HHsearch alignment for GI: 254780758 and conserved domain: PRK11539

>PRK11539 hypothetical protein; Provisional.
Probab=99.68  E-value=2.9e-15  Score=108.50  Aligned_cols=167  Identities=17%  Similarity=0.195  Sum_probs=109.7

Q ss_pred             CCEEEEEECCCCCCCEEEEEECCCCEEEEECCCCC-------HHHHHHHHHHCCCCEEEEEECCCCCCCCCCCHHHHHHH
Q ss_conf             73599997087657169999889984999838999-------99999999974997529998698852101105678860
Q gi|254780758|r    3 KLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGD-------LDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLKEDL   75 (216)
Q Consensus         3 ~~~~~~i~v~~~~~N~~li~~~~~~~~ilID~G~~-------~~~i~~~l~~~~~~i~~Ii~TH~H~DH~gg~~~l~~~~   75 (216)
T Consensus       498 ~~~v~~LDVG--QG~avlI~~--~~~~~L~DtG~~~~~~~~g~~vi~P~L~~~Gi~lD~lvlSH~D~DH~GGl~~ll~~~  573 (754)
T PRK11539        498 EWRVDMLDVG--QGLAMVIER--NGKAILYDTGNAWPEGDSAQQVIIPWLRWHNLTPEGVILSHEHLDHRGGLASLLHAW  573 (754)
T ss_pred             CCEEEEEECC--CCEEEEEEE--CCEEEEEECCCCCCCCCCHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCHHHHHHHC
T ss_conf             6089999727--851899998--997899957998888872377889999967997208994588500126899999848


Q ss_pred             CCCEEECCHHHHHHHCCHHHHHHHHHCCCCCCCCCCEEEECCCCEEEEECCCCCCCCCCCC-----CCCCCCCCCC--CC
Q ss_conf             7955405843898840123444432002346666741896478399762012331012224-----7210000012--34
Q gi|254780758|r   76 SLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFKVFHCPGH-----SPGHVIYVNF--EN  148 (216)
Q Consensus        76 ~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~gd~i~lg~~~~~vi~tPGH-----t~g~~~~~~~--~~  148 (216)
T Consensus       574 p~~~i~~~~~~~-----------------------~~~~c~~G~~~~~~g~~~~vL~P~~~~~~~~N~~ScVl~i~~g~~  630 (754)
T PRK11539        574 PMAWIRSPLNWA-----------------------NHLPCVRGERWQWQGLTFSVHWPLQQSNDAGNNDSCVVKVDDGKH  630 (754)
T ss_pred             CCEEEECCCCCC-----------------------CCCCEECCCEEEECCEEEEEECCCCCCCCCCCCCCEEEEEEECCE
T ss_conf             830998656656-----------------------765511687899999899997799867899998848999998996


Q ss_pred             CCCCCCCHHHHCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCEEEEECCCCCC--CHHHHHHHCH
Q ss_conf             3211110000013566346798999999999999851999789984887988--8899988281
Q gi|254780758|r  149 NFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEISFVCGHGPNS--TIGRERRLNP  210 (216)
Q Consensus       149 ~~lftGD~lf~~~~G~~d~~~~d~~~~~~sl~~~l~~l~~~~~v~PgHG~~t--t~~~e~~~n~  210 (216)
T Consensus       631 s~LltGDi------e-----~~~E~~Ll~---~~~~~L~~dVLkvpHHGSktSSs~~Fl~~v~P  680 (754)
T PRK11539        631 SILLTGDI------E-----AQAEQKMLS---RYWQQLQATLLQVPHHGSNTSSSLPFIQRVNG  680 (754)
T ss_pred             EEEEECCC------C-----HHHHHHHHH---CCCCCCCCCEEECCCCCCCCCCHHHHHHHCCC
T ss_conf             89996279------9-----899999986---37668888689889989784665999985499