HHsearch alignment for GI: 254780758 and conserved domain: TIGR02651

>TIGR02651 RNase_Z ribonuclease Z; InterPro: IPR013471 All tRNA molecules are synthesised as long precursors with extra sequence at both the 5' and 3' ends, which undergo several processing steps to form the mature tRNA molecule. In many bacteria the tRNA precursors do not contain the CCA sequence which forms the 3' end of the mature tRNA and is essential for aminoacylation. In these organisms ribonucleotide Z cleaves the precursor to form a 3' end to which CCA is added. Species where all tRNA sequences already have the CCA tail, such as E. coli, do not generally posses this form of ribonuclease Z. ; GO: 0016891 endoribonuclease activity producing 5'-phosphomonoesters, 0042779 removal of tRNA 3'-trailer sequence.
Probab=99.18  E-value=6e-11  Score=83.39  Aligned_cols=128  Identities=23%  Similarity=0.210  Sum_probs=78.7

Q ss_pred             CCEEEEEEC-CCCEEEEECCCCCHHHHHHHHHHCCC---CEEEEEECCCCCCCCCCCHHHHHHH---------CCCEEEC
Q ss_conf             716999988-99849998389999999999997499---7529998698852101105678860---------7955405
Q gi|254780758|r   16 QNCTFLFDE-ESLEAVVVDPGGDLDIIKDVIQSRNF---HVKQIWITHGHVDHVGGAAQLKEDL---------SLTIIGP   82 (216)
Q Consensus        16 ~N~~li~~~-~~~~~ilID~G~~~~~i~~~l~~~~~---~i~~Ii~TH~H~DH~gg~~~l~~~~---------~~~i~~~   82 (216)
T Consensus        18 ~~si~l~~~~e~g~~~LFDCG---EGTQ~Q~~~~~~~~~~i~~IFITH~HGDHi~GLPGLl~t~sf~G~~r~~pL~IyGP   94 (327)
T TIGR02651        18 VSSIALKLEDERGELWLFDCG---EGTQRQMLRSGISPMKIDRIFITHLHGDHILGLPGLLSTMSFQGGGRKEPLTIYGP   94 (327)
T ss_pred             CCEEEEECHHHCCCEEEEECC---CHHHHHHHHCCCCCCCCCEEEEECCCHHHHHHHHHHHHHHCCCCCCCCCCEEEECC
T ss_conf             758999602242874255477---18999999716886311136870663145542368888310378886445288687


Q ss_pred             CHHHHHHHCCHHHHHHHHHCCCCCCCCCCEEE-----------ECCCCEEEEECCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             84389884012344443200234666674189-----------647839976201233101222472100000123
Q gi|254780758|r   83 HKDDAAMMGKVDEQARLLSIRMNARNASSDRW-----------LQDGDTLLLGTHIFKVFHCPGHSPGHVIYVNFE  147 (216)
Q Consensus        83 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-----------l~~gd~i~lg~~~~~vi~tPGHt~g~~~~~~~~  147 (216)
T Consensus        95 ~G~~e~~~~~l~~~~~~~~y~i~~~E~~~~~~~P~~~~~k~k~l~~~~~~~~~~f~v~~~~l-~H~~~~~GY~~~E  169 (327)
T TIGR02651        95 PGIKEFIETSLRVSYTYLNYPIKIHEIEEKGVLPEFVVYKEKLLEDGLVFEDDGFKVEAFPL-DHSIPSLGYRFEE  169 (327)
T ss_pred             HHHHHHHHHHHHHHCCCCCCCEEEEEECCCCCCCHHHHHCCCEEECCEEEECCCEEEEEEEC-CCCCEEEEEEEEE
T ss_conf             44799999999862237884159997268997731231025612023267658448999950-5784146789986