HHsearch results for GI: 254780758 and protein with PDBid: 2r2d_A

>2r2d_A AGR_PTI_140P, Zn-dependent hydrolases; lactonase, N-acyl hompserine lactone, DI-nuclear zinc center, quorum quenching, AIIB, phosphate; HET: PO4; 1.75A {Agrobacterium tumefaciens}
Probab=99.92  E-value=9.2e-26  Score=168.20  Aligned_cols=191  Identities=14%  Similarity=0.163  Sum_probs=111.1

Q ss_pred             CCEEEEEECCCCEEEEECCCCCH------------------------HHHHHHHHHCCCC---EEEEEECCCCCCCCCCC
Q ss_conf             71699998899849998389999------------------------9999999974997---52999869885210110
Q gi|254780758|r   16 QNCTFLFDEESLEAVVVDPGGDL------------------------DIIKDVIQSRNFH---VKQIWITHGHVDHVGGA   68 (216)
Q Consensus        16 ~N~~li~~~~~~~~ilID~G~~~------------------------~~i~~~l~~~~~~---i~~Ii~TH~H~DH~gg~   68 (216)
                      .|||||..+++  .+|||||...                        +.+.+.|++.|++   |++|++||.|+||+||+
T Consensus        43 v~~~LI~~~~g--~iLvDtG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~L~~~G~~p~dI~~VilTH~H~DH~Ggl  120 (276)
T 2r2d_A           43 VSAYLIQCTDA--TVLYDTGCHPECMGTNGRWPAQSQLNAPYIGASECNLPERLRQLGLSPDDISTVVLSHLHNDHAGCV  120 (276)
T ss_dssp             EEEEEEECSSC--EEEECCCSCTTCSSTTCSSCHHHHHHSCBCCCTTCSHHHHHHHTTCCGGGCSEEECSCCSTTTSTTG
T ss_pred             EEEEEEEECCE--EEEEECCCCHHHHCCCCCCCCHHHHCCCCCCCCHHHHHHHHHHCCCCHHHCCEEECCCCCCCCCCCC
T ss_conf             58999994990--4999578884551243334302221155456532029999998399979998998479960423741


Q ss_pred             HHHHHHHCCCEEECCHHHHHHHCCHHHHH--H-HH--HCCC-CCCCCCCEEEECCCCEEEEECCCCCCCCCCCCCCCCCC
Q ss_conf             56788607955405843898840123444--4-32--0023-46666741896478399762012331012224721000
Q gi|254780758|r   69 AQLKEDLSLTIIGPHKDDAAMMGKVDEQA--R-LL--SIRM-NARNASSDRWLQDGDTLLLGTHIFKVFHCPGHSPGHVI  142 (216)
Q Consensus        69 ~~l~~~~~~~i~~~~~~~~~~~~~~~~~~--~-~~--~~~~-~~~~~~~~~~l~~gd~i~lg~~~~~vi~tPGHt~g~~~  142 (216)
                      +.|.   +++++++..+-...........  . ..  .... ............+.....+++-...++.+|||||||++
T Consensus       121 ~~f~---~a~i~~~~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~G~~~~~~~pGHTpGh~~  197 (276)
T 2r2d_A          121 EYFG---KSRLIAHEDEFATAVRYFATGDHSSPYIVKDIEAWLATPRNWDLVGRDERERELAPGVNLLNFGTGHASGMLG  197 (276)
T ss_dssp             GGCS---SSEEEEEHHHHHHHHHHHHTTCCSSSSCHHHHHHHTTSCCCEEEECTTCCEEEEETTEEEEEEESSSSSSEEE
T ss_pred             CCCC---CCCCCCCHHHHHHHHHCCCCCCCCCCCCHHHHHHHCCCCCCCCEEECCCCCEEEECCEEEEECCCCCCCCCEE
T ss_conf             3578---6300038999998640123443345300455433104444565551268825970997886688998710689


Q ss_pred             CCCC---CCCCCCCCCHHHHC-CCCCCC---CCCCCHHHHHHHHHHHHHCCC--CCEEEEECCCCCCCHHHHHHHCHHH
Q ss_conf             0012---34321111000001-356634---679899999999999985199--9789984887988889998828145
Q gi|254780758|r  143 YVNF---ENNFAHLGDTLFRS-SIGRTD---ILHGDYQQLINSINNKILPLG--DEISFVCGHGPNSTIGRERRLNPFL  212 (216)
Q Consensus       143 ~~~~---~~~~lftGD~lf~~-~~G~~d---~~~~d~~~~~~sl~~~l~~l~--~~~~v~PgHG~~tt~~~e~~~n~~~  212 (216)
                      +++.   +.+++|+||+++.. ++.+..   ....|..++.+|++ +++.+.  ....|+|||+|..--..+|..+.|+
T Consensus       198 ~~v~~~~~~~vl~~GD~~~~~~~~~~~~~~~~~~~d~~~~~~sl~-~l~~l~~~~~~~vipgHd~~~~~~~~k~~~~~y  275 (276)
T 2r2d_A          198 LAVRLEKQPGFLLVSDACYTATNYGPPARRAGVLHDTIGYDRTVS-HIRQYAESRSLTVLFGHDREQFASLIKSTDGFY  275 (276)
T ss_dssp             EEEECSSSCEEEEEETTSCCHHHHSSSCCCCSSCSCHHHHHHHHH-HHHHHHHHTTCEEEESSCHHHHHHSCCTTTCCB
T ss_pred             EEEEECCCCEEEEEECCCCCHHHCCCCCCCCCCCCCHHHHHHHHH-HHHHHHHCCCCEEEECCCHHHHHHHHHCCCCCC
T ss_conf             999957999799995864617552898887766689999999999-999663358988993849899878861567777