HHsearch results for GI: 254780758 and protein with PDBid: 2az4_A

>2az4_A Hypothetical protein EF2904; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.00A {Enterococcus faecalis V583} SCOP: d.157.1.10
Probab=99.65  E-value=2.2e-16  Score=113.72  Aligned_cols=139  Identities=13%  Similarity=0.242  Sum_probs=90.0

Q ss_pred             CCCCEEEEEECCCCEEEEECCCCCH--------HHHHHHH-----------------------HHCCCCEEEEEECCCCC
Q ss_conf             6571699998899849998389999--------9999999-----------------------97499752999869885
Q gi|254780758|r   14 FKQNCTFLFDEESLEAVVVDPGGDL--------DIIKDVI-----------------------QSRNFHVKQIWITHGHV   62 (216)
Q Consensus        14 ~~~N~~li~~~~~~~~ilID~G~~~--------~~i~~~l-----------------------~~~~~~i~~Ii~TH~H~   62 (216)
                      .+.||++|..++  ..+|+|+|...        +.+.+..                       .+...++++|++||+|.
T Consensus        18 iGg~~~~i~~~~--~~illD~G~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~i~ai~iTH~H~   95 (429)
T 2az4_A           18 IGGTVIEVAYKD--AHIFFDFGTEFRPELDLPDDHIETLINNRLVPELKDLYDPRLGYEYHGAEDKDYQHTAVFLSHAHL   95 (429)
T ss_dssp             SSCCEEEEEETT--EEEEECCCCCCCTTCCCSCCCHHHHHHTTSSCCCSSCBCGGGCCCCCSSCCCCCSEEEEECSCSCH
T ss_pred             CCCCEEEEEECC--EEEEEECCCCCCCCCCCCCCCHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEECCCHH
T ss_conf             588389999999--089994799977655675411000111234665433335542111001224656665899898717


Q ss_pred             CCCCCCHHHHHHHCCCEEECCHHHHHHHCCHHHHH-HHHHCCCC-CCCCCCEEEECCCCEEEEECCCCCCCCCCCC-CCC
Q ss_conf             21011056788607955405843898840123444-43200234-6666741896478399762012331012224-721
Q gi|254780758|r   63 DHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQA-RLLSIRMN-ARNASSDRWLQDGDTLLLGTHIFKVFHCPGH-SPG  139 (216)
Q Consensus        63 DH~gg~~~l~~~~~~~i~~~~~~~~~~~~~~~~~~-~~~~~~~~-~~~~~~~~~l~~gd~i~lg~~~~~vi~tPGH-t~g  139 (216)
                      ||+|+++.+..  ..++|++......+ ....... ........ .........++.++.+.+|+.+++++++ +| .||
T Consensus        96 DH~g~l~~l~~--~~piy~~~~t~~l~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~v~~~~~-~Hsi~g  171 (429)
T 2az4_A           96 DHSRMINYLDP--AVPLYTLKETKMIL-NSLNRKGDFLIPSPFEEKNFTREMIGLNKNDVIKVGEISVEIVPV-DHDAYG  171 (429)
T ss_dssp             HHHTTGGGBCT--TSCEEEEHHHHHHH-HHHTTTSCSSCCCTTSCTTCCCCCEEECTTCEEEETTEEEEEEEC-CCSSTT
T ss_pred             HHHCCHHHHHH--CCCEEECHHHHHHH-HHHHHHHCCCCCCHHHHCCCCCEEEEECCCCEEEECCEEEEEEEC-CCCCCC
T ss_conf             26585256761--69765279999999-998764000123402221554315995899969977779999856-678887


Q ss_pred             CCCCCC--CCCCCCCCCCHHH
Q ss_conf             000001--2343211110000
Q gi|254780758|r  140 HVIYVN--FENNFAHLGDTLF  158 (216)
Q Consensus       140 ~~~~~~--~~~~~lftGD~lf  158 (216)
                      +++|.+  ++.+++||||.-|
T Consensus       172 s~~~~i~~~~~~i~ytGD~~~  192 (429)
T 2az4_A          172 ASALLIRTPDHFITYTGDLRL  192 (429)
T ss_dssp             CEEEEEEETTEEEEECCSCCS
T ss_pred             CEEEEEECCCCEEEECCCEEE
T ss_conf             548998246745885465131