (1394), Expect = e-152,   Method: Composition-based stats.
 Identities = 169/295 (57%), Positives = 213/295 (72%), Gaps = 14/295 (4%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ IIL L  YW  QGC +LQPYDMEVGAGT H +T LRALGP  WKAAYVQPSRRP
Sbjct: 1   MLTFQQIILKLQSYWDAQGCALLQPYDMEVGAGTSHTATFLRALGPEPWKAAYVQPSRRP 60

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNRLQHYYQ+QV++KP P N+  LY+ SL+A+G D   +D+RFVED+WE+PT
Sbjct: 61  KDGRYGENPNRLQHYYQYQVVLKPAPANILELYLGSLEALGFDLKKNDIRFVEDDWENPT 120

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQQV GI+C PI+GEITYGLERLAMY+Q V++VY++ +
Sbjct: 121 LGAWGLGWEVWLNGMEVTQFTYFQQVGGIDCKPITGEITYGLERLAMYLQGVDNVYNLTW 180

Query: 190 NAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRH 249
                  + YGD++ Q+E E S YNFE+++ + L   F   EK+   L+           
Sbjct: 181 T----DGLSYGDVYKQNEVEQSTYNFEHSDADFLFTAFTAHEKQAKHLI----------G 226

Query: 250 HLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                PAY+Q +KA+H FNLLDARG IS TER  YI RIR+LA+A  +++  +  
Sbjct: 227 VQLALPAYEQVLKAAHSFNLLDARGAISVTERAAYIGRIRNLARAVAQSYYESRE 281


>gi|159044947|ref|YP_001533741.1| glycyl-tRNA synthetase subunit alpha [Dinoroseobacter shibae DFL
           12]
 gi|157912707|gb|ABV94140.1| glycyl-tRNA synthetase alpha chain [Dinoroseobacter shibae DFL 12]
          Length = 327

 Score =  541 bits (1394), Expect = e-152,   Method: Composition-based stats.
 Identities = 199/302 (65%), Positives = 232/302 (76%), Gaps = 2/302 (0%)

Query: 7   KKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPS 66
                SFQ IIL L  YWA QGC +LQPYDMEVGAGTFHP+TTLRALG   W AAYVQPS
Sbjct: 20  MDTPRSFQEIILRLQAYWADQGCAVLQPYDMEVGAGTFHPATTLRALGSRPWAAAYVQPS 79

Query: 67  RRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWE 126
           RRP DGRY ENPNRLQHYYQ+QVIIKP+P +LQ LY+ SL+A+GID  +HD+RFVED+WE
Sbjct: 80  RRPTDGRYGENPNRLQHYYQYQVIIKPSPPDLQELYLGSLRAIGIDAALHDIRFVEDDWE 139

Query: 127 SPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYD 186
           SPTLGAWGLGWE WCDGME+SQFTYFQQV G +C P+SGE+TYGLERLAMYV  V+ V D
Sbjct: 140 SPTLGAWGLGWEVWCDGMEVSQFTYFQQVGGHDCRPVSGELTYGLERLAMYVLGVDHVMD 199

Query: 187 IVFNAIEGQ-NVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNE 245
           + FNA +    + YGD+F Q+E EYSR+NF+ A+   L  HF ++E EC   L     + 
Sbjct: 200 MPFNAPDAAIPLSYGDVFRQTEAEYSRWNFDQADTATLLKHFEEAEAECAAALAAPHQDP 259

Query: 246 H-HRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
              +  L V PAYDQCIKASH+FNLLDARGVIS TERQ YI R+R+LAKAC +AF+ T  
Sbjct: 260 KTGKRILMVHPAYDQCIKASHLFNLLDARGVISVTERQAYIGRVRALAKACADAFVQTEA 319

Query: 305 GG 306
           GG
Sbjct: 320 GG 321


>gi|323493789|ref|ZP_08098907.1| glycyl-tRNA synthetase subunit alpha [Vibrio brasiliensis LMG
           20546]
 gi|323311923|gb|EGA65069.1| glycyl-tRNA synthetase subunit alpha [Vibrio brasiliensis LMG
           20546]
          Length = 306

 Score =  541 bits (1394), Expect = e-152,   Method: Composition-based stats.
 Identities = 186/302 (61%), Positives = 222/302 (73%), Gaps = 9/302 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +IL L  YWAQ GCTI+QP DMEVGAGT HP T LRALGP     AYVQ
Sbjct: 1   MQKYDIKTFQGMILALQDYWAQNGCTIVQPLDMEVGAGTSHPMTCLRALGPEPMSTAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQV +KP+P N+Q LY+ SL+ +GIDPL+HD+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVALKPSPDNIQELYLGSLEVLGIDPLVHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYG+ERLAMY+Q V+SV
Sbjct: 121 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGIERLAMYIQEVDSV 180

Query: 185 YDIVFN-AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIP 243
           YD+V+N A +G NV YGDIF Q+E E S YNFE+A+ + L + F   EKEC         
Sbjct: 181 YDLVWNVAPDGSNVTYGDIFHQNEVEQSTYNFEHADVDFLFSFFEQCEKECK-------- 232

Query: 244 NEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTP 303
                      PAY++ +KA H FNLLDAR  IS TERQRYILRIR+L KA  EA+  + 
Sbjct: 233 ELLELEKPLPLPAYERILKAGHAFNLLDARKAISVTERQRYILRIRNLTKAVAEAYYASR 292

Query: 304 NG 305
             
Sbjct: 293 EA 294


>gi|208778911|ref|ZP_03246257.1| glycyl-tRNA synthetase, alpha subunit [Francisella novicida FTG]
 gi|208744711|gb|EDZ91009.1| glycyl-tRNA synthetase, alpha subunit [Francisella novicida FTG]
          Length = 302

 Score =  541 bits (1394), Expect = e-152,   Method: Composition-based stats.
 Identities = 180/295 (61%), Positives = 217/295 (73%), Gaps = 10/295 (3%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ IIL L  YWA +GC I+QP DMEVGAGTFHP+TTLRA+GP  W AAYVQPSRRP
Sbjct: 7   MLTFQEIILKLHHYWASKGCAIIQPLDMEVGAGTFHPATTLRAIGPEPWTAAYVQPSRRP 66

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNR QHYYQ+QV++KP+P ++Q LY+ SL+ +GIDPL +D+RFVEDNWESPT
Sbjct: 67  TDGRYGENPNRTQHYYQYQVVMKPSPDDIQELYLGSLRELGIDPLENDIRFVEDNWESPT 126

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GMEI+QFTYFQQV G+EC P+ GEITYGLERLAMY+QNV+S+YDI++
Sbjct: 127 LGAWGLGWEVWSNGMEITQFTYFQQVGGLECKPVMGEITYGLERLAMYIQNVDSMYDILW 186

Query: 190 NAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRH 249
              +   + Y D+F Q+E E S YNFE AN E L   F   EKE   L++K +P      
Sbjct: 187 ANTQNGPLYYRDVFLQNEVEMSTYNFEEANVEELFKQFDLLEKEGYRLVEKNLP------ 240

Query: 250 HLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                PAY+  +KASH FNLLDAR  IS TERQ YILR+R LA    + +     
Sbjct: 241 ----IPAYEFVLKASHTFNLLDARHAISVTERQGYILRVRKLALEVAKEYYSARE 291


>gi|91781833|ref|YP_557039.1| glycyl-tRNA synthetase subunit alpha [Burkholderia xenovorans
           LB400]
 gi|91685787|gb|ABE28987.1| glycyl-tRNA synthetase alpha chain [Burkholderia xenovorans LB400]
          Length = 335

 Score =  541 bits (1394), Expect = e-152,   Method: Composition-based stats.
 Identities = 170/303 (56%), Positives = 215/303 (70%), Gaps = 18/303 (5%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ IILT+  YW +QGC +LQP DMEVGAGT H  T LRA+GP  W+AAYVQPSRRP
Sbjct: 1   MLTFQQIILTMQSYWDKQGCALLQPIDMEVGAGTSHVHTFLRAIGPEPWRAAYVQPSRRP 60

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNRLQHYYQ+QV++KP P N+ +LY+ SL+A+G D   +DVRFVED+WE+PT
Sbjct: 61  KDGRYGENPNRLQHYYQYQVVLKPAPENILDLYLGSLEALGFDLKQNDVRFVEDDWENPT 120

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQQV G++C P+ GEITYGLERLAMY+Q V +VYD+V+
Sbjct: 121 LGAWGLGWEVWLNGMEVTQFTYFQQVGGLDCKPVLGEITYGLERLAMYLQKVENVYDLVW 180

Query: 190 --------NAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKG 241
                   N  E + + YGD++ Q+E E S YNFE+AN E+L + F   E E   +++  
Sbjct: 181 TEWEEQGPNGPELRRLTYGDVYHQNEVEQSAYNFEHANVELLFSIFNSYEAEAKRMIEAQ 240

Query: 242 IPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLM 301
                        PAY+  +KA H FNLLDARG IS TER  YI RIR+L+K   +A+  
Sbjct: 241 ----------IALPAYELVLKAGHTFNLLDARGAISVTERAAYIGRIRALSKLVAQAYYD 290

Query: 302 TPN 304
           +  
Sbjct: 291 SRE 293


>gi|89255899|ref|YP_513261.1| glycyl-tRNA synthetase subunit alpha [Francisella tularensis subsp.
           holarctica LVS]
 gi|134302498|ref|YP_001122468.1| glycyl-tRNA synthetase subunit alpha [Francisella tularensis subsp.
           tularensis WY96-3418]
 gi|156501882|ref|YP_001427947.1| glycyl-tRNA synthetase subunit alpha [Francisella tularensis subsp.
           holarctica FTNF002-00]
 gi|167009664|ref|ZP_02274595.1| glycyl-tRNA synthetase subunit alpha [Francisella tularensis subsp.
           holarctica FSC200]
 gi|187931370|ref|YP_001891354.1| glycyl-tRNA synthetase subunit alpha [Francisella tularensis subsp.
           mediasiatica FSC147]
 gi|224456636|ref|ZP_03665109.1| glycyl-tRNA synthetase subunit alpha [Francisella tularensis subsp.
           tularensis MA00-2987]
 gi|290953387|ref|ZP_06558008.1| glycyl-tRNA synthetase subunit alpha [Francisella tularensis subsp.
           holarctica URFT1]
 gi|295313391|ref|ZP_06803999.1| glycyl-tRNA synthetase subunit alpha [Francisella tularensis subsp.
           holarctica URFT1]
 gi|122501101|sp|Q2A4U1|SYGA_FRATH RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|229558071|sp|A7NAI8|SYGA_FRATF RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|229558073|sp|A4IZJ6|SYGA_FRATW RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|238691543|sp|B2SFN3|SYGA_FRATM RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|89143730|emb|CAJ78929.1| Glycyl-tRNA synthetase alpha chain [Francisella tularensis subsp.
           holarctica LVS]
 gi|134050275|gb|ABO47346.1| glycyl-tRNA synthetase, alpha subunit [Francisella tularensis
           subsp. tularensis WY96-3418]
 gi|156252485|gb|ABU60991.1| glycyl-tRNA synthetase, alpha subunit [Francisella tularensis
           subsp. holarctica FTNF002-00]
 gi|187712279|gb|ACD30576.1| glycyl-tRNA synthetase, alpha subunit [Francisella tularensis
           subsp. mediasiatica FSC147]
 gi|282158723|gb|ADA78114.1| glycyl-tRNA synthetase subunit alpha [Francisella tularensis subsp.
           tularensis NE061598]
          Length = 296

 Score =  541 bits (1394), Expect = e-152,   Method: Composition-based stats.
 Identities = 180/295 (61%), Positives = 217/295 (73%), Gaps = 10/295 (3%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ IIL L  YWA +GC I+QP DMEVGAGTFHP+TTLRA+GP  W AAYVQPSRRP
Sbjct: 1   MLTFQEIILKLHHYWASKGCAIVQPLDMEVGAGTFHPATTLRAIGPEPWTAAYVQPSRRP 60

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNR QHYYQ+QV++KP+P ++Q LY+ SL+ +GIDPL +D+RFVEDNWESPT
Sbjct: 61  TDGRYGENPNRTQHYYQYQVVMKPSPDDIQELYLGSLRELGIDPLENDIRFVEDNWESPT 120

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GMEI+QFTYFQQV G+EC P+ GEITYGLERLAMY+QNV+S+YDI++
Sbjct: 121 LGAWGLGWEVWSNGMEITQFTYFQQVGGLECKPVMGEITYGLERLAMYIQNVDSMYDILW 180

Query: 190 NAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRH 249
              +   + Y D+F Q+E E S YNFE AN E L   F   EKE   L++K +P      
Sbjct: 181 ANTQNGPLYYRDVFLQNEVEMSTYNFEEANVEELFKQFDLLEKEGYRLVEKNLP------ 234

Query: 250 HLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                PAY+  +KASH FNLLDAR  IS TERQ YILR+R LA    + +     
Sbjct: 235 ----IPAYEFVLKASHTFNLLDARHAISVTERQGYILRVRKLALEVAKEYYSARE 285


>gi|254464396|ref|ZP_05077807.1| glycyl-tRNA synthetase, alpha subunit [Rhodobacterales bacterium
           Y4I]
 gi|206685304|gb|EDZ45786.1| glycyl-tRNA synthetase, alpha subunit [Rhodobacterales bacterium
           Y4I]
          Length = 313

 Score =  541 bits (1394), Expect = e-152,   Method: Composition-based stats.
 Identities = 192/306 (62%), Positives = 239/306 (78%), Gaps = 2/306 (0%)

Query: 4   IHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYV 63
                   SFQ IIL L  YWA +GC ++QPYDMEVGAGTFHP+TTLR+LG  +W AAYV
Sbjct: 2   TQTNGAPRSFQEIILRLQNYWAAKGCAVMQPYDMEVGAGTFHPATTLRSLGSKAWAAAYV 61

Query: 64  QPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVED 123
           QPSRRP DGRY ENPNRLQHYYQ+QV+IKP+P +LQ LY+ SL+A+GID  +HD+RFVED
Sbjct: 62  QPSRRPTDGRYGENPNRLQHYYQYQVLIKPSPPDLQELYLGSLEAIGIDMALHDIRFVED 121

Query: 124 NWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNS 183
           +WESPTLGAWGLGWE WCDGME+SQFTYFQQV G +C P+SGE+TYGLERLAMYV  V+ 
Sbjct: 122 DWESPTLGAWGLGWEVWCDGMEVSQFTYFQQVGGHDCHPVSGELTYGLERLAMYVLGVDH 181

Query: 184 VYDIVFNAIEGQ-NVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLL-KKG 241
           V D+ FN  +    + YGD+F Q+E+EY+R+NF+ A+ ++L  HF ++E EC  +L ++ 
Sbjct: 182 VMDMPFNDPDAMIPLTYGDVFKQTEEEYARWNFDVASTDVLLRHFEEAEAECAAILAQEH 241

Query: 242 IPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLM 301
           +  +  +  +   PAYDQCIKASHIFNLLDARGVIS TERQ YI R+R+LAK C +AF++
Sbjct: 242 MDPKTGKRIIMAHPAYDQCIKASHIFNLLDARGVISVTERQAYIGRVRALAKQCADAFVL 301

Query: 302 TPNGGH 307
           T  GGH
Sbjct: 302 TEAGGH 307


>gi|71083321|ref|YP_266040.1| glycyl-tRNA synthetase subunit alpha [Candidatus Pelagibacter
           ubique HTCC1062]
 gi|91762249|ref|ZP_01264214.1| Glycyl-tRNA synthetase alpha subunit [Candidatus Pelagibacter
           ubique HTCC1002]
 gi|71062434|gb|AAZ21437.1| Glycyl-tRNA synthetase alpha subunit [Candidatus Pelagibacter
           ubique HTCC1062]
 gi|91718051|gb|EAS84701.1| Glycyl-tRNA synthetase alpha subunit [Candidatus Pelagibacter
           ubique HTCC1002]
          Length = 294

 Score =  541 bits (1394), Expect = e-152,   Method: Composition-based stats.
 Identities = 181/305 (59%), Positives = 222/305 (72%), Gaps = 15/305 (4%)

Query: 1   MAPIHN--KKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSW 58
           MA      K    SFQ+ IL L +YW++QGC +LQPYD+EVGAGTFHP+TTLR+LGP  W
Sbjct: 1   MASKEKIIKPKFQSFQDTILNLQKYWSKQGCILLQPYDIEVGAGTFHPATTLRSLGPKPW 60

Query: 59  KAAYVQPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDV 118
           KAAYVQPSRRP DGRY ENPNRLQHYYQFQV+IKP+P N++ LY+ SL  +GI+   HD+
Sbjct: 61  KAAYVQPSRRPTDGRYGENPNRLQHYYQFQVLIKPSPDNIKKLYLNSLAVIGINHKEHDI 120

Query: 119 RFVEDNWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYV 178
           RFVED+WESPTLGA GLGWE WCDGMEI+QFTYFQQ+ G EC P+S EITYGLER+ M+ 
Sbjct: 121 RFVEDDWESPTLGAAGLGWEVWCDGMEITQFTYFQQMAGFECKPVSVEITYGLERICMFT 180

Query: 179 QNVNSVYDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLL 238
           Q + +VYD+++N    + V YGD+F Q+E+E+S YNFE+AN E L   F   E E   L+
Sbjct: 181 QQMKNVYDLIWND---EGVKYGDVFLQAEKEFSAYNFEHANTENLFKMFDMFELEAKALV 237

Query: 239 KKGIPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEA 298
            K              PAYDQC+KASH FN+LDARGVIS  +R  YI RIR + KA  E+
Sbjct: 238 DKK----------ISLPAYDQCLKASHAFNILDARGVISVAQRAGYIGRIRDITKAVAES 287

Query: 299 FLMTP 303
           +L + 
Sbjct: 288 WLSSQ 292


>gi|56552342|ref|YP_163180.1| glycyl-tRNA synthetase subunit alpha [Zymomonas mobilis subsp.
           mobilis ZM4]
 gi|260753969|ref|YP_003226862.1| glycyl-tRNA synthetase subunit alpha [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
 gi|81598198|sp|Q5NMJ1|SYGA_ZYMMO RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|56543916|gb|AAV90070.1| glycyl-tRNA synthetase, alpha subunit [Zymomonas mobilis subsp.
           mobilis ZM4]
 gi|258553332|gb|ACV76278.1| glycyl-tRNA synthetase, alpha subunit [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
          Length = 290

 Score =  541 bits (1394), Expect = e-152,   Method: Composition-based stats.
 Identities = 185/295 (62%), Positives = 226/295 (76%), Gaps = 11/295 (3%)

Query: 7   KKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPS 66
             + LSFQ +IL L  YW+QQGC ILQPYDME+GAGTFHP+T+L+ALGP  WKAAYVQP 
Sbjct: 1   MPDSLSFQALILKLHDYWSQQGCVILQPYDMEMGAGTFHPATSLKALGPNPWKAAYVQPC 60

Query: 67  RRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWE 126
           RRP DGRY ENPNRL HYYQ+QVI+KP+P N+Q LY+ SL+A+GID   HD+RFVED+WE
Sbjct: 61  RRPADGRYGENPNRLCHYYQYQVILKPSPDNIQALYLGSLEAIGIDLSRHDIRFVEDDWE 120

Query: 127 SPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYD 186
           SPTLGAWGLGWE WCDGME++QFTYFQQ+ G +C P+SGEITYGLERLAMY+Q V++VYD
Sbjct: 121 SPTLGAWGLGWEVWCDGMEVTQFTYFQQIGGFDCKPVSGEITYGLERLAMYIQGVDNVYD 180

Query: 187 IVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEH 246
           + FN      V YGD+F ++E+++S YNFE AN E L   F ++ +EC  LL++  P   
Sbjct: 181 LRFNDA---GVSYGDVFLENERQFSAYNFEAANTETLFRWFKEASQECKALLERDKP--- 234

Query: 247 HRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLM 301
                   PAYDQ IKASHIFNLL +RG+IS TERQ YI R+R L KA   A++ 
Sbjct: 235 -----LPLPAYDQAIKASHIFNLLQSRGMISVTERQAYIGRVRELTKAVAAAWMA 284


>gi|62259703|gb|AAX77866.1| unknown protein [synthetic construct]
          Length = 337

 Score =  540 bits (1393), Expect = e-152,   Method: Composition-based stats.
 Identities = 181/304 (59%), Positives = 220/304 (72%), Gaps = 10/304 (3%)

Query: 1   MAPIHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKA 60
           M  +    + L+FQ IIL L  YWA +GC I+QP DMEVGAGTFHP+TTLRA+GP  W A
Sbjct: 24  MLEVKILISMLTFQEIILKLHHYWASKGCAIVQPLDMEVGAGTFHPATTLRAIGPEPWTA 83

Query: 61  AYVQPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRF 120
           AYVQPSRRP DGRY ENPNR QHYYQ+QV++KP+P ++Q LY+ SL+ +GIDPL +D+RF
Sbjct: 84  AYVQPSRRPTDGRYGENPNRTQHYYQYQVVMKPSPDDIQELYLGSLRELGIDPLENDIRF 143

Query: 121 VEDNWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQN 180
           VEDNWESPTLGAWGLGWE W +GMEI+QFTYFQQV G+EC P+ GEITYGLERLAMY+QN
Sbjct: 144 VEDNWESPTLGAWGLGWEVWSNGMEITQFTYFQQVGGLECKPVMGEITYGLERLAMYIQN 203

Query: 181 VNSVYDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKK 240
           V+S+YDI++   +   + Y D+F Q+E E S YNFE AN E L   F   EKE   L++K
Sbjct: 204 VDSMYDILWANTQNGPLYYRDVFLQNEVEMSTYNFEEANVEELFKQFDLLEKEGYRLVEK 263

Query: 241 GIPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFL 300
            +P           PAY+  +KASH FNLLDAR  IS TERQ YILR+R LA    + + 
Sbjct: 264 NLP----------IPAYEFVLKASHTFNLLDARHAISVTERQGYILRVRKLALEVAKEYY 313

Query: 301 MTPN 304
               
Sbjct: 314 SARE 317


>gi|115314387|ref|YP_763110.1| glycyl-tRNA synthetase subunit alpha [Francisella tularensis subsp.
           holarctica OSU18]
 gi|115129286|gb|ABI82473.1| glycine--tRNA ligase [Francisella tularensis subsp. holarctica
           OSU18]
          Length = 304

 Score =  540 bits (1393), Expect = e-152,   Method: Composition-based stats.
 Identities = 180/295 (61%), Positives = 217/295 (73%), Gaps = 10/295 (3%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ IIL L  YWA +GC I+QP DMEVGAGTFHP+TTLRA+GP  W AAYVQPSRRP
Sbjct: 7   MLTFQEIILKLHHYWASKGCAIVQPLDMEVGAGTFHPATTLRAIGPEPWTAAYVQPSRRP 66

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNR QHYYQ+QV++KP+P ++Q LY+ SL+ +GIDPL +D+RFVEDNWESPT
Sbjct: 67  TDGRYGENPNRTQHYYQYQVVMKPSPDDIQELYLGSLRELGIDPLENDIRFVEDNWESPT 126

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GMEI+QFTYFQQV G+EC P+ GEITYGLERLAMY+QNV+S+YDI++
Sbjct: 127 LGAWGLGWEVWSNGMEITQFTYFQQVGGLECKPVMGEITYGLERLAMYIQNVDSMYDILW 186

Query: 190 NAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRH 249
              +   + Y D+F Q+E E S YNFE AN E L   F   EKE   L++K +P      
Sbjct: 187 ANTQNGPLYYRDVFLQNEVEMSTYNFEEANVEELFKQFDLLEKEGYRLVEKNLP------ 240

Query: 250 HLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                PAY+  +KASH FNLLDAR  IS TERQ YILR+R LA    + +     
Sbjct: 241 ----IPAYEFVLKASHTFNLLDARHAISVTERQGYILRVRKLALEVAKEYYSARE 291


>gi|269215557|ref|ZP_06159411.1| glycyl-tRNA synthetase, alpha subunit [Slackia exigua ATCC 700122]
 gi|269131044|gb|EEZ62119.1| glycyl-tRNA synthetase, alpha subunit [Slackia exigua ATCC 700122]
          Length = 307

 Score =  540 bits (1393), Expect = e-152,   Method: Composition-based stats.
 Identities = 180/295 (61%), Positives = 222/295 (75%), Gaps = 11/295 (3%)

Query: 8   KNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSR 67
            N  +FQ ++L L  YWA QGC ILQPYD EVGAGT HP+TTLR+LGP +W+ AYVQ  R
Sbjct: 6   HNAPTFQEVVLRLQTYWAAQGCVILQPYDNEVGAGTNHPATTLRSLGPDTWRTAYVQGCR 65

Query: 68  RPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWES 127
           RP DGRY ENPNR+QHYYQFQV+IKP+P N+Q+LY++SL+A+GID   HDVRFVED+WES
Sbjct: 66  RPADGRYGENPNRMQHYYQFQVLIKPSPDNVQDLYLDSLRAIGIDVEEHDVRFVEDDWES 125

Query: 128 PTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDI 187
           PTLGAWGLGWE W DGME++QFTYFQQV G EC+P+  EI YGLERL MY+Q V+SVYDI
Sbjct: 126 PTLGAWGLGWEVWIDGMEVTQFTYFQQVGGFECAPVPSEIAYGLERLVMYIQGVDSVYDI 185

Query: 188 VFNAIEGQ-NVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEH 246
           V++  +      YGD+F ++E+EYS YNFE A+ ++L   F   E EC  +L+ G+P   
Sbjct: 186 VWSRGDDGIEFTYGDVFLENEREYSAYNFEVADTDLLFGDFDRYEAECNRILEAGLP--- 242

Query: 247 HRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLM 301
                   PAYD  +K SH FNLLDARGVIS TER  YILR+RS+AKAC  +++ 
Sbjct: 243 -------LPAYDYVLKCSHTFNLLDARGVISATERMGYILRVRSIAKACCASYIE 290


>gi|149914422|ref|ZP_01902953.1| Glycine--tRNA ligase [Roseobacter sp. AzwK-3b]
 gi|149811941|gb|EDM71774.1| Glycine--tRNA ligase [Roseobacter sp. AzwK-3b]
          Length = 309

 Score =  540 bits (1393), Expect = e-152,   Method: Composition-based stats.
 Identities = 193/299 (64%), Positives = 235/299 (78%), Gaps = 2/299 (0%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
             SFQ +IL L  YWA QGC ++QPYDMEVGAGTFHP+TTLR+LG   W AAYVQPSRRP
Sbjct: 8   PRSFQEVILRLQAYWAAQGCAMMQPYDMEVGAGTFHPATTLRSLGSKPWAAAYVQPSRRP 67

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNRLQHYYQ+QV+IKP+P NLQ LY+ SL+A+GID  +HD+RFVED+WESPT
Sbjct: 68  TDGRYGENPNRLQHYYQYQVLIKPSPPNLQALYLGSLEAIGIDMALHDIRFVEDDWESPT 127

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE WCDGME+SQFTYFQQV G +C P+SGE+TYGLERLAMYV  V+ V D+ +
Sbjct: 128 LGAWGLGWEVWCDGMEVSQFTYFQQVGGHDCHPVSGELTYGLERLAMYVLGVDHVMDMPY 187

Query: 190 NAIEGQ-NVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKG-IPNEHH 247
           N  +    + YGD+F Q+EQEYSR+NF+ AN ++L  HF ++E EC  +L +  +  +  
Sbjct: 188 NDPQAPIPLTYGDVFRQTEQEYSRWNFDVANTDVLLRHFEEAEAECEAILSQPELDPKTG 247

Query: 248 RHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNGG 306
           +  +   PAYDQCIKASH+FNLLDARGVIS TERQ YI R+R+LAK C +AF+ T  GG
Sbjct: 248 QRIIMAHPAYDQCIKASHVFNLLDARGVISVTERQAYIGRVRALAKKCADAFVTTEAGG 306


>gi|89074696|ref|ZP_01161154.1| glycyl-tRNA synthetase alpha subunit [Photobacterium sp. SKA34]
 gi|89049460|gb|EAR55021.1| glycyl-tRNA synthetase alpha subunit [Photobacterium sp. SKA34]
          Length = 303

 Score =  540 bits (1393), Expect = e-152,   Method: Composition-based stats.
 Identities = 178/301 (59%), Positives = 217/301 (72%), Gaps = 8/301 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +IL L  YW QQGCTI+QP DMEVGAGT HP T LRALGP    AAYVQ
Sbjct: 1   MQKYDIKTFQGMILALQDYWGQQGCTIVQPLDMEVGAGTSHPMTCLRALGPEPIAAAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQV++KP+P N+Q LY+ SL+ +G+D  +HD+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVMLKPSPDNIQELYLGSLEVLGVDTKVHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYG+ERLAMY+QNV+SV
Sbjct: 121 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGIERLAMYIQNVDSV 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V+       V YGDIF Q+E E S YNFE+A+ + L   F   EKE +         
Sbjct: 181 YDLVWTDGPLGKVTYGDIFHQNEVEQSTYNFEHADVDFLFTFFDQCEKESI--------E 232

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY++ +KA+H FNLLDAR  IS TERQRYILRIR++ K   EA+  +  
Sbjct: 233 LLELEQPLPLPAYERILKAAHAFNLLDARKAISVTERQRYILRIRNVTKQVAEAYYASRE 292

Query: 305 G 305
            
Sbjct: 293 A 293


>gi|241761603|ref|ZP_04759690.1| glycyl-tRNA synthetase, alpha subunit [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
 gi|241373911|gb|EER63444.1| glycyl-tRNA synthetase, alpha subunit [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
          Length = 290

 Score =  540 bits (1393), Expect = e-152,   Method: Composition-based stats.
 Identities = 185/295 (62%), Positives = 226/295 (76%), Gaps = 11/295 (3%)

Query: 7   KKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPS 66
             + LSFQ +IL L  YW+QQGC ILQPYDME+GAGTFHP+T+L+ALGP  WKAAYVQP 
Sbjct: 1   MPDSLSFQALILKLHDYWSQQGCVILQPYDMEMGAGTFHPATSLKALGPNPWKAAYVQPC 60

Query: 67  RRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWE 126
           RRP DGRY ENPNRL HYYQ+QVI+KP+P N+Q LY+ SL+A+GID   HD+RFVED+WE
Sbjct: 61  RRPADGRYGENPNRLCHYYQYQVILKPSPDNIQALYLGSLEAIGIDLSRHDIRFVEDDWE 120

Query: 127 SPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYD 186
           SPTLGAWGLGWE WCDGME++QFTYFQQ+ G +C P+SGEITYGLERLAMY+Q V++VYD
Sbjct: 121 SPTLGAWGLGWEVWCDGMEVTQFTYFQQIGGFDCKPVSGEITYGLERLAMYIQGVDNVYD 180

Query: 187 IVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEH 246
           + FN      V YGD+F ++E+++S YNFE AN E L   F ++ +EC  LL++  P   
Sbjct: 181 LRFNDA---GVSYGDVFLENERQFSAYNFEAANTETLFRWFKEASQECKALLEREKP--- 234

Query: 247 HRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLM 301
                   PAYDQ IKASHIFNLL +RG+IS TERQ YI R+R L KA   A++ 
Sbjct: 235 -----LPLPAYDQAIKASHIFNLLQSRGMISVTERQAYIGRVRELTKAVAAAWMA 284


>gi|259416620|ref|ZP_05740540.1| glycyl-tRNA synthetase, alpha subunit [Silicibacter sp. TrichCH4B]
 gi|259348059|gb|EEW59836.1| glycyl-tRNA synthetase, alpha subunit [Silicibacter sp. TrichCH4B]
          Length = 316

 Score =  540 bits (1393), Expect = e-152,   Method: Composition-based stats.
 Identities = 194/306 (63%), Positives = 240/306 (78%), Gaps = 2/306 (0%)

Query: 4   IHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYV 63
           +       SFQ IIL L  YWA +GC ILQPYDMEVGAGTFHP+TTLR+LG  +W AAYV
Sbjct: 1   MTQTTAPRSFQEIILRLQTYWASKGCAILQPYDMEVGAGTFHPATTLRSLGSNAWAAAYV 60

Query: 64  QPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVED 123
           QPSRRP DGRY ENPNRLQHYYQ+QV+IKP+P +LQ LY+ SL+A+G+D  +HD+RFVED
Sbjct: 61  QPSRRPTDGRYGENPNRLQHYYQYQVLIKPSPPDLQELYLGSLEAIGVDMELHDIRFVED 120

Query: 124 NWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNS 183
           +WESPTLGAWGLGWE WCDGME+SQFTYFQQV G +C P+SGE+TYGLERLAMY+  ++ 
Sbjct: 121 DWESPTLGAWGLGWEVWCDGMEVSQFTYFQQVGGHDCHPVSGELTYGLERLAMYILGIDH 180

Query: 184 VYDIVFNAIEGQ-NVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLL-KKG 241
           V D+ FN  +    + YGDIF Q+E+EY+R+NF+ AN E+L  HF ++E EC  +L ++ 
Sbjct: 181 VMDMPFNDPQSPQPLSYGDIFKQTEEEYARWNFDVANTEVLLRHFEEAEAECAAILAQEH 240

Query: 242 IPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLM 301
           +  +  +  +   PAYDQCIKASHIFNLLDARGVIS TERQ YI R+R+LAK C +AF++
Sbjct: 241 MDPKTGKRIIMAHPAYDQCIKASHIFNLLDARGVISVTERQAYIGRVRTLAKQCADAFVL 300

Query: 302 TPNGGH 307
           T  GGH
Sbjct: 301 TEAGGH 306


>gi|118497118|ref|YP_898168.1| glycyl-tRNA synthetase subunit alpha [Francisella tularensis subsp.
           novicida U112]
 gi|194323415|ref|ZP_03057192.1| glycyl-tRNA synthetase, alpha subunit [Francisella tularensis
           subsp. novicida FTE]
 gi|229558072|sp|A0Q599|SYGA_FRATN RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|118423024|gb|ABK89414.1| glycyl-tRNA synthetase alpha chain [Francisella novicida U112]
 gi|194322270|gb|EDX19751.1| glycyl-tRNA synthetase, alpha subunit [Francisella tularensis
           subsp. novicida FTE]
          Length = 296

 Score =  540 bits (1393), Expect = e-152,   Method: Composition-based stats.
 Identities = 180/295 (61%), Positives = 217/295 (73%), Gaps = 10/295 (3%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ IIL L  YWA +GC I+QP DMEVGAGTFHP+TTLRA+GP  W AAYVQPSRRP
Sbjct: 1   MLTFQEIILKLHHYWASKGCAIIQPLDMEVGAGTFHPATTLRAIGPEPWTAAYVQPSRRP 60

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNR QHYYQ+QV++KP+P ++Q LY+ SL+ +GIDPL +D+RFVEDNWESPT
Sbjct: 61  TDGRYGENPNRTQHYYQYQVVMKPSPDDIQELYLGSLRELGIDPLENDIRFVEDNWESPT 120

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GMEI+QFTYFQQV G+EC P+ GEITYGLERLAMY+QNV+S+YDI++
Sbjct: 121 LGAWGLGWEVWSNGMEITQFTYFQQVGGLECKPVMGEITYGLERLAMYIQNVDSMYDILW 180

Query: 190 NAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRH 249
              +   + Y D+F Q+E E S YNFE AN E L   F   EKE   L++K +P      
Sbjct: 181 ANTQNGPLYYRDVFLQNEVEMSTYNFEEANVEELFKQFDLLEKEGYRLIEKNLP------ 234

Query: 250 HLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                PAY+  +KASH FNLLDAR  IS TERQ YILR+R LA    + +     
Sbjct: 235 ----IPAYEFVLKASHTFNLLDARHAISVTERQGYILRVRKLALEVAKEYYSARE 285


>gi|83589467|ref|YP_429476.1| glycyl-tRNA synthetase subunit alpha [Moorella thermoacetica ATCC
           39073]
 gi|123524936|sp|Q2RKV6|SYGA_MOOTA RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|83572381|gb|ABC18933.1| glycyl-tRNA synthetase alpha chain [Moorella thermoacetica ATCC
           39073]
          Length = 319

 Score =  540 bits (1393), Expect = e-152,   Method: Composition-based stats.
 Identities = 174/293 (59%), Positives = 218/293 (74%), Gaps = 14/293 (4%)

Query: 11  LSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPL 70
           ++FQ +I+TL ++WA+Q C I QPYD+E GAGT +P+T LR LGP  W+ AYV+PSRRP 
Sbjct: 1   MNFQELIMTLQRFWAEQNCVIQQPYDLEKGAGTMNPATFLRVLGPEPWRVAYVEPSRRPT 60

Query: 71  DGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTL 130
           DGRY ENPNRLQHYYQ+QVI+KP+P N+Q+LY++SL+A+GI+PL HD+RFVEDNWESPTL
Sbjct: 61  DGRYGENPNRLQHYYQYQVILKPSPDNVQDLYLQSLEAMGINPLEHDIRFVEDNWESPTL 120

Query: 131 GAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFN 190
           GAWGLGWE W DGMEI+QFTYFQQ  G +C P+S EITYGLERLAMY+Q VNSVYDI + 
Sbjct: 121 GAWGLGWEVWLDGMEITQFTYFQQCGGFDCHPVSAEITYGLERLAMYIQQVNSVYDIEWV 180

Query: 191 AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHH 250
                 + YGDI  Q+E +YS YNF +A+  +L N F   E E + ++++G+        
Sbjct: 181 ----DGITYGDIHHQTEVDYSHYNFTFADTAMLFNLFNAYEAEAMRVVEQGL-------- 228

Query: 251 LCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTP 303
             V PAYD  +K SH FNLLDARG IS TER  YI R+R LA+ C  A+L   
Sbjct: 229 --VQPAYDYTLKCSHTFNLLDARGAISVTERTAYIGRVRHLARLCAAAYLEQR 279


>gi|84625800|ref|YP_453172.1| glycyl-tRNA synthetase subunit alpha [Xanthomonas oryzae pv. oryzae
           MAFF 311018]
 gi|123520596|sp|Q2NXS9|SYGA_XANOM RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|84369740|dbj|BAE70898.1| Glycyl-tRNA synthetase alpha chain [Xanthomonas oryzae pv. oryzae
           MAFF 311018]
          Length = 302

 Score =  540 bits (1393), Expect = e-152,   Method: Composition-based stats.
 Identities = 179/300 (59%), Positives = 224/300 (74%), Gaps = 11/300 (3%)

Query: 6   NKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQP 65
           +++  ++FQ +I TL QYWA+QGC ++QP D+EVGAGTFHP+T LRALGP  W AAYVQP
Sbjct: 4   SRRVPITFQGLIQTLNQYWAEQGCVLIQPLDLEVGAGTFHPATFLRALGPEPWNAAYVQP 63

Query: 66  SRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNW 125
           SRRP DGRY ENPNRLQ YYQ+QV +KPNP N+Q+LY+ SL+A+GIDPL+HD+RFVEDNW
Sbjct: 64  SRRPTDGRYGENPNRLQRYYQYQVAMKPNPDNIQDLYLGSLQALGIDPLVHDLRFVEDNW 123

Query: 126 ESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVY 185
           ESPTLGAWGLGWE W +GME++QFTYFQQ  G+EC P+ GEITYGLERL MY+Q  ++VY
Sbjct: 124 ESPTLGAWGLGWEVWLNGMEVTQFTYFQQAGGLECKPVLGEITYGLERLCMYLQRCDNVY 183

Query: 186 DIVFN-AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
            +V+    +G  V YGD++ Q+E E S YNFE+AN   L + F   E E   L++ G+P 
Sbjct: 184 ALVWTYGPDGAAVTYGDVYHQNEVEQSTYNFEHANVAELFHRFDACEAEAKHLVEVGLP- 242

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY+Q  KASH FNLLDAR  IS TERQRYILR+R+LA+   +A+     
Sbjct: 243 ---------LPAYEQVSKASHAFNLLDARRAISVTERQRYILRVRALAQGVAQAYYAQRE 293


>gi|319943024|ref|ZP_08017307.1| glycyl-tRNA synthetase alpha subunit [Lautropia mirabilis ATCC
           51599]
 gi|319743566|gb|EFV95970.1| glycyl-tRNA synthetase alpha subunit [Lautropia mirabilis ATCC
           51599]
          Length = 300

 Score =  540 bits (1393), Expect = e-152,   Method: Composition-based stats.
 Identities = 165/295 (55%), Positives = 216/295 (73%), Gaps = 14/295 (4%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ IIL L +YW +QGC +LQPYDMEVGAGTFH +T LRA+GP  W+AAYVQPSRRP
Sbjct: 1   MLTFQQIILRLQEYWDKQGCALLQPYDMEVGAGTFHTATFLRAIGPEPWRAAYVQPSRRP 60

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNRLQHYYQ+QV++KP P ++ +LY+ SLKA+G+DP  +D+RFVED+WESPT
Sbjct: 61  KDGRYGENPNRLQHYYQYQVVLKPAPPDILDLYLGSLKALGLDPQANDIRFVEDDWESPT 120

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQ+V  ++C P +GEITYGLERLAMY+Q V +++D+ +
Sbjct: 121 LGAWGLGWEVWLNGMEVTQFTYFQEVGSLKCLPTTGEITYGLERLAMYLQKVENLFDLQW 180

Query: 190 NAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRH 249
                  + Y D+F Q+E E S YNF  A+ ++L  HF D E+E  +L++  +       
Sbjct: 181 ----APGITYRDVFHQNEVEQSTYNFTLADTKMLFAHFDDYEREARNLIEAKL------- 229

Query: 250 HLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                PAY+  +K SH FNLLDARG IS TER  YI R+R+LA+   +A+  +  
Sbjct: 230 ---ALPAYEMVMKCSHTFNLLDARGAISVTERAAYIGRVRALARGVAQAYYESRE 281


>gi|269965269|ref|ZP_06179390.1| glycyl-tRNA synthetase alpha subunit [Vibrio alginolyticus 40B]
 gi|269830070|gb|EEZ84298.1| glycyl-tRNA synthetase alpha subunit [Vibrio alginolyticus 40B]
          Length = 305

 Score =  540 bits (1393), Expect = e-152,   Method: Composition-based stats.
 Identities = 186/302 (61%), Positives = 220/302 (72%), Gaps = 9/302 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +IL L  YWAQ GCTI+QP DMEVGAGT HP T LRALGP     AYVQ
Sbjct: 1   MQKYDIKTFQGMILALQDYWAQNGCTIVQPLDMEVGAGTSHPMTCLRALGPEPMSTAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQV +KP+P N+Q LY+ SL+ +GIDPL+HD+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVALKPSPDNIQELYLGSLEVLGIDPLVHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYG+ERLAMY+Q V+SV
Sbjct: 121 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGIERLAMYIQEVDSV 180

Query: 185 YDIVFN-AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIP 243
           YD+V+N A +G  V YGDIF Q+E E S YNFE+A+ E L   F   EKEC         
Sbjct: 181 YDLVWNIAPDGSKVTYGDIFHQNEVEQSTYNFEHADVEFLFGFFEQCEKECK-------- 232

Query: 244 NEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTP 303
                      PAY++ +KA H FNLLDAR  IS TERQRYILRIR+L KA  EA+  + 
Sbjct: 233 ELLELEKPLPLPAYERILKAGHAFNLLDARKAISVTERQRYILRIRNLTKAVAEAYYASR 292

Query: 304 NG 305
             
Sbjct: 293 EA 294


>gi|242279453|ref|YP_002991582.1| glycyl-tRNA synthetase subunit alpha [Desulfovibrio salexigens DSM
           2638]
 gi|259511904|sp|C6BV68|SYGA_DESAD RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|242122347|gb|ACS80043.1| glycyl-tRNA synthetase, alpha subunit [Desulfovibrio salexigens DSM
           2638]
          Length = 290

 Score =  540 bits (1393), Expect = e-152,   Method: Composition-based stats.
 Identities = 163/294 (55%), Positives = 211/294 (71%), Gaps = 14/294 (4%)

Query: 11  LSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPL 70
           ++FQ++IL L  +W+  GC I+QP D+EVGAGTF+PST  R +GP  W  AYV+PSRRP 
Sbjct: 1   MNFQDVILKLQDFWSDYGCCIVQPLDIEVGAGTFNPSTFFRVIGPEPWNTAYVEPSRRPT 60

Query: 71  DGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTL 130
           DGRY ENPNRLQHY+QFQVI+KP+P ++Q+LY++SL+ +GID   HD+RFVED+WESPTL
Sbjct: 61  DGRYGENPNRLQHYFQFQVILKPSPDDVQDLYLKSLEVIGIDAKEHDIRFVEDDWESPTL 120

Query: 131 GAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFN 190
           GAWGLGWE W +GME++QFTYFQQV GI+  P+S E+TYGLERL MY+Q V SVYD+ +N
Sbjct: 121 GAWGLGWEVWLNGMEVTQFTYFQQVGGIDLKPVSVELTYGLERLCMYLQGVESVYDLKWN 180

Query: 191 AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHH 250
                 V YG IF Q+E E S+YNFE ++  +L + F   E E   L ++G+P       
Sbjct: 181 ----DKVTYGQIFYQNEVEQSKYNFELSDASMLLDLFDKYEAESKKLCEEGLPR------ 230

Query: 251 LCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
               PAY+ C+K SH FN+LDARG IS TER  YI R+R+LA A  + +     
Sbjct: 231 ----PAYEYCLKCSHTFNMLDARGAISITERATYIGRVRNLASAAAKLYAEERE 280


>gi|332703855|ref|ZP_08423943.1| Glycyl-tRNA synthetase alpha subunit [Desulfovibrio africanus str.
           Walvis Bay]
 gi|332554004|gb|EGJ51048.1| Glycyl-tRNA synthetase alpha subunit [Desulfovibrio africanus str.
           Walvis Bay]
          Length = 294

 Score =  540 bits (1393), Expect = e-152,   Method: Composition-based stats.
 Identities = 167/298 (56%), Positives = 210/298 (70%), Gaps = 15/298 (5%)

Query: 11  LSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPL 70
           ++FQ +IL L Q+W+  GC I QP+D+EVGAGTF+P T  R +GP  WK AYV+PSRRP 
Sbjct: 1   MTFQEVILRLQQFWSDYGCVIGQPFDVEVGAGTFNPHTFFRVIGPEPWKVAYVEPSRRPT 60

Query: 71  DGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTL 130
           DGRY ENPNRLQHYYQFQVI+KP+P ++Q++Y+ SL A+GID   HD+RFVEDNWESPTL
Sbjct: 61  DGRYGENPNRLQHYYQFQVILKPSPDDVQDIYLASLAALGIDTAAHDIRFVEDNWESPTL 120

Query: 131 GAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFN 190
           GAWGLGWE W +GME++QFTYFQQ  GI+  P+S EITYGLERL MY+Q   SVYD+ +N
Sbjct: 121 GAWGLGWEVWLNGMEVTQFTYFQQTGGIDLHPVSVEITYGLERLCMYLQGKESVYDLDWN 180

Query: 191 AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHH 250
               + V YG +  Q+E E S+YNFE+++  +L   F   E ECL L + G+P       
Sbjct: 181 ----KTVKYGQVHHQNEVEQSKYNFEFSDAGMLFGLFNSYEGECLRLCEVGLP------- 229

Query: 251 LCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTP-NGGH 307
              +PAYD C+K SH FNLLDARG IS TER  YI R+R+LA      +       G+
Sbjct: 230 ---WPAYDYCLKCSHAFNLLDARGAISITERTGYIGRVRNLASRVARLYATQRKEMGY 284


>gi|166714070|ref|ZP_02245277.1| glycyl-tRNA synthetase subunit alpha [Xanthomonas oryzae pv.
           oryzicola BLS256]
 gi|188574646|ref|YP_001911575.1| glycyl-tRNA synthetase subunit alpha [Xanthomonas oryzae pv. oryzae
           PXO99A]
 gi|238691584|sp|B2SII2|SYGA_XANOP RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|188519098|gb|ACD57043.1| glycyl-tRNA synthetase, alpha subunit [Xanthomonas oryzae pv.
           oryzae PXO99A]
          Length = 302

 Score =  540 bits (1393), Expect = e-152,   Method: Composition-based stats.
 Identities = 178/300 (59%), Positives = 224/300 (74%), Gaps = 11/300 (3%)

Query: 6   NKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQP 65
           +++  ++FQ +I TL QYWA+QGC ++QP D+EVGAGTFHP+T LRALGP  W AAYVQP
Sbjct: 4   SRRVPITFQGLIQTLNQYWAEQGCVLIQPLDLEVGAGTFHPATFLRALGPEPWNAAYVQP 63

Query: 66  SRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNW 125
           SRRP DGRY ENPNRLQ YYQ+QV +KPNP N+Q+LY+ SL+A+GIDPL+HD+RFVEDNW
Sbjct: 64  SRRPTDGRYGENPNRLQRYYQYQVAMKPNPDNIQDLYLGSLQALGIDPLVHDLRFVEDNW 123

Query: 126 ESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVY 185
           ESPTLGAWG+GWE W +GME++QFTYFQQ  G+EC P+ GEITYGLERL MY+Q  ++VY
Sbjct: 124 ESPTLGAWGVGWEVWLNGMEVTQFTYFQQAGGLECKPVLGEITYGLERLCMYLQRCDNVY 183

Query: 186 DIVFN-AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
            +V+    +G  V YGD++ Q+E E S YNFE+AN   L + F   E E   L++ G+P 
Sbjct: 184 ALVWTYGPDGAAVTYGDVYHQNEVEQSTYNFEHANVAELFHRFDACEAEAKHLVEVGLP- 242

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY+Q  KASH FNLLDAR  IS TERQRYILR+R+LA+   +A+     
Sbjct: 243 ---------LPAYEQVTKASHAFNLLDARRAISVTERQRYILRVRALAQGVAQAYYAQRE 293


>gi|171056907|ref|YP_001789256.1| glycyl-tRNA synthetase subunit alpha [Leptothrix cholodnii SP-6]
 gi|238689123|sp|B1Y7P3|SYGA_LEPCP RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|170774352|gb|ACB32491.1| glycyl-tRNA synthetase, alpha subunit [Leptothrix cholodnii SP-6]
          Length = 317

 Score =  540 bits (1392), Expect = e-152,   Method: Composition-based stats.
 Identities = 173/295 (58%), Positives = 216/295 (73%), Gaps = 14/295 (4%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ+IIL L  YW +QGC +LQPYDMEVGAGT H +T LRALGP  WKAAYVQPSRRP
Sbjct: 1   MLTFQHIILRLQDYWDRQGCALLQPYDMEVGAGTSHTATFLRALGPEPWKAAYVQPSRRP 60

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY  NPNRLQHYYQ+QV++KP P N+ +LY+ SL+A+G D   +D+RFVED+WE+PT
Sbjct: 61  KDGRYGNNPNRLQHYYQYQVVLKPAPANILDLYLGSLEALGFDLKKNDIRFVEDDWENPT 120

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQQV GI+C PI+GEITYGLERLAMY+Q V +VYD+ +
Sbjct: 121 LGAWGLGWEVWLNGMEVTQFTYFQQVGGIDCKPITGEITYGLERLAMYLQGVENVYDLQY 180

Query: 190 NAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRH 249
                  + YGD+F Q+E E S YNFE++N E L + F   E    +L+ + +       
Sbjct: 181 ----APGLTYGDVFHQNEVEQSTYNFEHSNVEFLLSAFGAHEGNAQELMAQQL------- 229

Query: 250 HLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                PAY+Q +KA+H FNLLDARG IS TER  YI RIR+LA+A   A+L +  
Sbjct: 230 ---ALPAYEQVLKAAHTFNLLDARGAISVTERAAYIGRIRNLARAVAAAYLDSRA 281


>gi|27364424|ref|NP_759952.1| glycyl-tRNA synthetase subunit alpha [Vibrio vulnificus CMCP6]
 gi|37678205|ref|NP_932814.1| glycyl-tRNA synthetase subunit alpha [Vibrio vulnificus YJ016]
 gi|320157807|ref|YP_004190186.1| glycyl-tRNA synthetase subunit alpha [Vibrio vulnificus MO6-24/O]
 gi|30316213|sp|Q8DDJ8|SYGA_VIBVU RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|61216580|sp|Q7MQI7|SYGA_VIBVY RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|27360543|gb|AAO09479.1| Glycyl-tRNA synthetase alpha chain [Vibrio vulnificus CMCP6]
 gi|37196944|dbj|BAC92785.1| glycyl-tRNA synthetase, alpha subunit [Vibrio vulnificus YJ016]
 gi|319933119|gb|ADV87983.1| glycyl-tRNA synthetase alpha chain [Vibrio vulnificus MO6-24/O]
          Length = 305

 Score =  540 bits (1392), Expect = e-152,   Method: Composition-based stats.
 Identities = 185/302 (61%), Positives = 224/302 (74%), Gaps = 9/302 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +IL L  YWAQ GCTI+QP DMEVGAGT HP T LRALGP     AYVQ
Sbjct: 1   MQKYDIKTFQGMILALQDYWAQNGCTIVQPLDMEVGAGTSHPMTCLRALGPEPMSTAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQV +KP+P N+Q LY+ SL+ +GIDPL+HD+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVALKPSPDNIQELYLGSLEVLGIDPLVHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYG+ERLAMY+Q V+SV
Sbjct: 121 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGIERLAMYIQEVDSV 180

Query: 185 YDIVFN-AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIP 243
           YD+ +N A +G  V YGDIF Q+E E S YNFE+A+ + L + F   EKEC  LL+   P
Sbjct: 181 YDLTWNIAPDGSKVTYGDIFHQNEVEQSTYNFEHADVDFLFSFFEQCEKECQQLLELEKP 240

Query: 244 NEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTP 303
                       AY++ +KA+H FNLLDAR  IS TERQRYILRIR+L K+  EA+  + 
Sbjct: 241 LPLP--------AYERILKAAHAFNLLDARKAISVTERQRYILRIRNLTKSVAEAYYASR 292

Query: 304 NG 305
             
Sbjct: 293 EA 294


>gi|239817705|ref|YP_002946615.1| glycyl-tRNA synthetase subunit alpha [Variovorax paradoxus S110]
 gi|259511918|sp|C5CM90|SYGA_VARPS RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|239804282|gb|ACS21349.1| glycyl-tRNA synthetase, alpha subunit [Variovorax paradoxus S110]
          Length = 301

 Score =  540 bits (1392), Expect = e-151,   Method: Composition-based stats.
 Identities = 169/294 (57%), Positives = 216/294 (73%), Gaps = 14/294 (4%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ IIL L  YWA +GC +LQPYDMEVGAGT H +T LRALGP  WKAAYVQPSRRP
Sbjct: 1   MLTFQQIILKLQSYWADKGCALLQPYDMEVGAGTSHTATFLRALGPEPWKAAYVQPSRRP 60

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNRLQHYYQ+QV++KP P N+  LY+ SL+A+G D   +D+RFVED+WE+PT
Sbjct: 61  KDGRYGENPNRLQHYYQYQVVLKPAPSNILELYLGSLEALGFDLKKNDIRFVEDDWENPT 120

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQQV GI+C PI+GEITYGLERLAMY+Q V++VY++ +
Sbjct: 121 LGAWGLGWEVWLNGMEVTQFTYFQQVGGIDCKPITGEITYGLERLAMYLQGVDNVYNLTW 180

Query: 190 NAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRH 249
                  + YGD++ Q+E E S YNFE+++ E L   F   EK+   L+ + +       
Sbjct: 181 T----DGLSYGDVYKQNEVEQSTYNFEHSDAEFLFTAFAAHEKQARHLMTEQL------- 229

Query: 250 HLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTP 303
                PAY+Q +KA+H FNLLDARG IS TER  YI RIR+LA++  +++  + 
Sbjct: 230 ---ALPAYEQVLKAAHSFNLLDARGAISVTERAAYIGRIRNLARSVAQSYYESR 280


>gi|303233240|ref|ZP_07319912.1| glycine--tRNA ligase, alpha subunit [Atopobium vaginae PB189-T1-4]
 gi|302480630|gb|EFL43718.1| glycine--tRNA ligase, alpha subunit [Atopobium vaginae PB189-T1-4]
          Length = 308

 Score =  540 bits (1392), Expect = e-151,   Method: Composition-based stats.
 Identities = 176/301 (58%), Positives = 223/301 (74%), Gaps = 11/301 (3%)

Query: 4   IHNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYV 63
           ++ +   L+FQ++ILTL  YWA+QGCTI+QPYD EVGAGTFHP+T LR+LG   W A Y 
Sbjct: 1   MNTEHTPLTFQDMILTLQSYWAKQGCTIMQPYDSEVGAGTFHPATLLRSLGSKPWSACYA 60

Query: 64  QPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVED 123
           QP RRP DGRY  NPNRLQHYYQFQV+IKP+P N Q LY+ SL A+G++P  HDVRFVED
Sbjct: 61  QPCRRPADGRYGTNPNRLQHYYQFQVLIKPSPHNAQELYLNSLTAIGLNPEEHDVRFVED 120

Query: 124 NWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNS 183
           +WESPTLGAWGLGWE W +GME++QFTYFQQV G+E +P+  EITYGLER+AMY Q  +S
Sbjct: 121 DWESPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLEVNPVPVEITYGLERIAMYAQGKDS 180

Query: 184 VYDIVFNA-IEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGI 242
           V+D+V++    G+ V YGD++ ++E E+S YNFE AN +++   F D E+EC   L+  +
Sbjct: 181 VFDLVWSYLPSGEPVTYGDVYHENEFEFSTYNFELANIDMMRQKFDDYERECHACLEHHV 240

Query: 243 PNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMT 302
           P            AYD  +K SH FNLLD+RG IS TER  YILR+R+LAK C EA++ T
Sbjct: 241 P----------LVAYDCVMKCSHAFNLLDSRGAISATERANYILRVRTLAKLCCEAYVAT 290

Query: 303 P 303
           P
Sbjct: 291 P 291


>gi|237748759|ref|ZP_04579239.1| glycyl-tRNA synthetase [Oxalobacter formigenes OXCC13]
 gi|229380121|gb|EEO30212.1| glycyl-tRNA synthetase [Oxalobacter formigenes OXCC13]
          Length = 303

 Score =  540 bits (1392), Expect = e-151,   Method: Composition-based stats.
 Identities = 168/300 (56%), Positives = 215/300 (71%), Gaps = 14/300 (4%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            ++FQ II TL QYW+QQGC +LQPYDMEVGAGT H +T LRA+GP  W+AAYVQPSRRP
Sbjct: 1   MITFQQIIFTLQQYWSQQGCALLQPYDMEVGAGTSHTATFLRAIGPEPWRAAYVQPSRRP 60

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNR+QHYYQFQV++KP P ++ +LY+ SL A+G+D   +DVRFVED+WE+PT
Sbjct: 61  KDGRYGENPNRMQHYYQFQVVLKPAPEDILDLYLGSLAALGLDLKQNDVRFVEDDWENPT 120

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQQV GI+C PI GEITYGLERLAMY+Q V +VYD+V+
Sbjct: 121 LGAWGLGWEVWLNGMEVTQFTYFQQVGGIDCKPILGEITYGLERLAMYLQGVENVYDLVW 180

Query: 190 NAIEGQNV----LYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNE 245
                + V     YGD++ Q+E E S +NFE AN   L   F + E E   L+++ +   
Sbjct: 181 TEWTDRGVKKYLTYGDVYHQNEVEQSAFNFEQANVPFLFTLFGNYETEAKRLIEEKLT-- 238

Query: 246 HHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNG 305
                    PAY+  +KA+H FNLLDARG +S TER  YI RIR+L++   + +  +   
Sbjct: 239 --------LPAYENILKAAHTFNLLDARGALSVTERAAYIGRIRTLSRMVAQGYYESREA 290


>gi|209696358|ref|YP_002264289.1| glycyl-tRNA synthetase subunit alpha [Aliivibrio salmonicida
           LFI1238]
 gi|238064834|sp|B6EGT2|SYGA_ALISL RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|208010312|emb|CAQ80648.1| glycine-tRNA synthetase, alpha subunit [Aliivibrio salmonicida
           LFI1238]
          Length = 310

 Score =  539 bits (1391), Expect = e-151,   Method: Composition-based stats.
 Identities = 183/301 (60%), Positives = 217/301 (72%), Gaps = 8/301 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +IL L  YWAQQGCTI+QP DMEVGAGT HP T LRALGP     AYVQ
Sbjct: 1   MQKYDIKTFQGMILALQDYWAQQGCTIVQPLDMEVGAGTSHPMTCLRALGPEPMATAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQV +KP+P N+Q LY+ SL+ +GIDPL+HD+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVALKPSPDNIQELYLGSLEVLGIDPLVHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYG+ERLAMY+Q V SV
Sbjct: 121 WENPTLGAWGLGWEIWLNGMEVTQFTYFQQVGGLECKPVTGEITYGIERLAMYIQEVGSV 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V+N      V YGDIF Q+E E S YNFE+A+ + L   F   EKEC          
Sbjct: 181 YDLVWNYGPQGVVTYGDIFHQNEVEQSTYNFEHADVDFLFGFFDQCEKECK--------E 232

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY++ +KA H FNLLDAR  IS TERQRYILRIR+L K+  EA+  +  
Sbjct: 233 LLELEKPLPLPAYERILKAGHAFNLLDARKAISVTERQRYILRIRNLTKSVAEAYYASRE 292

Query: 305 G 305
            
Sbjct: 293 A 293


>gi|126728899|ref|ZP_01744714.1| glycyl-tRNA synthetase subunit alpha [Sagittula stellata E-37]
 gi|126710829|gb|EBA09880.1| glycyl-tRNA synthetase subunit alpha [Sagittula stellata E-37]
          Length = 317

 Score =  539 bits (1391), Expect = e-151,   Method: Composition-based stats.
 Identities = 197/311 (63%), Positives = 237/311 (76%), Gaps = 4/311 (1%)

Query: 1   MAPIHNK--KNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSW 58
           M+    K      SFQ IIL L  YWA +GC ILQPYDMEVGAGTFHP+TTLRALG   W
Sbjct: 1   MSETQQKSPHKPASFQEIILRLQTYWASKGCAILQPYDMEVGAGTFHPATTLRALGNRPW 60

Query: 59  KAAYVQPSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDV 118
            AAYVQPSRRP DGRY ENPNRLQHYYQ+QVIIKP+P +LQ LY+ SL+A+GID  +HD+
Sbjct: 61  TAAYVQPSRRPTDGRYGENPNRLQHYYQYQVIIKPSPPDLQALYLGSLEAIGIDMALHDI 120

Query: 119 RFVEDNWESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYV 178
           RFVED+WESPTLGAWGLGWE WCDGME+SQFTYFQQV G +C P+SGE+TYGLERLAMYV
Sbjct: 121 RFVEDDWESPTLGAWGLGWEVWCDGMEVSQFTYFQQVGGHDCHPVSGELTYGLERLAMYV 180

Query: 179 QNVNSVYDIVFNAIEGQN-VLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDL 237
             V+ V ++ FN  +    + YGD+F Q+E+EYSR+NF+ A+  +L  HF ++E EC  +
Sbjct: 181 LGVDHVMEMPFNDPQSPIALTYGDVFRQTEEEYSRFNFDTADTALLLRHFEEAEAECAAI 240

Query: 238 LKKGIPNEH-HRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACG 296
           L +   +    +  +   PAYDQCIKASHIFNLLDARGVIS TERQ YI R+R+LAK C 
Sbjct: 241 LARDAEDPKTGKRIVMAHPAYDQCIKASHIFNLLDARGVISVTERQAYIGRVRALAKMCA 300

Query: 297 EAFLMTPNGGH 307
           +AF+ T  GG+
Sbjct: 301 DAFVTTTAGGY 311


>gi|296161022|ref|ZP_06843833.1| glycyl-tRNA synthetase, alpha subunit [Burkholderia sp. Ch1-1]
 gi|295888721|gb|EFG68528.1| glycyl-tRNA synthetase, alpha subunit [Burkholderia sp. Ch1-1]
          Length = 335

 Score =  539 bits (1391), Expect = e-151,   Method: Composition-based stats.
 Identities = 170/303 (56%), Positives = 215/303 (70%), Gaps = 18/303 (5%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ IILT+  YW +QGC +LQP DMEVGAGT H  T LRA+GP  W+AAYVQPSRRP
Sbjct: 1   MLTFQQIILTMQSYWDKQGCALLQPIDMEVGAGTSHVHTFLRAIGPEPWRAAYVQPSRRP 60

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNRLQHYYQ+QV++KP P N+ +LY+ SL+A+G D   +DVRFVED+WE+PT
Sbjct: 61  KDGRYGENPNRLQHYYQYQVVLKPAPENILDLYLGSLEALGFDLKQNDVRFVEDDWENPT 120

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQQV G++C P+ GEITYGLERLAMY+Q V +VYD+V+
Sbjct: 121 LGAWGLGWEVWLNGMEVTQFTYFQQVGGLDCKPVLGEITYGLERLAMYLQKVENVYDLVW 180

Query: 190 --------NAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKG 241
                   N  E + + YGD++ Q+E E S YNFE+AN E+L + F   E E   +++  
Sbjct: 181 TEWEEQGPNGPELRRLTYGDVYHQNEVEQSAYNFEHANVELLFSIFNSYEAEARRMIEAQ 240

Query: 242 IPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLM 301
                        PAY+  +KA H FNLLDARG IS TER  YI RIR+L+K   +A+  
Sbjct: 241 ----------IALPAYELVLKAGHTFNLLDARGAISVTERAAYIGRIRALSKLVAQAYYD 290

Query: 302 TPN 304
           +  
Sbjct: 291 SRE 293


>gi|326318833|ref|YP_004236505.1| glycyl-tRNA synthetase subunit alpha [Acidovorax avenae subsp.
           avenae ATCC 19860]
 gi|323375669|gb|ADX47938.1| glycyl-tRNA synthetase, alpha subunit [Acidovorax avenae subsp.
           avenae ATCC 19860]
          Length = 314

 Score =  539 bits (1391), Expect = e-151,   Method: Composition-based stats.
 Identities = 169/295 (57%), Positives = 215/295 (72%), Gaps = 14/295 (4%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ IIL L  YW  QGC +LQPYDMEVGAGT H +T LRALGP  WKAAYVQPSRRP
Sbjct: 1   MLTFQQIILKLQSYWDAQGCALLQPYDMEVGAGTSHTATFLRALGPEPWKAAYVQPSRRP 60

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNRLQHYYQ+QV++KP P N+  LY+ SL+A+G D   +D+RFVED+WE+PT
Sbjct: 61  KDGRYGENPNRLQHYYQYQVVLKPAPDNILELYLGSLEALGFDLKKNDIRFVEDDWENPT 120

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQQV GI+C P +GEITYGLERLAMY+Q V++VY++ +
Sbjct: 121 LGAWGLGWEVWLNGMEVTQFTYFQQVGGIDCKPATGEITYGLERLAMYLQGVDNVYNLAW 180

Query: 190 NAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRH 249
                  + YGD++ Q+E E S YNFE+++ + L   F   EK+   L+++ +       
Sbjct: 181 T----DTLKYGDVYHQNEVEQSTYNFEHSDADFLFTAFAAHEKQAQYLMEQQL------- 229

Query: 250 HLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                PAY+Q +KA+H FNLLDARG IS TER  YI RIR+LA+A   ++L +  
Sbjct: 230 ---ALPAYEQVLKAAHSFNLLDARGAISVTERAAYIGRIRNLARAVARSYLDSRA 281


>gi|254373943|ref|ZP_04989425.1| hypothetical protein FTDG_00099 [Francisella novicida GA99-3548]
 gi|151571663|gb|EDN37317.1| hypothetical protein FTDG_00099 [Francisella novicida GA99-3548]
          Length = 296

 Score =  539 bits (1391), Expect = e-151,   Method: Composition-based stats.
 Identities = 180/295 (61%), Positives = 217/295 (73%), Gaps = 10/295 (3%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ IIL L  YWA +GC I+QP DMEVGAGTFHP+TTLRA+GP  W AAYVQPSRRP
Sbjct: 1   MLTFQEIILKLHHYWASKGCAIIQPLDMEVGAGTFHPATTLRAIGPEPWTAAYVQPSRRP 60

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNR QHYYQ+QV++KP+P ++Q LY+ SL+ +GIDPL +D+RFVEDNWESPT
Sbjct: 61  TDGRYGENPNRTQHYYQYQVVMKPSPDDIQELYLGSLRELGIDPLENDIRFVEDNWESPT 120

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GMEI+QFTYFQQV G+EC P+ GEITYGLERLAMY+QNV+S+YDI++
Sbjct: 121 LGAWGLGWEVWSNGMEITQFTYFQQVGGLECKPVMGEITYGLERLAMYIQNVDSMYDILW 180

Query: 190 NAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRH 249
              +   + Y D+F Q+E E S YNFE AN E L   F   EKE   L++K +P      
Sbjct: 181 ANTQNGPLYYRDVFLQNEVEMSTYNFEEANVEELFKQFDLLEKEGYRLVEKNLP------ 234

Query: 250 HLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                PAY+  +KASH FNLLDAR  IS TERQ YILR+R LA    + +     
Sbjct: 235 ----IPAYEFVLKASHTFNLLDARHAISVTERQGYILRVRKLALEVAKEYYSARE 285


>gi|28198745|ref|NP_779059.1| glycyl-tRNA synthetase subunit alpha [Xylella fastidiosa Temecula1]
 gi|71275843|ref|ZP_00652127.1| Glycyl-tRNA synthetase, alpha subunit [Xylella fastidiosa Dixon]
 gi|71897930|ref|ZP_00680135.1| Glycyl-tRNA synthetase, alpha subunit [Xylella fastidiosa Ann-1]
 gi|71899339|ref|ZP_00681499.1| Glycyl-tRNA synthetase, alpha subunit [Xylella fastidiosa Ann-1]
 gi|170730174|ref|YP_001775607.1| glycyl-tRNA synthetase subunit alpha [Xylella fastidiosa M12]
 gi|182681437|ref|YP_001829597.1| glycyl-tRNA synthetase subunit alpha [Xylella fastidiosa M23]
 gi|32130156|sp|Q87D46|SYGA_XYLFT RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|238688046|sp|B0U7B1|SYGA_XYLFM RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|238691035|sp|B2I4M8|SYGA_XYLF2 RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|28056836|gb|AAO28708.1| glycyl-tRNA synthetase alpha chain [Xylella fastidiosa Temecula1]
 gi|71163421|gb|EAO13139.1| Glycyl-tRNA synthetase, alpha subunit [Xylella fastidiosa Dixon]
 gi|71730853|gb|EAO32924.1| Glycyl-tRNA synthetase, alpha subunit [Xylella fastidiosa Ann-1]
 gi|71732174|gb|EAO34229.1| Glycyl-tRNA synthetase, alpha subunit [Xylella fastidiosa Ann-1]
 gi|167964967|gb|ACA11977.1| Glycine--tRNA ligase [Xylella fastidiosa M12]
 gi|182631547|gb|ACB92323.1| glycyl-tRNA synthetase, alpha subunit [Xylella fastidiosa M23]
          Length = 307

 Score =  539 bits (1391), Expect = e-151,   Method: Composition-based stats.
 Identities = 179/297 (60%), Positives = 222/297 (74%), Gaps = 11/297 (3%)

Query: 9   NDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRR 68
              +FQ +I TL +YWA+QGC ++QP D+EVGAGTFHP+T LRALGP  W AAYVQPSRR
Sbjct: 12  TSTTFQGLIQTLNRYWAEQGCVLVQPLDLEVGAGTFHPATFLRALGPEPWNAAYVQPSRR 71

Query: 69  PLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESP 128
           P DGRY ENPNRLQ YYQ+QV +KPNP NLQ LY+ SL+A+GIDPL+HDVRFVEDNWESP
Sbjct: 72  PTDGRYGENPNRLQRYYQYQVAMKPNPDNLQELYLASLQALGIDPLVHDVRFVEDNWESP 131

Query: 129 TLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIV 188
           TLGAWGLGWE W +GME++QFTYFQQ  G+EC P+ GE+TYGLERL MY+Q+ ++VYD+V
Sbjct: 132 TLGAWGLGWEVWLNGMEVTQFTYFQQAGGLECKPVLGEVTYGLERLCMYLQSCDNVYDLV 191

Query: 189 FN-AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHH 247
           +    +G  V YGD++ Q+E E S YNFE+AN   L + F   E+E   L++  +P    
Sbjct: 192 WTYGPDGTPVTYGDVYHQNEVEQSAYNFEHANVTELLHTFDACEREAKSLVEAVLP---- 247

Query: 248 RHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                  PAY++ IKASH FNLLDAR  IS TERQRYILRIR+L++   +A+     
Sbjct: 248 ------LPAYEKVIKASHCFNLLDARRTISVTERQRYILRIRTLSQEVAKAYYAQRE 298


>gi|261250631|ref|ZP_05943206.1| glycyl-tRNA synthetase alpha chain [Vibrio orientalis CIP 102891]
 gi|260939200|gb|EEX95187.1| glycyl-tRNA synthetase alpha chain [Vibrio orientalis CIP 102891]
          Length = 306

 Score =  539 bits (1391), Expect = e-151,   Method: Composition-based stats.
 Identities = 184/302 (60%), Positives = 221/302 (73%), Gaps = 9/302 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +IL L  YWAQ GCTI+QP DMEVGAGT HP T LRALGP     AYVQ
Sbjct: 1   MQKYDIKTFQGMILALQDYWAQNGCTIVQPLDMEVGAGTSHPMTCLRALGPEPMSTAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQV +KP+P N+Q LY+ SL+ +GIDPL+HD+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVALKPSPDNIQELYLGSLEVLGIDPLVHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYG+ERLAMY+Q V+SV
Sbjct: 121 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGIERLAMYIQEVDSV 180

Query: 185 YDIVFN-AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIP 243
           YD+V+N A +G NV YGDIF Q+E E S YNFE+A+ + L   F   EKEC         
Sbjct: 181 YDLVWNVAPDGSNVTYGDIFHQNEVEQSTYNFEHADVDFLFTFFDQCEKECK-------- 232

Query: 244 NEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTP 303
                      PAY++ +KA H FN+LDAR  IS TERQRYILRIR+L K+  EA+  + 
Sbjct: 233 ELLELEKPLPLPAYERILKAGHAFNILDARKAISVTERQRYILRIRNLTKSVAEAYYASR 292

Query: 304 NG 305
             
Sbjct: 293 EA 294


>gi|297617794|ref|YP_003702953.1| glycyl-tRNA synthetase, subunit alpha [Syntrophothermus lipocalidus
           DSM 12680]
 gi|297145631|gb|ADI02388.1| glycyl-tRNA synthetase, alpha subunit [Syntrophothermus lipocalidus
           DSM 12680]
          Length = 300

 Score =  539 bits (1391), Expect = e-151,   Method: Composition-based stats.
 Identities = 169/294 (57%), Positives = 210/294 (71%), Gaps = 14/294 (4%)

Query: 11  LSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPL 70
           ++FQ IIL L  +W  QGC I QPYD+E GAGT +P+T LRALGP  W  AYV+PSRRP 
Sbjct: 1   MTFQEIILALETFWGSQGCIIQQPYDVEKGAGTMNPATFLRALGPEPWNVAYVEPSRRPT 60

Query: 71  DGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTL 130
           DGRY ENPNRLQHYYQ+QVI+KP+P N+ +LY++SL+ +GIDP  HD+R VEDNWESPTL
Sbjct: 61  DGRYGENPNRLQHYYQYQVILKPSPDNVIDLYLDSLRTLGIDPRKHDIRLVEDNWESPTL 120

Query: 131 GAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFN 190
           GAWGLGWE W DGMEI+QFTYFQQ  GI+C P+  EITYG+ER+AMY+QN  SV+DI + 
Sbjct: 121 GAWGLGWEIWLDGMEITQFTYFQQCGGIDCYPVCAEITYGIERIAMYIQNKESVFDIEWV 180

Query: 191 AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHH 250
                 + YGD+  QSE +YS YNF+ A+ E L   F   EKE   +L+K +        
Sbjct: 181 ----DGITYGDVHHQSEVDYSYYNFQVADIETLVTMFDLCEKEAKRVLEKEL-------- 228

Query: 251 LCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
             V PAYD  +K SH+FNLLDARG IS TER  YI R+R++A++   A+L    
Sbjct: 229 --VQPAYDYVLKCSHLFNLLDARGAISVTERTSYIARVRNMARSVALAYLRQRE 280


>gi|294667521|ref|ZP_06732737.1| glycyl-tRNA synthetase alpha subunit [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
 gi|292602750|gb|EFF46185.1| glycyl-tRNA synthetase alpha subunit [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
          Length = 302

 Score =  539 bits (1391), Expect = e-151,   Method: Composition-based stats.
 Identities = 179/300 (59%), Positives = 225/300 (75%), Gaps = 11/300 (3%)

Query: 6   NKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQP 65
           +++  ++FQ +I TL QYWA+QGC ++QP D+EVGAGTFHP+T LRALGP  W AAYVQP
Sbjct: 4   SRRVPITFQGLIQTLNQYWAEQGCVLIQPLDLEVGAGTFHPATFLRALGPEPWNAAYVQP 63

Query: 66  SRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNW 125
           SRRP DGRY ENPNRLQ YYQ+QV +KPNP N+Q+LY+ SL+A+GIDPL+HD+RFVEDNW
Sbjct: 64  SRRPTDGRYGENPNRLQRYYQYQVAMKPNPDNIQDLYLGSLQALGIDPLVHDLRFVEDNW 123

Query: 126 ESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVY 185
           ESPTLGAWGLGWE W +GME++QFTYFQQ  G+EC P+ GEITYGLERL MY+Q+ ++VY
Sbjct: 124 ESPTLGAWGLGWEVWLNGMEVTQFTYFQQAGGLECKPVLGEITYGLERLCMYLQSCDNVY 183

Query: 186 DIVFN-AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           ++V+    +G  V YGD++ Q+E E S YNFE+AN   L + F   E E   L++ G+P 
Sbjct: 184 ELVWTYGPDGAAVTYGDVYHQNEVEQSTYNFEHANVAELFHRFDACEAEARHLVEVGLP- 242

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                     PAY+Q  KASH FNLLDAR  IS TERQRYILR+R+LA+    A+     
Sbjct: 243 ---------LPAYEQVTKASHAFNLLDARRAISVTERQRYILRVRALAQGVXAAYYAQRE 293


>gi|328676585|gb|AEB27455.1| Glycyl-tRNA synthetase alpha chain [Francisella cf. novicida Fx1]
          Length = 296

 Score =  539 bits (1391), Expect = e-151,   Method: Composition-based stats.
 Identities = 179/295 (60%), Positives = 217/295 (73%), Gaps = 10/295 (3%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ IIL L  YWA +GC I+QP DMEVGAGTFHP+TTLRA+GP  W AAYVQPSRRP
Sbjct: 1   MLTFQEIILKLHHYWASKGCAIVQPLDMEVGAGTFHPATTLRAIGPEPWTAAYVQPSRRP 60

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNR QHYYQ+QV++KP+P ++Q LY+ SL+ +GIDPL +D+RFVEDNWESPT
Sbjct: 61  TDGRYGENPNRTQHYYQYQVVMKPSPDDIQELYLGSLRELGIDPLENDIRFVEDNWESPT 120

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GMEI+QFTYFQQV G+EC P+ GEITYGLERLAMY+QNV+S+YDI++
Sbjct: 121 LGAWGLGWEVWSNGMEITQFTYFQQVGGLECKPVMGEITYGLERLAMYIQNVDSMYDILW 180

Query: 190 NAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRH 249
              +   + Y D+F Q+E E S YNFE AN E L   F   EKE   L+++ +P      
Sbjct: 181 ANTQNGPLYYRDVFLQNEVEMSTYNFEEANVEELFKQFDLLEKEGYRLVERNLP------ 234

Query: 250 HLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                PAY+  +KASH FNLLDAR  IS TERQ YILR+R LA    + +     
Sbjct: 235 ----IPAYEFVLKASHTFNLLDARHAISVTERQGYILRVRKLALEVAKEYYSARE 285


>gi|15838554|ref|NP_299242.1| glycyl-tRNA synthetase subunit alpha [Xylella fastidiosa 9a5c]
 gi|11387204|sp|Q9PC25|SYGA_XYLFA RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|9107062|gb|AAF84762.1|AE004015_5 glycyl-tRNA synthetase alpha chain [Xylella fastidiosa 9a5c]
          Length = 307

 Score =  539 bits (1391), Expect = e-151,   Method: Composition-based stats.
 Identities = 179/297 (60%), Positives = 222/297 (74%), Gaps = 11/297 (3%)

Query: 9   NDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRR 68
              +FQ +I TL +YWA+QGC ++QP D+EVGAGTFHP+T LRALGP  W AAYVQPSRR
Sbjct: 12  TSTTFQGLIHTLNRYWAEQGCVLVQPLDLEVGAGTFHPATFLRALGPEPWNAAYVQPSRR 71

Query: 69  PLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESP 128
           P DGRY ENPNRLQ YYQ+QV +KPNP NLQ LY+ SL+A+GIDPL+HDVRFVEDNWESP
Sbjct: 72  PTDGRYGENPNRLQRYYQYQVAMKPNPDNLQELYLASLQALGIDPLVHDVRFVEDNWESP 131

Query: 129 TLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIV 188
           TLGAWGLGWE W +GME++QFTYFQQ  G+EC P+ GE+TYGLERL MY+Q+ ++VYD+V
Sbjct: 132 TLGAWGLGWEVWLNGMEVTQFTYFQQAGGLECKPVLGEVTYGLERLCMYLQSCDNVYDLV 191

Query: 189 FN-AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHH 247
           +    +G  V YGD++ Q+E E S YNFE+AN   L + F   E+E   L++  +P    
Sbjct: 192 WTYGPDGTPVTYGDVYHQNEVEQSAYNFEHANVTELLHTFDACEREAKALVEAVLP---- 247

Query: 248 RHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                  PAY++ IKASH FNLLDAR  IS TERQRYILRIR+L++   +A+     
Sbjct: 248 ------LPAYEKVIKASHCFNLLDARRTISVTERQRYILRIRTLSQEVAKAYYAQRE 298


>gi|313892684|ref|ZP_07826267.1| glycine--tRNA ligase, alpha subunit [Veillonella sp. oral taxon 158
           str. F0412]
 gi|313442775|gb|EFR61184.1| glycine--tRNA ligase, alpha subunit [Veillonella sp. oral taxon 158
           str. F0412]
          Length = 291

 Score =  539 bits (1390), Expect = e-151,   Method: Composition-based stats.
 Identities = 158/294 (53%), Positives = 205/294 (69%), Gaps = 14/294 (4%)

Query: 11  LSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPL 70
           ++FQ IIL L ++W+ QGC +  PYD+E GAGT +P+T L A+GP  W   YV+PSRRP 
Sbjct: 1   MTFQEIILNLQKFWSDQGCIVQNPYDIEKGAGTMNPATFLHAIGPEPWAVCYVEPSRRPA 60

Query: 71  DGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTL 130
           DGRY +NPNRL  ++QFQVI+K +P N+Q LY++SL A+GI    HD+RFVEDNWESPTL
Sbjct: 61  DGRYGDNPNRLFQHHQFQVIVKSSPDNIQELYLQSLAALGIHAEDHDIRFVEDNWESPTL 120

Query: 131 GAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFN 190
           GAWGLGWE W DGME++QFTYFQQV  I+C P+S EITYGLERLAMY+Q V +VYD+ +N
Sbjct: 121 GAWGLGWEVWLDGMEVTQFTYFQQVGSIDCKPVSVEITYGLERLAMYIQGVENVYDLKWN 180

Query: 191 AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHH 250
               +NV YGD++  +E E S YNFE A+ ++L   F   E E   + + G         
Sbjct: 181 ----ENVTYGDVWHANEVEQSVYNFELADTDMLFKLFDMYEAEAKRVCEAGY-------- 228

Query: 251 LCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
             V PAYD  +K SH FNLLD+RG IS +ER  +I R+R+LA+ C + +L    
Sbjct: 229 --VLPAYDYVLKCSHTFNLLDSRGAISISERTAFIGRVRALARICAQQYLAKRE 280


>gi|323496934|ref|ZP_08101962.1| glycyl-tRNA synthetase subunit alpha [Vibrio sinaloensis DSM 21326]
 gi|323318008|gb|EGA70991.1| glycyl-tRNA synthetase subunit alpha [Vibrio sinaloensis DSM 21326]
          Length = 306

 Score =  539 bits (1390), Expect = e-151,   Method: Composition-based stats.
 Identities = 183/302 (60%), Positives = 220/302 (72%), Gaps = 9/302 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +IL L  YWAQ GCTI+QP DMEVGAGT HP T LRALGP     AYVQ
Sbjct: 1   MQKYDIKTFQGMILALQDYWAQNGCTIVQPLDMEVGAGTSHPMTCLRALGPEPMSTAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQV +KP+P N+Q LY+ SL+ +GIDPL+HD+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVALKPSPDNIQELYLGSLEVLGIDPLVHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYG+ERLAMY+Q V+SV
Sbjct: 121 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGIERLAMYIQEVDSV 180

Query: 185 YDIVFN-AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIP 243
           YD+V+N A +G  V YGDIF Q+E E S YNFE+A+ + L   F   EKEC         
Sbjct: 181 YDLVWNIAPDGSKVTYGDIFHQNEVEQSTYNFEHADVDFLFTFFDQCEKECK-------- 232

Query: 244 NEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTP 303
                      PAY++ +KA H FN+LDAR  IS TERQRYILRIR+L K+  EA+  + 
Sbjct: 233 ELLELEKPLPLPAYERILKAGHAFNILDARKAISVTERQRYILRIRNLTKSVAEAYYASR 292

Query: 304 NG 305
             
Sbjct: 293 EA 294


>gi|254372480|ref|ZP_04987969.1| glycyl-tRNA synthetase alpha chain [Francisella tularensis subsp.
           novicida GA99-3549]
 gi|151570207|gb|EDN35861.1| glycyl-tRNA synthetase alpha chain [Francisella novicida GA99-3549]
          Length = 302

 Score =  539 bits (1390), Expect = e-151,   Method: Composition-based stats.
 Identities = 180/295 (61%), Positives = 216/295 (73%), Gaps = 10/295 (3%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ IIL L  YWA +GC I+QP DMEVGAGTFHP+TTLRA+GP  W AAYVQPSRRP
Sbjct: 7   MLTFQEIILKLHHYWASKGCAIIQPLDMEVGAGTFHPATTLRAIGPEPWTAAYVQPSRRP 66

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNR QHYYQ+QV++KP+P ++Q LY+ SL+ +GIDPL +D+RFVEDNWESPT
Sbjct: 67  TDGRYGENPNRTQHYYQYQVVMKPSPDDIQELYLGSLRELGIDPLENDIRFVEDNWESPT 126

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GMEI+QFTYFQQV G+EC P+ GEITYGLERLAMY+QNV+S+YDI++
Sbjct: 127 LGAWGLGWEVWSNGMEITQFTYFQQVGGLECKPVMGEITYGLERLAMYIQNVDSMYDILW 186

Query: 190 NAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRH 249
              +   + Y D+F Q+E E S YNFE AN E L   F   EKE   L+ K +P      
Sbjct: 187 ANTQNGPLYYRDVFLQNEVEMSTYNFEEANVEELFKQFDLLEKEGYRLIGKNLP------ 240

Query: 250 HLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                PAY+  +KASH FNLLDAR  IS TERQ YILR+R LA    + +     
Sbjct: 241 ----IPAYEFVLKASHTFNLLDARHAISVTERQGYILRVRKLALEVAKEYYSARE 291


>gi|167617967|ref|ZP_02386598.1| glycyl-tRNA synthetase subunit alpha [Burkholderia thailandensis
           Bt4]
 gi|257140196|ref|ZP_05588458.1| glycyl-tRNA synthetase subunit alpha [Burkholderia thailandensis
           E264]
          Length = 335

 Score =  539 bits (1390), Expect = e-151,   Method: Composition-based stats.
 Identities = 169/303 (55%), Positives = 213/303 (70%), Gaps = 18/303 (5%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ IILTL  YW +QGC +LQP DMEVGAGT H  T LRA+GP  W+AAYVQPSRRP
Sbjct: 1   MLTFQQIILTLQSYWDRQGCALLQPIDMEVGAGTSHVHTFLRAIGPEPWRAAYVQPSRRP 60

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNRLQHYYQ+QV++KP P N+ +LY+ SL A+G D   +DVRFVED+WE+PT
Sbjct: 61  KDGRYGENPNRLQHYYQYQVVLKPAPENILDLYLGSLAALGFDLKQNDVRFVEDDWENPT 120

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQQV G++C P+ GEITYGLERLAMY+Q V +VYD+++
Sbjct: 121 LGAWGLGWEVWLNGMEVTQFTYFQQVGGLDCKPVLGEITYGLERLAMYLQKVENVYDLIW 180

Query: 190 --------NAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKG 241
                   N  E + + YGD++ Q+E E S YNFE AN E+L   F   E E   +++  
Sbjct: 181 TEWEEQGPNGPEIRRLTYGDVYHQNEVEQSTYNFEQANVELLFTFFNSYEAEAKRMIEAQ 240

Query: 242 IPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLM 301
           +            PAY+  +KA H FNLLDARG IS TER  YI RIR+L++   +A+  
Sbjct: 241 L----------ALPAYELVLKAGHTFNLLDARGAISVTERAAYIGRIRALSRLVAQAYYD 290

Query: 302 TPN 304
           +  
Sbjct: 291 SRE 293


>gi|86605300|ref|YP_474063.1| glycyl-tRNA synthetase subunit alpha [Synechococcus sp. JA-3-3Ab]
 gi|86553842|gb|ABC98800.1| glycyl-tRNA synthetase, alpha subunit [Synechococcus sp. JA-3-3Ab]
          Length = 328

 Score =  539 bits (1390), Expect = e-151,   Method: Composition-based stats.
 Identities = 166/298 (55%), Positives = 212/298 (71%), Gaps = 7/298 (2%)

Query: 12  SFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPLD 71
           +FQ++I  L Q+W +QGC ILQPYD+E GAGT  P T LRALGP  W+ AYV+P RRP D
Sbjct: 5   TFQDLIFRLQQFWGEQGCLILQPYDLEKGAGTMSPHTFLRALGPDPWRVAYVEPCRRPTD 64

Query: 72  GRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTLG 131
           GRY +NPNRLQHY+Q+QV+IKP+P ++Q +Y+ESL+A+GIDP  HD+RFVED+WESPTLG
Sbjct: 65  GRYGQNPNRLQHYFQYQVLIKPSPDDIQEVYLESLRALGIDPAEHDIRFVEDDWESPTLG 124

Query: 132 AWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFNA 191
           AWG+GWE W DGMEI+QFTYFQQV G++C P+S EITYGLERLAMY+Q V+SV+D+ +  
Sbjct: 125 AWGVGWEVWLDGMEITQFTYFQQVGGLDCRPVSVEITYGLERLAMYLQGVDSVFDLCWGE 184

Query: 192 IEG-QNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN------ 244
                 + YG I+ Q+E E S YNFEY++PE+L   F   E E   L++           
Sbjct: 185 HPSLGRITYGQIYFQNEVEQSYYNFEYSDPEMLLELFRLYEAEAKRLIETTQQKLQKQVL 244

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMT 302
                   + PAYD  +K SH FNLLDARGVI+  ER  YI RIR+LA+   E ++  
Sbjct: 245 PDRLAVSLLLPAYDYVLKCSHTFNLLDARGVIAVAERTLYIGRIRNLARQLAELYVSQ 302


>gi|187922693|ref|YP_001894335.1| glycyl-tRNA synthetase subunit alpha [Burkholderia phytofirmans
           PsJN]
 gi|187713887|gb|ACD15111.1| glycyl-tRNA synthetase, alpha subunit [Burkholderia phytofirmans
           PsJN]
          Length = 335

 Score =  539 bits (1390), Expect = e-151,   Method: Composition-based stats.
 Identities = 171/303 (56%), Positives = 215/303 (70%), Gaps = 18/303 (5%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ IILT+  YW +QGC +LQP DMEVGAGT H  T LRA+GP  W+AAYVQPSRRP
Sbjct: 1   MLTFQQIILTMQSYWDKQGCALLQPIDMEVGAGTSHVHTFLRAVGPEPWRAAYVQPSRRP 60

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNRLQHYYQ+QV++KP P N+ +LY+ SL+A+G D   +DVRFVED+WE+PT
Sbjct: 61  KDGRYGENPNRLQHYYQYQVVLKPAPENILDLYLGSLEALGFDLKQNDVRFVEDDWENPT 120

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQQV G++C P+ GEITYGLERLAMY+Q V +VYD+V+
Sbjct: 121 LGAWGLGWEVWLNGMEVTQFTYFQQVGGLDCKPVLGEITYGLERLAMYLQKVENVYDLVW 180

Query: 190 --------NAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKG 241
                   N  E + + YGD++ Q+E E S YNFEYAN E+L + F   E E   +++  
Sbjct: 181 TEWEEQGPNGPELRRLTYGDVYHQNEVEQSTYNFEYANVELLFSIFNSYEAEAKRMIEAQ 240

Query: 242 IPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLM 301
                        PAY+  +KA H FNLLDARG IS TER  YI RIR+L+K   +A+  
Sbjct: 241 ----------IALPAYELVLKAGHTFNLLDARGAISVTERAAYIGRIRALSKLVAQAYYD 290

Query: 302 TPN 304
           +  
Sbjct: 291 SRE 293


>gi|330818264|ref|YP_004361969.1| Glycyl-tRNA synthetase, alpha subunit [Burkholderia gladioli BSR3]
 gi|327370657|gb|AEA62013.1| Glycyl-tRNA synthetase, alpha subunit [Burkholderia gladioli BSR3]
          Length = 335

 Score =  539 bits (1390), Expect = e-151,   Method: Composition-based stats.
 Identities = 167/304 (54%), Positives = 214/304 (70%), Gaps = 18/304 (5%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ IILTL  YW +QGC +LQP DM+VGAGT H  T LRA+GP  W+AAYVQPSRRP
Sbjct: 1   MLTFQQIILTLQSYWDKQGCALLQPIDMQVGAGTSHVHTFLRAIGPEPWRAAYVQPSRRP 60

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNRLQHYYQ+QV++KP P N+ +LY+ SL+A+G D   +DVRFVED+WE+PT
Sbjct: 61  KDGRYGENPNRLQHYYQYQVVMKPAPENILDLYLGSLEALGFDLKQNDVRFVEDDWENPT 120

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQQ  G++C P+ GEITYGLERLAMY+Q V +VYD+V+
Sbjct: 121 LGAWGLGWEVWLNGMEVTQFTYFQQAGGLDCKPVLGEITYGLERLAMYLQKVENVYDLVW 180

Query: 190 --------NAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKG 241
                   N  E + + YGD++ Q+E E S YNFE+AN E+L   F   E E   +++  
Sbjct: 181 TEWEELGPNGPEIRRLSYGDVYHQNEVEQSTYNFEHANVELLFGFFNSYESEAKRMIEAK 240

Query: 242 IPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLM 301
           +            PAY+  +KA H FNLLDARG IS TER  YI RIR+L++   +++  
Sbjct: 241 L----------ALPAYELVLKAGHTFNLLDARGAISVTERAAYIGRIRALSRLVAQSYYE 290

Query: 302 TPNG 305
           +   
Sbjct: 291 SREA 294


>gi|238028589|ref|YP_002912820.1| glycyl-tRNA synthetase subunit alpha [Burkholderia glumae BGR1]
 gi|237877783|gb|ACR30116.1| Glycyl-tRNA synthetase, alpha subunit [Burkholderia glumae BGR1]
          Length = 335

 Score =  539 bits (1390), Expect = e-151,   Method: Composition-based stats.
 Identities = 165/304 (54%), Positives = 214/304 (70%), Gaps = 18/304 (5%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ IILTL  YW +QGC +LQP DMEVGAGT H  T LRA+GP  W+AAYVQPSRRP
Sbjct: 1   MLTFQQIILTLQSYWDKQGCALLQPIDMEVGAGTSHVHTFLRAIGPEPWRAAYVQPSRRP 60

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNRLQHYYQ+QV++KP P N+ +LY+ SL+A+G D   +DVRFVED+WE+PT
Sbjct: 61  KDGRYGENPNRLQHYYQYQVVMKPAPENILDLYLGSLEALGFDLKQNDVRFVEDDWENPT 120

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQQV G++C P+ GEITYG+ERLAMY+Q V ++YD+V+
Sbjct: 121 LGAWGLGWEVWLNGMEVTQFTYFQQVGGLDCKPVLGEITYGIERLAMYLQKVENIYDLVW 180

Query: 190 --------NAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKG 241
                   N  + + + Y D++ Q+E E S YNFEYAN ++L   F   E E   +++  
Sbjct: 181 TEWEELGPNGPQTRRLTYRDVYHQNEVEQSTYNFEYANVDLLFTFFNSYEAEAKRMIEAK 240

Query: 242 IPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLM 301
           +            PAY+  +KA H FNLLDARG IS TER  YI RIR+L++   +++  
Sbjct: 241 L----------ALPAYELVLKAGHTFNLLDARGAISVTERAAYIGRIRALSRLVAQSYYE 290

Query: 302 TPNG 305
           +   
Sbjct: 291 SREA 294


>gi|91228338|ref|ZP_01262266.1| glycyl-tRNA synthetase alpha subunit [Vibrio alginolyticus 12G01]
 gi|91188098|gb|EAS74402.1| glycyl-tRNA synthetase alpha subunit [Vibrio alginolyticus 12G01]
          Length = 305

 Score =  539 bits (1390), Expect = e-151,   Method: Composition-based stats.
 Identities = 186/302 (61%), Positives = 220/302 (72%), Gaps = 9/302 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +IL L  YWAQ GCTI+QP DMEVGAGT HP T LRALGP     AYVQ
Sbjct: 1   MQKYDIKTFQGMILALQDYWAQNGCTIVQPLDMEVGAGTSHPMTCLRALGPEPMSTAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQV +KP+P N+Q LY+ SL+ +GIDPL+HD+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVALKPSPDNIQELYLGSLEVLGIDPLVHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYG+ERLAMY+Q V+SV
Sbjct: 121 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGIERLAMYIQEVDSV 180

Query: 185 YDIVFN-AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIP 243
           YD+V+N A +G  V YGDIF Q+E E S YNFE+A+ E L   F   EKEC         
Sbjct: 181 YDLVWNIAPDGSIVTYGDIFHQNEVEQSTYNFEHADVEFLFGFFEQCEKECK-------- 232

Query: 244 NEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTP 303
                      PAY++ +KA H FNLLDAR  IS TERQRYILRIR+L KA  EA+  + 
Sbjct: 233 ELLELEKPLPLPAYERILKAGHAFNLLDARKAISVTERQRYILRIRNLTKAVAEAYYASR 292

Query: 304 NG 305
             
Sbjct: 293 EA 294


>gi|74318366|ref|YP_316106.1| glycyl-tRNA synthetase subunit alpha [Thiobacillus denitrificans
           ATCC 25259]
 gi|123611333|sp|Q3SGE9|SYGA_THIDA RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|74057861|gb|AAZ98301.1| glycyl-tRNA synthetase, alpha subunit [Thiobacillus denitrificans
           ATCC 25259]
          Length = 312

 Score =  539 bits (1390), Expect = e-151,   Method: Composition-based stats.
 Identities = 169/293 (57%), Positives = 215/293 (73%), Gaps = 14/293 (4%)

Query: 12  SFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPLD 71
           +FQ+IILTL +YW ++GC +LQPYDMEVGAGT H +T LRALGP  WKAAYVQPSRRP D
Sbjct: 4   TFQDIILTLQRYWGERGCALLQPYDMEVGAGTSHTATFLRALGPEPWKAAYVQPSRRPKD 63

Query: 72  GRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTLG 131
           GRY ENPNRLQHYYQFQV++KP P ++  LY+ SL+A+G D   +DVRFVED+WE+PTLG
Sbjct: 64  GRYGENPNRLQHYYQFQVVLKPAPADILELYLGSLEALGFDLRKNDVRFVEDDWENPTLG 123

Query: 132 AWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFNA 191
           AWGLGWE W +GME++QFTYFQQV GI+C PI+GEITYGLERLAMY+Q V SV+D+ +  
Sbjct: 124 AWGLGWEVWLNGMEVTQFTYFQQVGGIDCKPITGEITYGLERLAMYLQGVESVFDLRWT- 182

Query: 192 IEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHHL 251
                + Y D++ Q+E E S YNFE+++   L   F   EK+  +L+             
Sbjct: 183 ---DGLTYRDVYHQNEVEQSAYNFEHSDVGFLLTAFSAHEKKAQELM----------VAQ 229

Query: 252 CVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
              PAY+Q +KA+H FNLLDARG IS TER  YI RIR+LA++  +++L +  
Sbjct: 230 LALPAYEQVLKAAHTFNLLDARGAISVTERAAYIGRIRNLARSVAKSYLDSRA 282


>gi|134296893|ref|YP_001120628.1| glycyl-tRNA synthetase subunit alpha [Burkholderia vietnamiensis
           G4]
 gi|134140050|gb|ABO55793.1| glycyl-tRNA synthetase alpha chain [Burkholderia vietnamiensis G4]
          Length = 334

 Score =  539 bits (1389), Expect = e-151,   Method: Composition-based stats.
 Identities = 169/303 (55%), Positives = 214/303 (70%), Gaps = 18/303 (5%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ IILTL  YW +QGC +LQP DMEVGAGT H  T LRA+GP  W+AAYVQPSRRP
Sbjct: 1   MLTFQQIILTLQSYWDKQGCALLQPIDMEVGAGTSHVHTFLRAVGPEPWRAAYVQPSRRP 60

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNRLQHYYQ+QV++KP P N+ +LY+ SL+A+G D   +DVRFVED+WE+PT
Sbjct: 61  KDGRYGENPNRLQHYYQYQVVLKPAPENILDLYLGSLEALGFDLQQNDVRFVEDDWENPT 120

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQQV G++C P+ GEITYGLERLAMY+Q V +VYD+V+
Sbjct: 121 LGAWGLGWEVWLNGMEVTQFTYFQQVGGLDCKPVLGEITYGLERLAMYLQKVENVYDLVW 180

Query: 190 --------NAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKG 241
                   N  E + + YGD++ Q+E E S YNFE+AN ++L   F   E E   ++   
Sbjct: 181 TEWEEQGPNGPELRRLSYGDVYHQNEVEQSTYNFEHANVDLLFTFFNSYEAEAKKMIDAQ 240

Query: 242 IPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLM 301
           +            PAY+  +KA H FNLLDARG IS TER  YI RIR+L++   +A+  
Sbjct: 241 L----------ALPAYELVLKAGHTFNLLDARGAISVTERAAYIGRIRALSRLVAQAYYD 290

Query: 302 TPN 304
           +  
Sbjct: 291 SRE 293


>gi|260222392|emb|CBA31910.1| Glycyl-tRNA synthetase alpha subunit [Curvibacter putative symbiont
           of Hydra magnipapillata]
          Length = 301

 Score =  539 bits (1389), Expect = e-151,   Method: Composition-based stats.
 Identities = 166/295 (56%), Positives = 216/295 (73%), Gaps = 14/295 (4%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ IIL L  YW +QGC +LQPYDMEVGAGT H +T LRA+GP  WKAAYVQPSRRP
Sbjct: 1   MLTFQQIILRLQDYWDRQGCALLQPYDMEVGAGTSHTATFLRAIGPEPWKAAYVQPSRRP 60

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNRLQHYYQ+QV++KP P N+  LY+ SL+A+G D   +D+RFVED+WE+PT
Sbjct: 61  KDGRYGENPNRLQHYYQYQVVLKPAPANILELYLGSLEALGFDLKKNDIRFVEDDWENPT 120

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQQV GI+C P +GEITYGLERLAMY+Q V++VY++ +
Sbjct: 121 LGAWGLGWEVWLNGMEVTQFTYFQQVGGIDCKPATGEITYGLERLAMYLQGVDNVYNLQW 180

Query: 190 NAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRH 249
                + + YGD++ Q+E E S YNFE+++ + L   F   EK+   L+++ +       
Sbjct: 181 T----ETMKYGDVYHQNEVEQSTYNFEHSDADFLFTAFNAHEKQAKYLMEQQL------- 229

Query: 250 HLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                PAY+Q +K +H FNLLDARG IS TER  YI RIR+LA++  +A+  +  
Sbjct: 230 ---ALPAYEQVLKCAHSFNLLDARGAISVTERAAYIGRIRNLARSVAQAYYESRE 281


>gi|46580307|ref|YP_011115.1| glycyl-tRNA synthetase subunit alpha [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120602311|ref|YP_966711.1| glycyl-tRNA synthetase subunit alpha [Desulfovibrio vulgaris DP4]
 gi|81566610|sp|Q72AU2|SYGA_DESVH RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|166200222|sp|A1VCW8|SYGA_DESVV RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|46449724|gb|AAS96374.1| glycyl-tRNA synthetase, alpha subunit [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120562540|gb|ABM28284.1| glycyl-tRNA synthetase alpha chain [Desulfovibrio vulgaris DP4]
 gi|311233710|gb|ADP86564.1| glycyl-tRNA synthetase, alpha subunit [Desulfovibrio vulgaris RCH1]
          Length = 289

 Score =  539 bits (1389), Expect = e-151,   Method: Composition-based stats.
 Identities = 171/294 (58%), Positives = 212/294 (72%), Gaps = 14/294 (4%)

Query: 11  LSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPL 70
           + FQN+ILTL  YWA +GC I QP D+E GAGTF+PST LR +GP  W  AYV+PSRRP 
Sbjct: 1   MHFQNVILTLQNYWASRGCVITQPIDVECGAGTFNPSTFLRVIGPEPWNVAYVEPSRRPT 60

Query: 71  DGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTL 130
           DGRY ENPNRLQHY+QFQVI+KP+P N+Q LY+ SL+A+GIDP  HD+RFVED+WESPTL
Sbjct: 61  DGRYGENPNRLQHYFQFQVILKPSPDNVQELYLGSLRALGIDPAAHDIRFVEDDWESPTL 120

Query: 131 GAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFN 190
           GAWGLGWE W +GME++QFTYFQQV GI+ +P S EITYGLERL MY+Q   SVYD+ +N
Sbjct: 121 GAWGLGWEVWLNGMEVTQFTYFQQVGGIDLAPTSVEITYGLERLCMYLQGKESVYDLDWN 180

Query: 191 AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHH 250
               ++V YGDI+ Q+E E S+YNFE ++  +L + F   E EC  L ++G+        
Sbjct: 181 ----EHVTYGDIYHQNEVEQSKYNFERSDAAMLLHAFNAYETECRRLTEEGL-------- 228

Query: 251 LCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
             ++PAYD C+K SH FNLLDARG IS TER  YI R+R LA      +     
Sbjct: 229 --LWPAYDYCLKCSHTFNLLDARGAISITERTGYIGRVRYLASGVARLYAAQRE 280


>gi|78357077|ref|YP_388526.1| glycyl-tRNA synthetase subunit alpha [Desulfovibrio desulfuricans
           subsp. desulfuricans str. G20]
 gi|123552272|sp|Q30ZR5|SYGA_DESDG RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|78219482|gb|ABB38831.1| glycyl-tRNA synthetase alpha chain [Desulfovibrio desulfuricans
           subsp. desulfuricans str. G20]
          Length = 294

 Score =  539 bits (1389), Expect = e-151,   Method: Composition-based stats.
 Identities = 167/294 (56%), Positives = 213/294 (72%), Gaps = 14/294 (4%)

Query: 11  LSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPL 70
           ++FQ++ILTL  +WA++GC I QP+D E GAGTF+P+T LR +GP  W  AYV+PSRRP 
Sbjct: 1   MNFQDVILTLQNFWARRGCAIQQPFDSECGAGTFNPATFLRVIGPEPWNVAYVEPSRRPT 60

Query: 71  DGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTL 130
           DGRY ENPNRLQHY+QFQVI+KP+P N+Q +YI+SL+A+GI+P  HD+RFVED+WESPTL
Sbjct: 61  DGRYGENPNRLQHYFQFQVILKPSPDNVQEIYIDSLRALGINPAEHDIRFVEDDWESPTL 120

Query: 131 GAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFN 190
           GAWGLGWE W +GME++QFTYFQQV GI+ SP S EITYGLERL MY+Q   SVYD+++N
Sbjct: 121 GAWGLGWEVWLNGMEVTQFTYFQQVGGIDLSPTSVEITYGLERLCMYLQEKESVYDLMWN 180

Query: 191 AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHH 250
                 V YG I+ ++E E SRYNFE ++  +L   F   E+EC  L +K +        
Sbjct: 181 ----DTVTYGHIYHRNEVEMSRYNFEESDAGMLLELFNAYERECTRLCEKQL-------- 228

Query: 251 LCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
             ++PAYD C+K SH FNLLDARG IS TER  YI R+R LA +    +     
Sbjct: 229 --LWPAYDYCLKCSHTFNLLDARGAISITERTGYIGRVRVLASSVARLYAAQRE 280


>gi|163802140|ref|ZP_02196035.1| glycyl-tRNA synthetase alpha subunit [Vibrio sp. AND4]
 gi|159173945|gb|EDP58755.1| glycyl-tRNA synthetase alpha subunit [Vibrio sp. AND4]
          Length = 305

 Score =  539 bits (1389), Expect = e-151,   Method: Composition-based stats.
 Identities = 184/302 (60%), Positives = 220/302 (72%), Gaps = 9/302 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +IL L  YWAQ GCTI+QP DMEVGAGT HP T LRALGP     AYVQ
Sbjct: 1   MQKYDIKTFQGMILALQDYWAQNGCTIVQPLDMEVGAGTSHPMTCLRALGPEPMSTAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQV +KP+P N+Q LY+ SL+ +G+DPL+HD+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVALKPSPDNIQELYLGSLEVLGVDPLVHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYG+ERLAMY+Q V+SV
Sbjct: 121 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGIERLAMYIQEVDSV 180

Query: 185 YDIVFN-AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIP 243
           YD+V+N A +G  V YGDIF Q+E E S YNFE+A+ + L   F   EKEC         
Sbjct: 181 YDLVWNIAPDGSKVTYGDIFHQNEVEQSTYNFEHADVDFLFGFFEQCEKECK-------- 232

Query: 244 NEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTP 303
                      PAY++ +KA H FNLLDAR  IS TERQRYILRIR+L KA  EA+  + 
Sbjct: 233 ELLELEKPLPLPAYERILKAGHAFNLLDARKAISVTERQRYILRIRNLTKAVAEAYYASR 292

Query: 304 NG 305
             
Sbjct: 293 EA 294


>gi|254507284|ref|ZP_05119420.1| glycyl-tRNA synthetase, alpha subunit [Vibrio parahaemolyticus 16]
 gi|219549744|gb|EED26733.1| glycyl-tRNA synthetase, alpha subunit [Vibrio parahaemolyticus 16]
          Length = 306

 Score =  539 bits (1389), Expect = e-151,   Method: Composition-based stats.
 Identities = 184/302 (60%), Positives = 222/302 (73%), Gaps = 9/302 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +IL L  YWAQ GCTI+QP DMEVGAGT HP T LRALGP     AYVQ
Sbjct: 1   MQKYDIKTFQGMILALQDYWAQNGCTIVQPLDMEVGAGTSHPMTCLRALGPEPMSTAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQV +KP+P N+Q LY+ SL+ +GIDPL+HD+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVALKPSPDNIQELYLGSLEVLGIDPLVHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYG+ERLAMY+Q V+SV
Sbjct: 121 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGIERLAMYIQEVDSV 180

Query: 185 YDIVFN-AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIP 243
           YD+V+N A +G NV YGDIF Q+E E S YNFE+A+ + L + F   EKE          
Sbjct: 181 YDLVWNVAPDGSNVTYGDIFHQNEVEQSTYNFEHADVDFLFSFFDQCEKESK-------- 232

Query: 244 NEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTP 303
                      PAY++ +KA+H FNLLDAR  IS TERQRYILRIR+L K+  EA+  + 
Sbjct: 233 ELLELEKPLPLPAYERILKAAHAFNLLDARKAISVTERQRYILRIRNLTKSVAEAYYASR 292

Query: 304 NG 305
             
Sbjct: 293 EA 294


>gi|302391467|ref|YP_003827287.1| glycyl-tRNA synthetase alpha chain [Acetohalobium arabaticum DSM
           5501]
 gi|302203544|gb|ADL12222.1| glycyl-tRNA synthetase alpha chain [Acetohalobium arabaticum DSM
           5501]
          Length = 295

 Score =  539 bits (1389), Expect = e-151,   Method: Composition-based stats.
 Identities = 167/294 (56%), Positives = 211/294 (71%), Gaps = 14/294 (4%)

Query: 11  LSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPL 70
           ++FQ++I  L ++WA+Q C I QPYD+EVGAGT +P+TTLRALGP  W  AYV+P RRP 
Sbjct: 1   MNFQDMIHALNEFWAEQKCIIKQPYDIEVGAGTMNPATTLRALGPEDWNVAYVEPCRRPA 60

Query: 71  DGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTL 130
           DGRY ENPNRLQHYYQ+QVI+KP+P  +Q +Y++SL+A+GIDP  HD+RFVEDNWESPTL
Sbjct: 61  DGRYGENPNRLQHYYQYQVIMKPSPQKIQEIYLDSLEALGIDPAKHDIRFVEDNWESPTL 120

Query: 131 GAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFN 190
           GAWGLGWE W DGMEI+QFTYFQQV G +  P+S EITYGLER+A+Y+Q V+SV+DI + 
Sbjct: 121 GAWGLGWEVWLDGMEITQFTYFQQVGGFDVKPVSVEITYGLERIAVYLQEVDSVFDIEWV 180

Query: 191 AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHH 250
                 + YGD+  Q E E+S YNFE A+ + L   F   E+E    +++ +        
Sbjct: 181 ----DGISYGDVHHQGEVEHSTYNFEVADIDKLLTFFDLYEEEAKQAIEEDL-------- 228

Query: 251 LCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
             V PAYD  +K SH FNLLDARG IS TER  YI R+R LA  C +A+L    
Sbjct: 229 --VLPAYDYVLKCSHTFNLLDARGAISVTERTSYIKRVRDLANLCAKAYLEQRE 280


>gi|260433227|ref|ZP_05787198.1| glycyl-tRNA synthetase, alpha subunit [Silicibacter
           lacuscaerulensis ITI-1157]
 gi|260417055|gb|EEX10314.1| glycyl-tRNA synthetase, alpha subunit [Silicibacter
           lacuscaerulensis ITI-1157]
          Length = 309

 Score =  539 bits (1389), Expect = e-151,   Method: Composition-based stats.
 Identities = 195/300 (65%), Positives = 237/300 (79%), Gaps = 2/300 (0%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
             SFQ IIL L  YWA +GC ILQPYDMEVGAGTFHP+TTLRALG   W AAYVQPSRRP
Sbjct: 8   PRSFQEIILRLQNYWASKGCAILQPYDMEVGAGTFHPATTLRALGAKPWAAAYVQPSRRP 67

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNRLQHYYQ+QV+IKP+P +LQ LY+ SL+A+GID  +HD+RFVED+WESPT
Sbjct: 68  TDGRYGENPNRLQHYYQYQVLIKPSPPDLQELYLGSLQAIGIDMDLHDIRFVEDDWESPT 127

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE WCDGME+SQFTYFQQV G +C+P+SGE+TYGLERLAMYV  ++ V D+ F
Sbjct: 128 LGAWGLGWEVWCDGMEVSQFTYFQQVGGHDCAPVSGELTYGLERLAMYVLGIDHVMDMPF 187

Query: 190 NAIEGQ-NVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLL-KKGIPNEHH 247
           N  +    + YGDIF Q+E+EY+R+NF+ AN E+L  HF ++E EC  +L ++ +  +  
Sbjct: 188 NDPQSPIPLTYGDIFKQTEEEYARWNFDVANTEVLLRHFEEAEAECAAILSQEHVDPKTG 247

Query: 248 RHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNGGH 307
           +  +   PAYDQCIKASHIFNLLDARGVIS TERQ YI R+R+LAK C +AF+ T   G+
Sbjct: 248 KRIIMAHPAYDQCIKASHIFNLLDARGVISVTERQAYIGRVRALAKQCADAFVQTEAAGY 307


>gi|84394117|ref|ZP_00992851.1| glycyl-tRNA synthetase alpha subunit [Vibrio splendidus 12B01]
 gi|84375263|gb|EAP92176.1| glycyl-tRNA synthetase alpha subunit [Vibrio splendidus 12B01]
          Length = 309

 Score =  539 bits (1389), Expect = e-151,   Method: Composition-based stats.
 Identities = 184/302 (60%), Positives = 221/302 (73%), Gaps = 9/302 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +IL L  YWAQ GCTI+QP DMEVGAGT HP T LRALGP     AYVQ
Sbjct: 1   MQKYDIKTFQGMILALQDYWAQNGCTIVQPLDMEVGAGTSHPMTCLRALGPEPMSTAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQV +KP+P N+Q LY+ SL+ +G+DPL+HD+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVALKPSPDNIQELYLGSLEVLGVDPLVHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYG+ERLAMY+Q V+SV
Sbjct: 121 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGIERLAMYIQEVDSV 180

Query: 185 YDIVFN-AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIP 243
           YD+V+N A +G NV YGDIF Q+E E S YNFE+A+ + L   F   EKEC         
Sbjct: 181 YDLVWNVAPDGSNVTYGDIFHQNEVEQSTYNFEHADVDFLFTFFDQCEKECK-------- 232

Query: 244 NEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTP 303
                      PAY++ +KA H FN+LDAR  IS TERQRYILRIR+L KA  EA+  + 
Sbjct: 233 ELLELEKPLPLPAYERILKAGHAFNILDARKAISVTERQRYILRIRNLTKAVAEAYYASR 292

Query: 304 NG 305
             
Sbjct: 293 EA 294


>gi|241767220|ref|ZP_04764966.1| glycyl-tRNA synthetase, alpha subunit [Acidovorax delafieldii 2AN]
 gi|241362133|gb|EER58228.1| glycyl-tRNA synthetase, alpha subunit [Acidovorax delafieldii 2AN]
          Length = 301

 Score =  538 bits (1388), Expect = e-151,   Method: Composition-based stats.
 Identities = 167/295 (56%), Positives = 215/295 (72%), Gaps = 14/295 (4%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ IIL L  YW  QGC +LQPYDMEVGAGT H +T LRA+GP  WKAAYVQPSRRP
Sbjct: 1   MLTFQQIILKLQSYWDAQGCALLQPYDMEVGAGTSHTATFLRAIGPEPWKAAYVQPSRRP 60

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNRLQHYYQ+QV++KP P N+  LY+ SL+A+G D   +D+RFVED+WE+PT
Sbjct: 61  KDGRYGENPNRLQHYYQYQVVLKPAPANILELYLGSLEALGFDLKKNDIRFVEDDWENPT 120

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQQV GI+C P +GEITYGLERLAMY+Q V++VY++ +
Sbjct: 121 LGAWGLGWEVWLNGMEVTQFTYFQQVGGIDCKPATGEITYGLERLAMYLQGVDNVYNLQW 180

Query: 190 NAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRH 249
                  + YGD++ Q+E E S YNFE+++ + L   F   EK+   L+++ +       
Sbjct: 181 T----DTLKYGDVYHQNEVEQSTYNFEHSDADFLFTAFNAHEKQAKYLMEQQL------- 229

Query: 250 HLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                PAY+Q +KA+H FNLLDARG IS TER  YI RIR+LA+A  +++  +  
Sbjct: 230 ---ALPAYEQVLKAAHSFNLLDARGAISVTERAAYIGRIRNLARAVAQSYYESRE 281


>gi|156972785|ref|YP_001443692.1| glycyl-tRNA synthetase subunit alpha [Vibrio harveyi ATCC BAA-1116]
 gi|269962699|ref|ZP_06177044.1| glycyl-tRNA synthetase alpha subunit [Vibrio harveyi 1DA3]
 gi|166227905|sp|A7N1D9|SYGA_VIBHB RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|156524379|gb|ABU69465.1| hypothetical protein VIBHAR_00450 [Vibrio harveyi ATCC BAA-1116]
 gi|269832622|gb|EEZ86736.1| glycyl-tRNA synthetase alpha subunit [Vibrio harveyi 1DA3]
          Length = 305

 Score =  538 bits (1388), Expect = e-151,   Method: Composition-based stats.
 Identities = 185/302 (61%), Positives = 220/302 (72%), Gaps = 9/302 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +IL L  YWAQ GCTI+QP DMEVGAGT HP T LRALGP     AYVQ
Sbjct: 1   MQKYDIKTFQGMILALQDYWAQNGCTIVQPLDMEVGAGTSHPMTCLRALGPEPMSTAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQV +KP+P N+Q LY+ SL+ +G+DPL+HD+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVALKPSPDNIQELYLGSLEVLGVDPLVHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYG+ERLAMY+Q V+SV
Sbjct: 121 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGIERLAMYIQEVDSV 180

Query: 185 YDIVFN-AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIP 243
           YD+V+N A +G  V YGDIF Q+E E S YNFE+A+ E L   F   EKEC         
Sbjct: 181 YDLVWNIAPDGSKVTYGDIFHQNEVEQSTYNFEHADVEFLFGFFEQCEKECK-------- 232

Query: 244 NEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTP 303
                      PAY++ +KA H FNLLDAR  IS TERQRYILRIR+L KA  EA+  + 
Sbjct: 233 ELLELEKPLPLPAYERILKAGHAFNLLDARKAISVTERQRYILRIRNLTKAVAEAYYASR 292

Query: 304 NG 305
             
Sbjct: 293 EA 294


>gi|254230342|ref|ZP_04923728.1| glycyl-tRNA synthetase, alpha subunit [Vibrio sp. Ex25]
 gi|262392773|ref|YP_003284627.1| glycyl-tRNA synthetase subunit alpha [Vibrio sp. Ex25]
 gi|151937134|gb|EDN56006.1| glycyl-tRNA synthetase, alpha subunit [Vibrio sp. Ex25]
 gi|262336367|gb|ACY50162.1| glycyl-tRNA synthetase alpha chain [Vibrio sp. Ex25]
          Length = 305

 Score =  538 bits (1388), Expect = e-151,   Method: Composition-based stats.
 Identities = 184/302 (60%), Positives = 218/302 (72%), Gaps = 9/302 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +IL L  YWAQ GCTI+QP DMEVGAGT HP T LRALGP     AYVQ
Sbjct: 1   MQKYDIKTFQGMILALQDYWAQNGCTIVQPLDMEVGAGTSHPMTCLRALGPEPMSTAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQV +KP+P N+Q LY+ SL+ +GIDPL+HD+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVALKPSPDNIQELYLGSLEVLGIDPLVHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYG+ERLAMY+Q V+SV
Sbjct: 121 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGIERLAMYIQEVDSV 180

Query: 185 YDIVFN-AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIP 243
           YD+ +N A +G  V YGDIF Q+E E S YNFE+A+ E L   F   EKEC         
Sbjct: 181 YDLTWNIAPDGSKVTYGDIFHQNEVEQSTYNFEHADVEFLFGFFEQCEKECK-------- 232

Query: 244 NEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTP 303
                      PAY++ +KA H FNLLDAR  IS TERQRYILRIR L K+  EA+  + 
Sbjct: 233 ELLELEKPLPLPAYERILKAGHAFNLLDARKAISVTERQRYILRIRDLTKSVAEAYYASR 292

Query: 304 NG 305
             
Sbjct: 293 EA 294


>gi|325983625|ref|YP_004296027.1| glycyl-tRNA synthetase, alpha subunit [Nitrosomonas sp. AL212]
 gi|325533144|gb|ADZ27865.1| glycyl-tRNA synthetase, alpha subunit [Nitrosomonas sp. AL212]
          Length = 307

 Score =  538 bits (1388), Expect = e-151,   Method: Composition-based stats.
 Identities = 169/295 (57%), Positives = 213/295 (72%), Gaps = 14/295 (4%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ IILTL +YW +QGC ILQPYDMEVGAGT H +T LRA+GP  WKAAYVQPSRRP
Sbjct: 3   TLTFQEIILTLQRYWDKQGCAILQPYDMEVGAGTSHTATFLRAIGPEPWKAAYVQPSRRP 62

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNRLQHYYQFQV++KP P N+ +LY +SL+ +G D   +D R VED+WE+PT
Sbjct: 63  KDGRYGENPNRLQHYYQFQVVLKPAPKNILDLYFDSLRELGFDLTQNDARLVEDDWENPT 122

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQQV GI+C P +GEITYGLERLAMY+Q V SV+D+V+
Sbjct: 123 LGAWGLGWEVWLNGMEVTQFTYFQQVGGIDCKPATGEITYGLERLAMYLQGVESVFDLVW 182

Query: 190 NAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRH 249
                + + Y D++ Q+E E S YNFE+++ E L   F   E +   L++K +       
Sbjct: 183 T----KGLTYHDVYHQNEVEQSTYNFEHSDTEFLFLAFGRHEAQANHLIEKQL------- 231

Query: 250 HLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                PAY+Q +KA+H FNLLDARG IS TER  YI RIR+L++    A+  +  
Sbjct: 232 ---ALPAYEQVLKAAHTFNLLDARGAISVTERAAYIGRIRNLSRQVARAYYDSRA 283


>gi|86147198|ref|ZP_01065514.1| glycyl-tRNA synthetase alpha subunit [Vibrio sp. MED222]
 gi|218708121|ref|YP_002415742.1| glycyl-tRNA synthetase subunit alpha [Vibrio splendidus LGP32]
 gi|254781840|sp|B7VGK7|SYGA_VIBSL RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|85835082|gb|EAQ53224.1| glycyl-tRNA synthetase alpha subunit [Vibrio sp. MED222]
 gi|218321140|emb|CAV17090.1| Glycyl-tRNA synthetase alpha chain [Vibrio splendidus LGP32]
          Length = 304

 Score =  538 bits (1388), Expect = e-151,   Method: Composition-based stats.
 Identities = 184/302 (60%), Positives = 221/302 (73%), Gaps = 9/302 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +IL L  YWAQ GCTI+QP DMEVGAGT HP T LRALGP     AYVQ
Sbjct: 1   MQKYDIKTFQGMILALQDYWAQNGCTIVQPLDMEVGAGTSHPMTCLRALGPEPMSTAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQV +KP+P N+Q LY+ SL+ +G+DPL+HD+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVALKPSPDNIQELYLGSLEVLGVDPLVHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYG+ERLAMY+Q V+SV
Sbjct: 121 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGIERLAMYIQEVDSV 180

Query: 185 YDIVFN-AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIP 243
           YD+V+N A +G NV YGDIF Q+E E S YNFE+A+ + L   F   EKEC         
Sbjct: 181 YDLVWNVAPDGSNVTYGDIFHQNEVEQSTYNFEHADVDFLFTFFDQCEKECK-------- 232

Query: 244 NEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTP 303
                      PAY++ +KA H FN+LDAR  IS TERQRYILRIR+L KA  EA+  + 
Sbjct: 233 ELLELEKPLPLPAYERILKAGHAFNILDARKAISVTERQRYILRIRNLTKAVAEAYYASR 292

Query: 304 NG 305
             
Sbjct: 293 EA 294


>gi|28896796|ref|NP_796401.1| glycyl-tRNA synthetase subunit alpha [Vibrio parahaemolyticus RIMD
           2210633]
 gi|153839065|ref|ZP_01991732.1| glycyl-tRNA synthetase, alpha subunit [Vibrio parahaemolyticus
           AQ3810]
 gi|260363494|ref|ZP_05776327.1| glycine--tRNA ligase, alpha subunit [Vibrio parahaemolyticus K5030]
 gi|260876553|ref|ZP_05888908.1| glycine--tRNA ligase, alpha subunit [Vibrio parahaemolyticus
           AN-5034]
 gi|260897314|ref|ZP_05905810.1| glycine--tRNA ligase, alpha subunit [Vibrio parahaemolyticus
           Peru-466]
 gi|260901406|ref|ZP_05909801.1| glycine--tRNA ligase, alpha subunit [Vibrio parahaemolyticus
           AQ4037]
 gi|32130157|sp|Q87TP7|SYGA_VIBPA RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|28805004|dbj|BAC58285.1| glycyl-tRNA synthetase, alpha chain [Vibrio parahaemolyticus RIMD
           2210633]
 gi|149747448|gb|EDM58402.1| glycyl-tRNA synthetase, alpha subunit [Vibrio parahaemolyticus
           AQ3810]
 gi|308087816|gb|EFO37511.1| glycine--tRNA ligase, alpha subunit [Vibrio parahaemolyticus
           Peru-466]
 gi|308090377|gb|EFO40072.1| glycine--tRNA ligase, alpha subunit [Vibrio parahaemolyticus
           AN-5034]
 gi|308107178|gb|EFO44718.1| glycine--tRNA ligase, alpha subunit [Vibrio parahaemolyticus
           AQ4037]
 gi|308113564|gb|EFO51104.1| glycine--tRNA ligase, alpha subunit [Vibrio parahaemolyticus K5030]
 gi|328471248|gb|EGF42150.1| glycyl-tRNA synthetase subunit alpha [Vibrio parahaemolyticus
           10329]
          Length = 305

 Score =  538 bits (1388), Expect = e-151,   Method: Composition-based stats.
 Identities = 183/302 (60%), Positives = 220/302 (72%), Gaps = 9/302 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +IL L  YWAQ GCTI+QP DMEVGAGT HP T LRALGP     AYVQ
Sbjct: 1   MQKYDIKTFQGMILALQDYWAQNGCTIVQPLDMEVGAGTSHPMTCLRALGPEPMSTAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQV +KP+P N+Q LY+ SL+ +GIDPL+HD+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVALKPSPDNIQELYLGSLEVLGIDPLVHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYG+ERLAMY+Q V+SV
Sbjct: 121 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGIERLAMYIQEVDSV 180

Query: 185 YDIVFN-AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIP 243
           YD+ +N A +G  V YGDIF Q+E E S YNFE+A+ + L + F   EKE          
Sbjct: 181 YDLTWNIAPDGSKVTYGDIFHQNEVEQSTYNFEHADVDFLFSFFDQCEKESK-------- 232

Query: 244 NEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTP 303
                      PAY++ +KA+H FNLLDAR  IS TERQRYILRIR+L KA  EA+  + 
Sbjct: 233 ELLELEKPLPLPAYERILKAAHAFNLLDARKAISVTERQRYILRIRNLTKAVAEAYYASR 292

Query: 304 NG 305
             
Sbjct: 293 EA 294


>gi|319788542|ref|YP_004148017.1| glycyl-tRNA synthetase subunit alpha [Pseudoxanthomonas suwonensis
           11-1]
 gi|317467054|gb|ADV28786.1| glycyl-tRNA synthetase, alpha subunit [Pseudoxanthomonas suwonensis
           11-1]
          Length = 298

 Score =  538 bits (1388), Expect = e-151,   Method: Composition-based stats.
 Identities = 175/280 (62%), Positives = 215/280 (76%), Gaps = 10/280 (3%)

Query: 12  SFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPLD 71
           +FQ +I  L  YWA+QGC ++QP D+EVGAGTFHP+T LRALGP  W AAYVQPSRRP D
Sbjct: 5   TFQGLIQALNAYWAEQGCVLIQPLDLEVGAGTFHPATFLRALGPEPWNAAYVQPSRRPTD 64

Query: 72  GRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTLG 131
           GRY ENPNRLQ YYQ+QV++KPNP N+Q LY+ SL+A+GIDP +HD+RFVEDNWESPTLG
Sbjct: 65  GRYGENPNRLQRYYQYQVVMKPNPDNIQELYLGSLEALGIDPKVHDLRFVEDNWESPTLG 124

Query: 132 AWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFNA 191
           AWGLGWE W +GME++QFTYFQQ  G+EC P+ GEITYGLERL MY+QNV++VYD+++  
Sbjct: 125 AWGLGWEVWLNGMEVTQFTYFQQAGGLECRPVLGEITYGLERLCMYLQNVDNVYDLIWTV 184

Query: 192 IEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHHL 251
                V YGD++ Q+E E S YNFE+A+   L + F   E+E L L++ G+P        
Sbjct: 185 GPQGPVTYGDVYHQNEVEQSAYNFEHADVAELFHRFDACEREALKLVEAGLP-------- 236

Query: 252 CVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSL 291
              PAY+Q  KASH FNLLDAR  IS TERQRYILR+R+L
Sbjct: 237 --LPAYEQVCKASHSFNLLDARRAISVTERQRYILRVRTL 274


>gi|167579893|ref|ZP_02372767.1| glycyl-tRNA synthetase subunit alpha [Burkholderia thailandensis
           TXDOH]
          Length = 335

 Score =  538 bits (1388), Expect = e-151,   Method: Composition-based stats.
 Identities = 169/303 (55%), Positives = 213/303 (70%), Gaps = 18/303 (5%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ IILTL  YW +QGC +LQP DMEVGAGT H  T LRA+GP  W+AAYVQPSRRP
Sbjct: 1   MLTFQQIILTLQSYWDRQGCALLQPIDMEVGAGTSHVHTFLRAIGPEPWRAAYVQPSRRP 60

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNRLQHYYQ+QV++KP P N+ +LY+ SL A+G D   +DVRFVED+WE+PT
Sbjct: 61  KDGRYGENPNRLQHYYQYQVVLKPAPENILDLYLGSLAALGFDLKQNDVRFVEDDWENPT 120

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQQV G++C P+ GEITYGLERLAMY+Q V +VYD+++
Sbjct: 121 LGAWGLGWEVWLNGMEVTQFTYFQQVGGLDCKPVLGEITYGLERLAMYLQKVENVYDLIW 180

Query: 190 --------NAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKG 241
                   N  E + + YGD++ Q+E E S YNFE AN E+L   F   E E   +++  
Sbjct: 181 TEWEEQGPNGPEIRRLTYGDVYHQNEVEQSTYNFEQANVELLFTFFNSYEAEARRMIEAQ 240

Query: 242 IPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLM 301
           +            PAY+  +KA H FNLLDARG IS TER  YI RIR+L++   +A+  
Sbjct: 241 L----------ALPAYELVLKAGHTFNLLDARGAISVTERAAYIGRIRALSRLVAQAYYD 290

Query: 302 TPN 304
           +  
Sbjct: 291 SRE 293


>gi|89895830|ref|YP_519317.1| glycyl-tRNA synthetase subunit alpha [Desulfitobacterium hafniense
           Y51]
 gi|122481925|sp|Q24SW9|SYGA_DESHY RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|89335278|dbj|BAE84873.1| hypothetical protein [Desulfitobacterium hafniense Y51]
          Length = 296

 Score =  538 bits (1387), Expect = e-151,   Method: Composition-based stats.
 Identities = 174/294 (59%), Positives = 218/294 (74%), Gaps = 14/294 (4%)

Query: 11  LSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPL 70
           + FQ++IL+L Q+W +QGC I QPYDME GAGTF+P+T LRALGP  WK AY++PSRRP 
Sbjct: 1   MKFQDMILSLNQFWGEQGCIIAQPYDMEKGAGTFNPNTFLRALGPEPWKVAYIEPSRRPT 60

Query: 71  DGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTL 130
           DGRY ENPNRLQHY+Q+QVIIKP+P N+Q LY++SL+ +G++P  HD+RFVEDNWESPTL
Sbjct: 61  DGRYGENPNRLQHYFQYQVIIKPSPDNIQELYLQSLERLGVNPKEHDIRFVEDNWESPTL 120

Query: 131 GAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFN 190
           GAWGLGWE W DGME++QFTYFQQ  GI+C P+  EITYGLERLAMY+QN  SVYDI + 
Sbjct: 121 GAWGLGWEVWLDGMEVTQFTYFQQCGGIDCKPVCAEITYGLERLAMYIQNKESVYDIEYV 180

Query: 191 AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHH 250
                ++ YGDI+ Q+E +YS YNF  A+ E L   F   EKE + + +KG+        
Sbjct: 181 G----DITYGDIYLQNEIDYSYYNFRAADVEALQAWFEMYEKEAIRIAEKGL-------- 228

Query: 251 LCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
             V PAYD  +K SH FNLLDARG IS TER  YI R+R+LA+ C +A++    
Sbjct: 229 --VLPAYDYVLKCSHTFNLLDARGAISVTERTGYIARVRNLARLCAQAYVEQRE 280


>gi|328952741|ref|YP_004370075.1| Glycyl-tRNA synthetase alpha subunit [Desulfobacca acetoxidans DSM
           11109]
 gi|328453065|gb|AEB08894.1| Glycyl-tRNA synthetase alpha subunit [Desulfobacca acetoxidans DSM
           11109]
          Length = 292

 Score =  538 bits (1387), Expect = e-151,   Method: Composition-based stats.
 Identities = 170/295 (57%), Positives = 213/295 (72%), Gaps = 14/295 (4%)

Query: 11  LSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPL 70
           + FQ++++TL ++WA +GC I QPYD+EVGAGTF+P+T LR LGP  W  AYV+PSRRP 
Sbjct: 1   MHFQDVLMTLERFWADRGCIIQQPYDLEVGAGTFNPATMLRVLGPEPWNVAYVEPSRRPT 60

Query: 71  DGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTL 130
           DGRY ENPNRLQHYYQ+QVI+KP+PLN+Q LY++SLKA+GIDPL HD+RFVED+WESPTL
Sbjct: 61  DGRYGENPNRLQHYYQYQVILKPSPLNIQELYLDSLKALGIDPLSHDIRFVEDDWESPTL 120

Query: 131 GAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFN 190
           GAWGLGWE W DGMEI+QFTYFQQ  GI+  PIS E+TYG ER++MY+Q +++VYD+V+ 
Sbjct: 121 GAWGLGWEVWLDGMEITQFTYFQQAGGIDLHPISVELTYGPERISMYLQGIDNVYDLVWT 180

Query: 191 AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHH 250
                 + YGDI  + E EYS YNFE A+  +L N F   E+E   L             
Sbjct: 181 ----DGIKYGDIHHRGEVEYSTYNFEQADVAMLFNLFEQYERESHRL----------SGL 226

Query: 251 LCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNG 305
             + PAYD C+K SH FNLLDARG IS  ER R I R+R +A+ C E +L     
Sbjct: 227 GLILPAYDYCLKCSHTFNLLDARGAISVAERSRLIGRVRQMARLCAEGYLKQREA 281


>gi|328675661|gb|AEB28336.1| Glycyl-tRNA synthetase alpha chain [Francisella cf. novicida 3523]
          Length = 296

 Score =  538 bits (1387), Expect = e-151,   Method: Composition-based stats.
 Identities = 180/295 (61%), Positives = 217/295 (73%), Gaps = 10/295 (3%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ IIL L  YWA +GC I+QP DMEVGAGTFHP+TTLRA+GP  W AAYVQPSRRP
Sbjct: 1   MLTFQEIILKLHHYWASKGCAIIQPLDMEVGAGTFHPATTLRAIGPEPWTAAYVQPSRRP 60

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNR QHYYQ+QV++KP+P N+Q LY+ S+K +GIDPL +D+RFVEDNWESPT
Sbjct: 61  TDGRYGENPNRTQHYYQYQVVMKPSPDNIQELYLGSIKELGIDPLENDIRFVEDNWESPT 120

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GMEI+QFTYFQQV G+EC P+ GEITYGLERLAMY+QNV+S+YDI++
Sbjct: 121 LGAWGLGWEVWSNGMEITQFTYFQQVGGLECKPVMGEITYGLERLAMYIQNVDSMYDILW 180

Query: 190 NAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRH 249
              +   + Y D+F Q+E E S YNFE AN + L   F   EKE   L++K +P      
Sbjct: 181 ANTQNGPLYYRDVFLQNEIEMSTYNFEEANVDELFKQFDLLEKEGYRLVEKNLP------ 234

Query: 250 HLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                PAY+  +KASH FNLLDAR  IS TERQ YILR+R LA    + +     
Sbjct: 235 ----IPAYEFVLKASHTFNLLDARHAISVTERQGYILRVRKLALEVAKEYYSVRE 285


>gi|299067913|emb|CBJ39127.1| glycine tRNA synthetase, alpha subunit [Ralstonia solanacearum
           CMR15]
          Length = 325

 Score =  538 bits (1387), Expect = e-151,   Method: Composition-based stats.
 Identities = 166/306 (54%), Positives = 215/306 (70%), Gaps = 11/306 (3%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ +IL L  YW  QGC +LQP D+EVGAGT H  T LRA+GP  W+AAYVQPSRRP
Sbjct: 1   MLTFQQLILKLQSYWDAQGCALLQPIDLEVGAGTSHVHTFLRAIGPEPWRAAYVQPSRRP 60

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNRLQHYYQ+QV++KP P N+ +LY+ SL A+G+D   +DVRFVED+WE+PT
Sbjct: 61  KDGRYGENPNRLQHYYQYQVVLKPAPENILDLYLGSLAALGLDLKQNDVRFVEDDWENPT 120

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQQV G++C PI+GEITYG+ERLAMY+Q V ++YD+V+
Sbjct: 121 LGAWGLGWEVWLNGMEVTQFTYFQQVGGLDCKPITGEITYGIERLAMYLQQVENIYDLVW 180

Query: 190 NAIEGQN--------VLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLL--- 238
              E           + YGD++ Q+E E S YNFE+A+  +L   F + E E   L+   
Sbjct: 181 TEWEEPGPNGPVKRRLTYGDVYHQNEVEQSTYNFEHADTAVLFRRFTEHETEAKRLMGVR 240

Query: 239 KKGIPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEA 298
           + G  ++         PAY+Q +KA H FNLLDARG IS TER  YI RIR+L++   +A
Sbjct: 241 EAGAADDGAAMPQLALPAYEQVLKAGHTFNLLDARGAISVTERAAYIGRIRNLSRLVAQA 300

Query: 299 FLMTPN 304
           +  +  
Sbjct: 301 YYDSRE 306


>gi|325526258|gb|EGD03875.1| glycyl-tRNA synthetase subunit alpha [Burkholderia sp. TJI49]
          Length = 334

 Score =  538 bits (1387), Expect = e-151,   Method: Composition-based stats.
 Identities = 168/303 (55%), Positives = 214/303 (70%), Gaps = 18/303 (5%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ IILTL  YW +QGC +LQP DMEVGAGT H  T LRA+GP  W+AAYVQPSRRP
Sbjct: 1   MLTFQQIILTLQSYWDKQGCALLQPIDMEVGAGTSHVHTFLRAVGPEPWRAAYVQPSRRP 60

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNRLQHYYQ+QV++KP P N+ +LY+ SL+A+G D   +DVRFVED+WE+PT
Sbjct: 61  KDGRYGENPNRLQHYYQYQVVLKPAPENILDLYLGSLEALGFDLKQNDVRFVEDDWENPT 120

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQ+V G+EC P+ GEITYGLERLAMY+Q V +VYD+++
Sbjct: 121 LGAWGLGWEVWLNGMEVTQFTYFQEVGGLECKPVLGEITYGLERLAMYLQKVENVYDLIW 180

Query: 190 --------NAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKG 241
                   N  E + + YGD++ Q+E E S YNFE+AN ++L   F   E E   ++   
Sbjct: 181 TEWEEQGPNGPEIRRLTYGDVYHQNEVEQSTYNFEHANVDLLFTFFNSYEAEAKKMIDAQ 240

Query: 242 IPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLM 301
           +            PAY+  +KA H FNLLDARG IS TER  YI RIR+L++   +A+  
Sbjct: 241 L----------ALPAYELVLKAGHTFNLLDARGAISVTERAAYIGRIRALSRLVAQAYYD 290

Query: 302 TPN 304
           +  
Sbjct: 291 SRE 293


>gi|149191883|ref|ZP_01870117.1| glycyl-tRNA synthetase subunit alpha [Vibrio shilonii AK1]
 gi|148834275|gb|EDL51278.1| glycyl-tRNA synthetase subunit alpha [Vibrio shilonii AK1]
          Length = 302

 Score =  538 bits (1387), Expect = e-151,   Method: Composition-based stats.
 Identities = 183/302 (60%), Positives = 222/302 (73%), Gaps = 9/302 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +IL L  YWAQ GCTI+QP DMEVGAGT HP T LRALGP     AYVQ
Sbjct: 1   MQKYDIKTFQGMILALQDYWAQNGCTIVQPLDMEVGAGTSHPMTCLRALGPEPMSTAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQV +KP+P N+Q LY+ SL+ +GIDPL+HD+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVALKPSPDNIQELYLGSLEVLGIDPLVHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYG+ERLAMY+Q V+SV
Sbjct: 121 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGIERLAMYIQEVDSV 180

Query: 185 YDIVFN-AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIP 243
           YD+V+N A +G  V YGDIF Q+E E S YNFE+A+ + L ++F   EKE          
Sbjct: 181 YDLVWNIAPDGSKVTYGDIFHQNEVEQSTYNFEHADVDFLFSYFDQCEKE--------TK 232

Query: 244 NEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTP 303
                      PAY++ +KA+H FNLLDAR  IS TERQRYILRIR+L K+  EA+  + 
Sbjct: 233 ELLELEKPLPLPAYERILKAAHAFNLLDARKAISVTERQRYILRIRNLTKSVAEAYYASR 292

Query: 304 NG 305
             
Sbjct: 293 EA 294


>gi|153835121|ref|ZP_01987788.1| glycyl-tRNA synthetase, alpha subunit [Vibrio harveyi HY01]
 gi|148868393|gb|EDL67507.1| glycyl-tRNA synthetase, alpha subunit [Vibrio harveyi HY01]
          Length = 305

 Score =  538 bits (1386), Expect = e-151,   Method: Composition-based stats.
 Identities = 184/302 (60%), Positives = 220/302 (72%), Gaps = 9/302 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +IL L  YWAQ GCTI+QP DMEVGAGT HP T LRALGP     AYVQ
Sbjct: 1   MQKYDIKTFQGMILALQDYWAQNGCTIVQPLDMEVGAGTSHPMTCLRALGPEPMSTAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQV +KP+P N+Q LY+ SL+ +G+DPL+HD+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVALKPSPDNIQELYLGSLEVLGVDPLVHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYG+ERLAMY+Q V+SV
Sbjct: 121 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGIERLAMYIQEVDSV 180

Query: 185 YDIVFN-AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIP 243
           YD+ +N A +G  V YGDIF Q+E E S YNFE+A+ E L + F   EKEC         
Sbjct: 181 YDLTWNIAPDGSKVTYGDIFHQNEVEQSTYNFEHADVEFLFSFFEQCEKECK-------- 232

Query: 244 NEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTP 303
                      PAY++ +KA H FNLLDAR  IS TERQRYILRIR+L KA  EA+  + 
Sbjct: 233 ELLELEKPLPLPAYERILKAGHAFNLLDARKAISVTERQRYILRIRNLTKAVAEAYYASR 292

Query: 304 NG 305
             
Sbjct: 293 EA 294


>gi|59710622|ref|YP_203398.1| glycyl-tRNA synthetase subunit alpha [Vibrio fischeri ES114]
 gi|197333992|ref|YP_002154787.1| glycyl-tRNA synthetase, alpha subunit [Vibrio fischeri MJ11]
 gi|75431920|sp|Q5E8Y6|SYGA_VIBF1 RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|238690287|sp|B5FEV9|SYGA_VIBFM RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|59478723|gb|AAW84510.1| glycyl-tRNA synthetase, alpha subunit [Vibrio fischeri ES114]
 gi|197315482|gb|ACH64929.1| glycyl-tRNA synthetase, alpha subunit [Vibrio fischeri MJ11]
          Length = 306

 Score =  538 bits (1386), Expect = e-151,   Method: Composition-based stats.
 Identities = 183/302 (60%), Positives = 219/302 (72%), Gaps = 9/302 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +IL L  YWAQ GCTI+QP DMEVGAGT HP T LRALGP     AYVQ
Sbjct: 1   MQKYDIKTFQGMILALQDYWAQNGCTIVQPLDMEVGAGTSHPMTCLRALGPEPMSTAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQV +KP+P N+Q LY+ SL+ +GIDPL+HD+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVALKPSPDNIQELYLGSLEVLGIDPLVHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYG+ERLAMY+Q V+SV
Sbjct: 121 WENPTLGAWGLGWEIWLNGMEVTQFTYFQQVGGLECKPVTGEITYGIERLAMYIQEVDSV 180

Query: 185 YDIVFN-AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIP 243
           YD+V+N   +G  V YGDIF Q+E E S YNFE+A+ + L   F   EKE          
Sbjct: 181 YDLVWNIGPDGTAVTYGDIFHQNEVEQSTYNFEHADVDFLFGFFDQCEKESK-------- 232

Query: 244 NEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTP 303
                      PAY++ +KA+H FNLLDAR  IS TERQRYILRIR+L KA  EA+  + 
Sbjct: 233 ELLELEKPLPLPAYERILKAAHAFNLLDARKAISVTERQRYILRIRNLTKAVAEAYYASR 292

Query: 304 NG 305
             
Sbjct: 293 EA 294


>gi|237806785|ref|YP_002891225.1| glycyl-tRNA synthetase subunit alpha [Tolumonas auensis DSM 9187]
 gi|259511917|sp|C4L763|SYGA_TOLAT RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|237499046|gb|ACQ91639.1| glycyl-tRNA synthetase, alpha subunit [Tolumonas auensis DSM 9187]
          Length = 304

 Score =  538 bits (1386), Expect = e-151,   Method: Composition-based stats.
 Identities = 177/300 (59%), Positives = 217/300 (72%), Gaps = 8/300 (2%)

Query: 5   HNKKNDLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQ 64
             K +  +FQ +IL+L  YWA+QGC I QP DMEVGAGT HP T LR++GP     AYVQ
Sbjct: 1   MQKFDIKTFQGLILSLQDYWARQGCVISQPLDMEVGAGTSHPMTFLRSIGPEPMNCAYVQ 60

Query: 65  PSRRPLDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDN 124
           PSRRP DGRY ENPNRLQHYYQFQVI+KP+P N+Q LY+ SL+ +G DPL+HD+RFVEDN
Sbjct: 61  PSRRPTDGRYGENPNRLQHYYQFQVILKPSPDNIQELYLGSLRELGFDPLVHDIRFVEDN 120

Query: 125 WESPTLGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSV 184
           WE+PTLGAWGLGWE W +GME++QFTYFQQV G+EC P++GEITYGLERLAMY+Q V+S+
Sbjct: 121 WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECFPVTGEITYGLERLAMYIQGVDSL 180

Query: 185 YDIVFNAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPN 244
           YD+V+       V Y D+F Q+E E S YNFE+A+   L   F   EKEC         +
Sbjct: 181 YDLVWADGPLGKVTYRDVFHQNEVEQSTYNFEHADVPFLFQLFDQCEKECQ--------H 232

Query: 245 EHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
             +       PAY++ +KA+H FNLLDAR  IS TERQRYILRIR+L+KA  EA+     
Sbjct: 233 LLNLELPLPLPAYERILKAAHAFNLLDARHAISVTERQRYILRIRTLSKAVAEAYYAARE 292


>gi|241662035|ref|YP_002980395.1| glycyl-tRNA synthetase subunit alpha [Ralstonia pickettii 12D]
 gi|240864062|gb|ACS61723.1| glycyl-tRNA synthetase, alpha subunit [Ralstonia pickettii 12D]
          Length = 328

 Score =  538 bits (1386), Expect = e-151,   Method: Composition-based stats.
 Identities = 164/308 (53%), Positives = 212/308 (68%), Gaps = 13/308 (4%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ +IL L  YW  QGC +LQP D+EVGAGT H  T LRA+GP  W+AAYVQPSRRP
Sbjct: 1   MLTFQQLILKLQSYWDAQGCALLQPIDLEVGAGTSHVHTFLRAIGPEPWRAAYVQPSRRP 60

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNRLQHYYQ+QV++KP P N+ +LY+ SL+A+G+D   +DVRFVED+WE+PT
Sbjct: 61  KDGRYGENPNRLQHYYQYQVVLKPAPENILDLYLGSLEALGLDLKQNDVRFVEDDWENPT 120

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQQV G++C P++GEITYG+ERLAMY+Q V ++YD+V+
Sbjct: 121 LGAWGLGWEVWLNGMEVTQFTYFQQVGGLDCKPVTGEITYGIERLAMYLQQVENIYDLVW 180

Query: 190 NAIEGQN--------VLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKG 241
              E           + YGD++ Q+E E S YNFE A+  +L   F + E E   L+   
Sbjct: 181 TEWEEPGPNGPVKRRLTYGDVYHQNEVEQSTYNFEQADTTVLFRRFAEHEAEAKRLMGVR 240

Query: 242 IPNEHHRH-----HLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACG 296
              +              PAY+Q +KA H FNLLDARG IS TER  YI RIR+L++   
Sbjct: 241 AEGDAAAEGNAPVVQLALPAYEQVLKAGHTFNLLDARGAISVTERAAYIGRIRNLSRLVA 300

Query: 297 EAFLMTPN 304
           +A+  +  
Sbjct: 301 QAYYDSRE 308


>gi|187927505|ref|YP_001897992.1| glycyl-tRNA synthetase subunit alpha [Ralstonia pickettii 12J]
 gi|309779793|ref|ZP_07674548.1| glycyl-tRNA synthetase, alpha subunit [Ralstonia sp. 5_7_47FAA]
 gi|187724395|gb|ACD25560.1| glycyl-tRNA synthetase, alpha subunit [Ralstonia pickettii 12J]
 gi|308921370|gb|EFP67012.1| glycyl-tRNA synthetase, alpha subunit [Ralstonia sp. 5_7_47FAA]
          Length = 328

 Score =  538 bits (1386), Expect = e-151,   Method: Composition-based stats.
 Identities = 164/308 (53%), Positives = 212/308 (68%), Gaps = 13/308 (4%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ +IL L  YW  QGC +LQP D+EVGAGT H  T LRA+GP  W+AAYVQPSRRP
Sbjct: 1   MLTFQQLILKLQSYWDAQGCALLQPIDLEVGAGTSHVHTFLRAIGPEPWRAAYVQPSRRP 60

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNRLQHYYQ+QV++KP P N+ +LY+ SL+A+G+D   +DVRFVED+WE+PT
Sbjct: 61  KDGRYGENPNRLQHYYQYQVVLKPAPENILDLYLGSLEALGLDLKQNDVRFVEDDWENPT 120

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQQV G++C P++GEITYG+ERLAMY+Q V ++YD+V+
Sbjct: 121 LGAWGLGWEVWLNGMEVTQFTYFQQVGGLDCKPVTGEITYGIERLAMYLQQVENIYDLVW 180

Query: 190 NAIEGQN--------VLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKG 241
              E           + YGD++ Q+E E S YNFE A+  +L   F + E E   L+   
Sbjct: 181 TEWEEPGPNGPVKRRLTYGDVYHQNEVEQSTYNFEQADTTVLFRRFAEHEAEAKRLMGVR 240

Query: 242 IPNEHHRH-----HLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACG 296
              +              PAY+Q +KA H FNLLDARG IS TER  YI RIR+L++   
Sbjct: 241 AEGDAAAEGDAPVVQLALPAYEQVLKAGHTFNLLDARGAISVTERAAYIGRIRNLSRLVA 300

Query: 297 EAFLMTPN 304
           +A+  +  
Sbjct: 301 QAYYDSRE 308


>gi|302036969|ref|YP_003797291.1| glycyl-tRNA synthetase subunit alpha [Candidatus Nitrospira
           defluvii]
 gi|300605033|emb|CBK41366.1| Glycyl-tRNA synthetase, alpha subunit [Candidatus Nitrospira
           defluvii]
          Length = 306

 Score =  538 bits (1386), Expect = e-151,   Method: Composition-based stats.
 Identities = 172/298 (57%), Positives = 217/298 (72%), Gaps = 15/298 (5%)

Query: 11  LSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPL 70
           ++FQ++ILTL ++WA +GC + QPYD+E+GAGTFHP+T LR+LGP  W+AAY Q  RRP 
Sbjct: 1   MNFQDLILTLHRFWADRGCVVHQPYDLEMGAGTFHPATFLRSLGPEPWRAAYPQACRRPT 60

Query: 71  DGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTL 130
           DGRY ENPNR+QHYYQ+QV++KP P N+Q LY+ESLK +GIDP  HD+RFV+D+WESPTL
Sbjct: 61  DGRYGENPNRMQHYYQYQVVLKPAPDNIQGLYLESLKQLGIDPKKHDIRFVQDDWESPTL 120

Query: 131 GAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFN 190
           GAWGLGWE   DGMEI+QFTYFQ++ GI  +PI+GEITYG ER+AMY+Q V++VYD+ + 
Sbjct: 121 GAWGLGWEVRLDGMEITQFTYFQEIGGIPLNPITGEITYGTERIAMYLQQVDNVYDLAWT 180

Query: 191 AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHH 250
                 V YGD+  +SE E+SRYNFE     +L   F   E EC  LL K +        
Sbjct: 181 ----DGVSYGDVHHRSEVEFSRYNFEEGEVPMLMATFQAFEGECQRLLDKKLT------- 229

Query: 251 LCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNG-GH 307
               PAYD CIK SH+FNLLDARG IS TER  YI R+R+LA+ C E++L      GH
Sbjct: 230 ---LPAYDYCIKTSHMFNLLDARGAISVTERTSYIARVRALARRCAESYLADREAMGH 284


>gi|229815345|ref|ZP_04445680.1| hypothetical protein COLINT_02391 [Collinsella intestinalis DSM
           13280]
 gi|229809125|gb|EEP44892.1| hypothetical protein COLINT_02391 [Collinsella intestinalis DSM
           13280]
          Length = 300

 Score =  538 bits (1386), Expect = e-151,   Method: Composition-based stats.
 Identities = 175/296 (59%), Positives = 218/296 (73%), Gaps = 11/296 (3%)

Query: 11  LSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPL 70
           ++FQ +IL L +YWA  GCT++QPYD EVGAGTFH +T LR+LG   W+  Y QP RRP 
Sbjct: 1   MTFQEMILKLEEYWAGHGCTVMQPYDSEVGAGTFHTATLLRSLGKKPWRTCYPQPCRRPA 60

Query: 71  DGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTL 130
           DGRY ENPNR+QHYYQFQV+IKP+P N Q LY++SL A+G+DP  HDVRFVED+WESPTL
Sbjct: 61  DGRYGENPNRMQHYYQFQVLIKPSPENSQELYLDSLTAIGLDPAEHDVRFVEDDWESPTL 120

Query: 131 GAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFN 190
           GAWGLGWE W DGME++QFTYFQQV GIEC P+  EITYGLER+AMY Q V SVYD+V++
Sbjct: 121 GAWGLGWEVWLDGMEVTQFTYFQQVGGIECDPVPVEITYGLERIAMYAQGVTSVYDLVWS 180

Query: 191 A-IEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRH 249
              +G  + YG++F ++E+E+S YNFE AN +++   F D E EC   L+  +P      
Sbjct: 181 YLPDGTPMTYGEVFLENEREFSAYNFEVANVDMMRQKFDDFEAECHACLEAKLP------ 234

Query: 250 HLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPNG 305
                PAYD  +K SH FN+LDARG IS T R  YILR+R+LAKAC E++L    G
Sbjct: 235 ----LPAYDCVMKCSHSFNILDARGAISATGRAAYILRVRTLAKACCESYLAEVAG 286


>gi|206559297|ref|YP_002230058.1| glycyl-tRNA synthetase subunit alpha [Burkholderia cenocepacia
           J2315]
 gi|198035335|emb|CAR51210.1| putative glycyl-tRNA synthetase alpha chain [Burkholderia
           cenocepacia J2315]
          Length = 334

 Score =  538 bits (1386), Expect = e-151,   Method: Composition-based stats.
 Identities = 169/303 (55%), Positives = 214/303 (70%), Gaps = 18/303 (5%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            L+FQ IILTL  YW +QGC +LQP DMEVGAGT H  T LRA+GP  W+AAYVQPSRRP
Sbjct: 1   MLTFQQIILTLQSYWDKQGCALLQPIDMEVGAGTSHVHTFLRAVGPEPWRAAYVQPSRRP 60

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNRLQHYYQ+QV++KP P N+ +LY+ SL+A+G D   +DVRFVED+WE+PT
Sbjct: 61  KDGRYGENPNRLQHYYQYQVVLKPAPENILDLYLGSLEALGFDLKQNDVRFVEDDWENPT 120

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQ+V G+EC P+ GEITYGLERLAMY+Q V +VYD+V+
Sbjct: 121 LGAWGLGWEVWLNGMEVTQFTYFQEVGGLECKPVLGEITYGLERLAMYLQKVENVYDLVW 180

Query: 190 --------NAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKG 241
                   N  E + + YGD++ Q+E E S YNFE+AN ++L   F   E E   ++   
Sbjct: 181 TEWEEQGPNGPELRRLSYGDVYHQNEVEQSTYNFEHANVDLLFTFFNSYEAEAKKMIDAQ 240

Query: 242 IPNEHHRHHLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLM 301
           +            PAY+  +KA H FNLLDARG IS TER  YI RIR+L++   +A+  
Sbjct: 241 L----------ALPAYELVLKAGHTFNLLDARGAISVTERAAYIGRIRALSRLVAQAYYD 290

Query: 302 TPN 304
           +  
Sbjct: 291 SRE 293


>gi|251796250|ref|YP_003010981.1| glycyl-tRNA synthetase subunit alpha [Paenibacillus sp. JDR-2]
 gi|247543876|gb|ACT00895.1| glycyl-tRNA synthetase, alpha subunit [Paenibacillus sp. JDR-2]
          Length = 295

 Score =  538 bits (1386), Expect = e-151,   Method: Composition-based stats.
 Identities = 165/294 (56%), Positives = 210/294 (71%), Gaps = 14/294 (4%)

Query: 11  LSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPL 70
           ++FQN+ILTL Q+WA+Q C ++QPYD E GAGT +P T LR +GP  W  AYV+PSRRP 
Sbjct: 1   MNFQNMILTLQQFWAEQNCILVQPYDTEKGAGTMNPMTFLRTIGPEPWNVAYVEPSRRPA 60

Query: 71  DGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTL 130
           DGRY ENPNRL  ++QFQVI+KP+P N+Q LY+ESLK +GIDP  HD+RFVEDNWESPTL
Sbjct: 61  DGRYGENPNRLYQHHQFQVILKPSPDNIQELYLESLKRLGIDPRHHDIRFVEDNWESPTL 120

Query: 131 GAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFN 190
           GAWGLGWE W +GMEI+QFTYFQQV GI+ +P++ EITYG+ERLA Y+Q   +V+D+ + 
Sbjct: 121 GAWGLGWEVWLNGMEITQFTYFQQVGGIDANPVAVEITYGMERLASYIQEKENVFDLEWV 180

Query: 191 AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHH 250
                 V YGD+F Q E E+S+Y FE ++  +L   F   E+E    ++          H
Sbjct: 181 ----DGVTYGDVFLQPEFEHSKYTFETSDSAMLFQLFNMYEEEAKKTME----------H 226

Query: 251 LCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
             VFPAYD  +K SH FNLLDARG IS TER  YI+R+R+LA+AC   +L    
Sbjct: 227 NLVFPAYDYVLKCSHTFNLLDARGAISVTERTGYIMRVRNLARACAATYLEERE 280


>gi|282850266|ref|ZP_06259645.1| glycyl-tRNA synthetase, alpha subunit [Veillonella parvula ATCC
           17745]
 gi|282579759|gb|EFB85163.1| glycyl-tRNA synthetase, alpha subunit [Veillonella parvula ATCC
           17745]
          Length = 291

 Score =  538 bits (1386), Expect = e-151,   Method: Composition-based stats.
 Identities = 157/294 (53%), Positives = 203/294 (69%), Gaps = 14/294 (4%)

Query: 11  LSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRPL 70
           ++FQ IIL L ++W+ QGC +  PYD+E GAGT +P+T L A+GP  W   YV+PSRRP 
Sbjct: 1   MTFQEIILNLQKFWSDQGCIVQNPYDIEKGAGTMNPATFLHAIGPEPWAVCYVEPSRRPA 60

Query: 71  DGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPTL 130
           DGRY +NPNRL  ++QFQVI+KP+P N+Q LY++SL  +GI    HD+RFVEDNWESPTL
Sbjct: 61  DGRYGDNPNRLFQHHQFQVIVKPSPDNIQELYLQSLATLGIHAEDHDIRFVEDNWESPTL 120

Query: 131 GAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVFN 190
           GAWGLGWE W DGME++QFTYFQQV  I+C P+S EITYGLERLAMY+Q V +VYD+ +N
Sbjct: 121 GAWGLGWEVWLDGMEVTQFTYFQQVGSIDCKPVSVEITYGLERLAMYIQGVENVYDLKWN 180

Query: 191 AIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRHH 250
               +NV YGD++  +E E S YNFE A+ ++L   F   E E   +   G         
Sbjct: 181 ----ENVTYGDVWHANEVEQSVYNFELADTDMLFKLFDMYEAEAKRVCAAGY-------- 228

Query: 251 LCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
             V PAYD  +K SH FNLLD+ G IS +ER  +I R+R+LA+ C + +L    
Sbjct: 229 --VLPAYDYVLKCSHTFNLLDSHGAISISERTAFIGRVRALARICAQQYLAKRE 280


>gi|124268565|ref|YP_001022569.1| glycyl-tRNA synthetase subunit alpha [Methylibium petroleiphilum
           PM1]
 gi|166200230|sp|A2SL95|SYGA_METPP RecName: Full=Glycyl-tRNA synthetase alpha subunit; AltName:
           Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS
 gi|124261340|gb|ABM96334.1| Glycine--tRNA ligase [Methylibium petroleiphilum PM1]
          Length = 318

 Score =  537 bits (1385), Expect = e-151,   Method: Composition-based stats.
 Identities = 173/295 (58%), Positives = 217/295 (73%), Gaps = 14/295 (4%)

Query: 10  DLSFQNIILTLTQYWAQQGCTILQPYDMEVGAGTFHPSTTLRALGPLSWKAAYVQPSRRP 69
            LSFQ IIL L QYWA QGC +LQPYDMEVGAGT H +T LRALGP  WKAAYVQPSRRP
Sbjct: 1   MLSFQQIILRLQQYWADQGCALLQPYDMEVGAGTSHTATFLRALGPEPWKAAYVQPSRRP 60

Query: 70  LDGRYAENPNRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGIDPLIHDVRFVEDNWESPT 129
            DGRY ENPNRLQHYYQ+QV++KP P N+  LY+ SL+A+G D   +D+RFVED+WE+PT
Sbjct: 61  KDGRYGENPNRLQHYYQYQVVLKPAPSNILELYLGSLEALGFDLKANDIRFVEDDWENPT 120

Query: 130 LGAWGLGWECWCDGMEISQFTYFQQVCGIECSPISGEITYGLERLAMYVQNVNSVYDIVF 189
           LGAWGLGWE W +GME++QFTYFQQV GI+C PI+GEITYGLERLAMY+Q V++VY + +
Sbjct: 121 LGAWGLGWEVWLNGMEVTQFTYFQQVGGIDCRPITGEITYGLERLAMYLQGVDNVYKLQW 180

Query: 190 NAIEGQNVLYGDIFAQSEQEYSRYNFEYANPEILHNHFIDSEKECLDLLKKGIPNEHHRH 249
                + + YGD++ Q+EQE S YNFE++N + L   F   E     L+ + +       
Sbjct: 181 T----EGLSYGDVYLQNEQEQSAYNFEHSNVDFLLTAFGAHEGNAQQLMTQQL------- 229

Query: 250 HLCVFPAYDQCIKASHIFNLLDARGVISTTERQRYILRIRSLAKACGEAFLMTPN 304
                PAY+Q +KA+H FNLLDARG IS TER  YI RIR+LA+A  ++++ +  
Sbjct: 230 ---ALPAYEQVLKAAHTFNLLDARGAISVTERAAYIGRIRNLARAVAQSYVDSRA 281


>gi|291533033|emb|CBL06146.1| glycyl-tRNA synthetase alpha chain [Megamonas hypermegale ART12/1]
          Length = 309

 Score =  537 bits (1385), Expect = e-151,   Method: Composition-based stats.
 Identities = 162/294 (55%), Positives = 209/294 (71%), Gaps = 14/294 (4%)

Query: 11  LSFQNIILTLTQYWAQQGCTILQPY