HHsearch results for GI: 254780758 and protein with PDBid: 2wyl_A

>2wyl_A L-ascorbate-6-phosphate lactonase ULAG; hydrolase; 2.59A {Escherichia coli} PDB: 2wym_A*
Probab=98.52  E-value=2.6e-07  Score=61.06  Aligned_cols=134  Identities=16%  Similarity=0.157  Sum_probs=64.7

Q ss_pred             CCCCCCEEEEEECCCCEEEEECCCC--------CH--HH---HHHHHHH----------------CCC-CEEEEEECCCC
Q ss_conf             8765716999988998499983899--------99--99---9999997----------------499-75299986988
Q gi|254780758|r   12 TPFKQNCTFLFDEESLEAVVVDPGG--------DL--DI---IKDVIQS----------------RNF-HVKQIWITHGH   61 (216)
Q Consensus        12 ~~~~~N~~li~~~~~~~~ilID~G~--------~~--~~---i~~~l~~----------------~~~-~i~~Ii~TH~H   61 (216)
                      ..+++++++|... ++..+||||=.        ..  ..   .......                ..+ +|++|++||.|
T Consensus        41 ~WLG~s~~~i~~~-~g~~IliDP~ls~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~R~~p~~idp~~L~~IDaVLiTH~H  119 (360)
T 2wyl_A           41 WWLGCTGIWLKSE-GGTNVCVDFWCGTGKQSHGNPLMKQGHQMQRMAGVKKLQPNLRTTPFVLDPFAIRQIDAVLATHDH  119 (360)
T ss_dssp             EEEETTEEEEECT-TCCEEEESCCCCCCCCCCCC----------------CCCCCCBCSCCCCCGGGCCCCSEEECSBSC
T ss_pred             EEECCCEEEEECC-CCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHCCCCCEEEECCCC
T ss_conf             9945758999906-991999868878877766665555321111235543457755557898896888888899979996


Q ss_pred             CCCCCCCHH--HHHHH--CCCEEECCHHHHHHHCCHHHHHHHHHCCCCCCCCCCEEEECCCCEEEEECCCCCCCCC----
Q ss_conf             521011056--78860--7955405843898840123444432002346666741896478399762012331012----
Q gi|254780758|r   62 VDHVGGAAQ--LKEDL--SLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFKVFHC----  133 (216)
Q Consensus        62 ~DH~gg~~~--l~~~~--~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~gd~i~lg~~~~~vi~t----  133 (216)
                      .||++....  +.+..  .++++++......+ ...       +     ........+..|+.+.+++.++.++.+    
T Consensus       120 ~DHld~~~l~~~~~~~~~~~~~~gP~~~~~~l-~~~-------g-----~~~~~i~~~~~g~~~~v~~~~i~~~~~~~~~  186 (360)
T 2wyl_A          120 NDHIDVNVAAAVMQNCADDVPFIGPKTCVDLW-IGW-------G-----VPKERCIVVKPGDVVKVKDIEIHALDAFDRT  186 (360)
T ss_dssp             TTTCCHHHHHHHHHHSCTTCCEEECHHHHHHH-HHH-------T-----CCGGGEEECCTTCEEEETTEEEEEEECCCC-
T ss_pred             HHHCCCHHHHHHHHCCCCCCEEECCHHHHHHH-HHC-------C-----CCHHHEEEECCCCEEEEECCEEEEEEEEEEE
T ss_conf             02178099999985476774386588999999-866-------9-----9655157605786577402135776314555


Q ss_pred             -----C-CC----------CCCCCCCCC--CCCCCCCCCCHHHH
Q ss_conf             -----2-24----------721000001--23432111100000
Q gi|254780758|r  134 -----P-GH----------SPGHVIYVN--FENNFAHLGDTLFR  159 (216)
Q Consensus       134 -----P-GH----------t~g~~~~~~--~~~~~lftGD~lf~  159 (216)
                           | .|          ....+.|.+  ++.++.|+||+-+.
T Consensus       187 ~~~~~p~~~~~~~~~~~~~~~~~~g~~ie~~g~tIy~sGDT~~~  230 (360)
T 2wyl_A          187 ALITLPADQKAAGVLPDGMDDRAVNYLFKTPGGSLYHSGDSHYS  230 (360)
T ss_dssp             -----------------CCTTTBEEEEEEETTEEEEECTTCCCC
T ss_pred             EEEECCCCCCCCCCCCCCCCCCEEEEEEECCCCEEEEECCCCCC
T ss_conf             56642664446665577787740489997199189992698866