HHsearch alignment for GI: 254780758 and conserved domain: PRK11244

>PRK11244 phnP carbon-phosphorus lyase complex accessory protein; Provisional.
Probab=99.14  E-value=1.1e-10  Score=81.92  Aligned_cols=124  Identities=20%  Similarity=0.219  Sum_probs=72.5

Q ss_pred             CEEEEEECCCCEEEEECCCCCHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCHHHHH--HHCCCEEECCHHHHHHHCCHH
Q ss_conf             169999889984999838999999999999749975299986988521011056788--607955405843898840123
Q gi|254780758|r   17 NCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLKE--DLSLTIIGPHKDDAAMMGKVD   94 (216)
Q Consensus        17 N~~li~~~~~~~~ilID~G~~~~~i~~~l~~~~~~i~~Ii~TH~H~DH~gg~~~l~~--~~~~~i~~~~~~~~~~~~~~~   94 (216)
T Consensus        37 r~s~lv~~~-~~~iLID~g~--~dl~~~~~~--~~iDaVllTH~H~DHi~GlddlR~~~~~~ipvy~~~~~~-~~~~-l-  108 (250)
T PRK11244         37 PCSALLEFN-GARTLIDAGL--HDLAERFPP--GSLQAFLLTHYHMDHVQGLFPLRWGVGDVIPVYGPPDPE-GCDD-L-  108 (250)
T ss_pred             EEEEEEEEC-CEEEEEECCC--HHHHHHCCC--CCCCEEEEECCCHHHHCCHHHHHHCCCCCEEEEECCCHH-HHHH-H-
T ss_conf             348999989-9279998980--899975555--687789982575334337688871379835677377577-8999-8-


Q ss_pred             HHHHHHHCCCCCCCCCCEEEECCCCEEEEECCCCCCCCCCCCCCCCCCCCCCC--CCCCCCCCHH
Q ss_conf             44443200234666674189647839976201233101222472100000123--4321111000
Q gi|254780758|r   95 EQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFKVFHCPGHSPGHVIYVNFE--NNFAHLGDTL  157 (216)
Q Consensus        95 ~~~~~~~~~~~~~~~~~~~~l~~gd~i~lg~~~~~vi~tPGHt~g~~~~~~~~--~~~lftGD~l  157 (216)
T Consensus       109 --~~~~~------~~~~~~~~~~~~~~~i~g~~itp~~~~-Hg~~~~Gy~i~~~g~~~aY~tD~~  164 (250)
T PRK11244        109 --FKHPG------ILDFSHPLEAFEPFDLGGLQVTPLPLN-HSKLTFGYLLETAHSRFAYLTDTV  164 (250)
T ss_pred             --HHCCC------CCCCCCCCCCCCCEEECCEEEEEEEEC-CCCCCEEEEEECCCCEEEEECCCC
T ss_conf             --50788------434236658888668688389999977-889736999964893299966778