HHsearch results for GI: 254780758 and protein with PDBid: 2zwr_A

>2zwr_A Metallo-beta-lactamase superfamily protein; hydrolase; 2.20A {Thermus thermophilus} PDB: 2zzi_A
Probab=100.00  E-value=0  Score=304.36  Aligned_cols=202  Identities=34%  Similarity=0.517  Sum_probs=171.0

Q ss_pred             CEEEEEECCCCCCCEEEEEECCCCEEEEECCCCCHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCHHHHHHHCCCEEECC
Q ss_conf             35999970876571699998899849998389999999999997499752999869885210110567886079554058
Q gi|254780758|r    4 LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLKEDLSLTIIGPH   83 (216)
Q Consensus         4 ~~~~~i~v~~~~~N~~li~~~~~~~~ilID~G~~~~~i~~~l~~~~~~i~~Ii~TH~H~DH~gg~~~l~~~~~~~i~~~~   83 (216)
                      |++..+++||+++|||+|.++  ++++|||||.+.+.+++.+++.+.++++|++||.|+||++|+.+|++++++.++...
T Consensus         1 m~i~~~~~Gp~~~N~ylI~~~--~~~ilID~G~~~~~~~~~l~~~~~~~~~vi~TH~H~DH~~g~~~l~~~~~~~~~~~~   78 (207)
T 2zwr_A            1 MRVFPVTLGPLQENAYLVETG--EGPVLIDPGDEPEKLLALFQTTGLIPLAILLTHAHFDHVGAVAPLVEALDLPVYLHP   78 (207)
T ss_dssp             CEEEEEEETTTTEEEEEEEET--TEEEEECCCSCHHHHHHHHHHHTCCCSCEECSCCCGGGTTTHHHHHHHHCCCEEECG
T ss_pred             CEEEEEEECCHHCEEEEEEEC--CEEEEEECCCCHHHHHHHHHHCCCCCEEEEECCCCHHHHCCHHHHHHHHCCCEEECC
T ss_conf             989999708811889999989--989999498699999999998799724999799976675219999998699489613


Q ss_pred             HHHHHHHCCHHHHHHHHHCCCCCCCCCCEEEECCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHCCCC
Q ss_conf             43898840123444432002346666741896478399762012331012224721000001234321111000001356
Q gi|254780758|r   84 KDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIG  163 (216)
Q Consensus        84 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~gd~i~lg~~~~~vi~tPGHt~g~~~~~~~~~~~lftGD~lf~~~~G  163 (216)
                      .+.... ............ ...........+++++.+    ..++++++||||+||+++|++++++||+||.++.++++
T Consensus        79 ~~~~~~-~~~~~~~~~~~~-~~~~~~~~~~~~~~g~~~----~~~~vi~~PGHt~g~~~~~~~~~~~lf~GD~~~~~~~~  152 (207)
T 2zwr_A           79 LDLPLY-EGADLAARAWGL-AIPKPPLPVRPLEEGMRL----FGFQVLHLPGHSPGHVAFYDPEGAQVFSGDLLFRGSVG  152 (207)
T ss_dssp             GGHHHH-HTHHHHHHHTTC-CCCCCCSCCEECCTTCEE----TTEEEEECCSSSTTCEEEEETTTTEEEEETSEETTEEC
T ss_pred             CCCCCC-CCCHHHHHCCCC-CCCCCCCCCCCCCCCCEE----EEEEEECCCCCCCCCEEEEECCCCEEEECCEECCCCCC
T ss_conf             322000-362022101364-323675430002245157----77998324887878479998778988863570368845


Q ss_pred             CCCCCCCCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHCHHHHC
Q ss_conf             634679899999999999985199978998488798888999882814514
Q gi|254780758|r  164 RTDILHGDYQQLINSINNKILPLGDEISFVCGHGPNSTIGRERRLNPFLKS  214 (216)
Q Consensus       164 ~~d~~~~d~~~~~~sl~~~l~~l~~~~~v~PgHG~~tt~~~e~~~n~~~~~  214 (216)
                      +.+++++|..+|++|| +|+++|+++++|+|||||+||+++||++|||||.
T Consensus       153 ~~~~~~~d~~~~~~sl-~kl~~l~~~~~i~PGHG~~tt~g~e~~~n~~l~~  202 (207)
T 2zwr_A          153 RYDLPGADPKALFASL-KRLLSLPPETRVHPGHGPGTTLGLEARTNPFLTG  202 (207)
T ss_dssp             CSSSTTCCHHHHHHHH-HHHTTSCTTCEEEESBSCCEEHHHHHHHCTTC--
T ss_pred             CCCCCCCCHHHHHHHH-HHHHCCCCCEEEECCCCCCCCHHHHHHHCCCCCC
T ss_conf             6567788999999999-9997589986999999986428999854902384