HHsearch alignment for GI: 254780758 and conserved domain: smart00849

>smart00849 Lactamase_B Metallo-beta-lactamase superfamily. Apart from the beta-lactamases a number of other proteins contain this domain PUBMED:7588620. These proteins include thiolesterases, members of the glyoxalase II family, that catalyse the hydrolysis of S-D-lactoyl-glutathione to form glutathione and D-lactic acid and a competence protein that is essential for natural transformation in Neisseria gonorrhoeae and could be a transporter involved in DNA uptake. Except for the competence protein these proteins bind two zinc ions per molecule as cofactor.
Probab=99.97  E-value=8.1e-30  Score=193.00  Aligned_cols=177  Identities=28%  Similarity=0.434  Sum_probs=132.6

Q ss_pred             CCCCCEEEEEECCCCEEEEECCCCC-HHHHHHHHHHCCC-CEEEEEECCCCCCCCCCCHHHHHHHCCCEEECCHHHHHHH
Q ss_conf             7657169999889984999838999-9999999997499-7529998698852101105678860795540584389884
Q gi|254780758|r   13 PFKQNCTFLFDEESLEAVVVDPGGD-LDIIKDVIQSRNF-HVKQIWITHGHVDHVGGAAQLKEDLSLTIIGPHKDDAAMM   90 (216)
Q Consensus        13 ~~~~N~~li~~~~~~~~ilID~G~~-~~~i~~~l~~~~~-~i~~Ii~TH~H~DH~gg~~~l~~~~~~~i~~~~~~~~~~~   90 (216)
T Consensus         3 ~~~~n~~li~~~~--~~vliD~G~~~~~~~~~~l~~~~~~~i~~vv~TH~H~DH~gg~~~~~~~~~~~i~~~~~~~~~~-   79 (183)
T smart00849        3 GVGVNSYLVEGDG--GAILIDTGPGEAEDLLAELKKLGPKDIDAIILTHGHPDHIGGLPELLEAPGAPVYAPEGTAELL-   79 (183)
T ss_pred             CCCCEEEEEEECC--EEEEEECCCCHHHHHHHHHHHCCCCCCCEEEECCCCCCHHCHHHHHHHHCCCEEEECHHHHHHH-
T ss_conf             8641899999899--8999929898099999999965998874999899994003309999873299899879999998-


Q ss_pred             CCHHHHHHHHHCCCCCCCCCCEEEECCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHCCCCCCCC--C
Q ss_conf             01234444320023466667418964783997620123310122247210000012343211110000013566346--7
Q gi|254780758|r   91 GKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDI--L  168 (216)
Q Consensus        91 ~~~~~~~~~~~~~~~~~~~~~~~~l~~gd~i~lg~~~~~vi~tPGHt~g~~~~~~~~~~~lftGD~lf~~~~G~~d~--~  168 (216)
T Consensus        80 ~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~pGHt~g~~~~~~~~~~vl~~GD~~~~~~~~~~~~~~~  157 (183)
T smart00849       80 KDLLKL--GGALGAEAPPPPPDRTLKDGEELDLGGLELEVIHTPGHTPGSIVLYLPEGKILFTGDLLFSGGIGRTDDDGG  157 (183)
T ss_pred             HCCHHC--CCCCCCCCCCCCCCEECCCCCEEEECCEEEEEEECCCCCCCCEEEEECCCCEEEEEEEECCCCCCCCCCCCC
T ss_conf             610010--333333467776616728999999899869986468878898999989999999988989798777478999


Q ss_pred             CCCHHHHHHHHHHHHHCCCCCEEEEECC
Q ss_conf             9899999999999985199978998488
Q gi|254780758|r  169 HGDYQQLINSINNKILPLGDEISFVCGH  196 (216)
Q Consensus       169 ~~d~~~~~~sl~~~l~~l~~~~~v~PgH  196 (216)
T Consensus       158 ~~~~~~~~~~l-~~~~~~~~~~-i~pgH  183 (183)
T smart00849      158 DASASDSLESL-LKLLALDPEL-VVPGH  183 (183)
T ss_pred             CHHHHHHHHHH-HHHHCCCCCE-EECCC
T ss_conf             56599999999-9987799999-97797