HHsearch alignment for GI: 254780758 and conserved domain: KOG4736

>KOG4736 consensus.
Probab=98.91  E-value=1.7e-09  Score=74.91  Aligned_cols=153  Identities=26%  Similarity=0.369  Sum_probs=86.8

Q ss_pred             CCCEEEEEECCCCEEEEECCCCCHHHHHHHHHHCCC---CEEEEEECCCCCCCCCCCHHHHHHHCCCEEECCHHHHHHHC
Q ss_conf             571699998899849998389999999999997499---75299986988521011056788607955405843898840
Q gi|254780758|r   15 KQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNF---HVKQIWITHGHVDHVGGAAQLKEDLSLTIIGPHKDDAAMMG   91 (216)
Q Consensus        15 ~~N~~li~~~~~~~~ilID~G~~~~~i~~~l~~~~~---~i~~Ii~TH~H~DH~gg~~~l~~~~~~~i~~~~~~~~~~~~   91 (216)
T Consensus        94 ~~~~tl~~d--~~~v~v~~~gls------~lak~~vt~d~i~~vv~t~~~~~hlgn~~~f~~s---p~l-~~s--~e~--  157 (302)
T KOG4736          94 QGQITLVVD--GGDVVVVDTGLS------VLAKEGVTLDQIDSVVITHKSPGHLGNNNLFPQS---PIL-YHS--MEY--  157 (302)
T ss_pred             HCCCCEEEC--CCCEEEEECCCC------HHHHCCCCHHHCCEEEEECCCCCCCCCCCCCCCC---HHH-HHH--HHH--
T ss_conf             204540312--883499955872------2421476753455168732475542653346677---777-664--560--


Q ss_pred             CHHHHHHHHHCCCCCCCCCCEEEECCCCEEEEECCCCCCCCCCCCCCCCCCCCCC----CCCCCCCCCHHHHCCCCCCCC
Q ss_conf             1234444320023466667418964783997620123310122247210000012----343211110000013566346
Q gi|254780758|r   92 KVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFKVFHCPGHSPGHVIYVNF----ENNFAHLGDTLFRSSIGRTDI  167 (216)
Q Consensus        92 ~~~~~~~~~~~~~~~~~~~~~~~l~~gd~i~lg~~~~~vi~tPGHt~g~~~~~~~----~~~~lftGD~lf~~~~G~~d~  167 (216)
T Consensus       158 -------------~gr~~~p-t~l~e~~~~~l~-~~~~V~~TpGht~~~isvlv~n~~~~GTv~itGD-Lf~~~-~dlde  220 (302)
T KOG4736         158 -------------IGRHVTP-TELDERPYLKLS-PNVEVWKTPGHTQHDISVLVHNVDLYGTVAITGD-LFPRE-EDLDE  220 (302)
T ss_pred             -------------CCCCCCH-HHHCCCCCCCCC-CCEEEEECCCCCCCCEEEEEEEECCCCEEEEEEE-CCCCC-CCCCC
T ss_conf             -------------3785674-240337740017-7546750799987635799985045524899853-24577-65443


Q ss_pred             C------CC--CHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHH
Q ss_conf             7------98--999999999999851999789984887988889
Q gi|254780758|r  168 L------HG--DYQQLINSINNKILPLGDEISFVCGHGPNSTIG  203 (216)
Q Consensus       168 ~------~~--d~~~~~~sl~~~l~~l~~~~~v~PgHG~~tt~~  203 (216)
T Consensus       221 ~d~i~~~e~s~d~~~kr~~-r~~~v~l~D--~ivpgHg~~f~v~  261 (302)
T KOG4736         221 KDDIMSQEGSEDNAAKRQS-RNRYVCLAD--WIVPGHGPPFRVL  261 (302)
T ss_pred             HHHHHHHCCCCCHHHHHHH-HHCEEEEEE--EEECCCCCCEEEC
T ss_conf             4556541368744454653-411798743--4533888722012