HHsearch results for GI: 254780758 and protein with PDBid: 3bv6_A

>3bv6_A Metal-dependent hydrolase; metallo protein, beta-lactamase like fold, MCSG, structural genomics, PSI-2; 1.80A {Vibrio cholerae o1 biovar eltor str}
Probab=98.67  E-value=1.5e-08  Score=68.23  Aligned_cols=169  Identities=17%  Similarity=0.144  Sum_probs=86.0

Q ss_pred             CCCCCCEEEEEECCCCEEEEECCCC----C--------H-HHHHHHH---------HH-------CCC-CEEEEEECCCC
Q ss_conf             8765716999988998499983899----9--------9-9999999---------97-------499-75299986988
Q gi|254780758|r   12 TPFKQNCTFLFDEESLEAVVVDPGG----D--------L-DIIKDVI---------QS-------RNF-HVKQIWITHGH   61 (216)
Q Consensus        12 ~~~~~N~~li~~~~~~~~ilID~G~----~--------~-~~i~~~l---------~~-------~~~-~i~~Ii~TH~H   61 (216)
                      ..++.++++|...+ +..++||+=.    .        . .......         +.       ..+ ++++|++||.|
T Consensus        65 ~WLGhag~~i~~~g-~t~iliDp~~~~~~~~~~~~~~~~~~~~~r~~g~~~~~p~~R~~p~~idp~~L~~IDaVLITH~H  143 (379)
T 3bv6_A           65 WWLGCTGIWLKSAG-NTNLSIDFWCGTGKKTQKNRLMNTQHQMMRMGGVEALQPNLRTSIFPLDPFAIKEIDAVLASHDH  143 (379)
T ss_dssp             EEEETTEEEEEETT-CCEEEESCCCCCCCCCSSCCBCCTTCHHHHHHCCCBCCCCCBCSCCCSCGGGCCCCSEEECSBCS
T ss_pred             EECCCCEEEEEECC-CCEEEECCCCCCCCCCCCCCCCCCCCHHHHCCCCCCCCCCCCCCCCCCCHHHCCCCCEEEECCCC
T ss_conf             98024689999789-73899899578887665544456421011024544468754557898896897998889989997


Q ss_pred             CCCCCC--CHHHHHHHC--CCEEECCHHHHHHHCCHHHHHHHHHCCCCCCCCCCEEEECCCCEEEEECCCCCCCCCC---
Q ss_conf             521011--056788607--9554058438988401234444320023466667418964783997620123310122---
Q gi|254780758|r   62 VDHVGG--AAQLKEDLS--LTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFKVFHCP---  134 (216)
Q Consensus        62 ~DH~gg--~~~l~~~~~--~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~gd~i~lg~~~~~vi~tP---  134 (216)
                      .||++.  +..+.++.+  ++++++......+ ..       .+     .+......+..|+++++++.+++++++-   
T Consensus       144 ~DHlD~~tl~~i~~~~~~~~~~igP~~~~~~l-~~-------~g-----vp~~~ii~l~~gd~~~i~~i~I~~~pa~H~~  210 (379)
T 3bv6_A          144 ADHIDVNVAAAVLQNCGEHVKFIGPQACVDLW-LG-------WG-----VPQERCIVAKVGDVLEIGDVKIRVLDSFDRT  210 (379)
T ss_dssp             GGGCCHHHHHHHHHHSCTTCEEEECHHHHHHH-HH-------HT-----CCGGGEEECCTTCEEEETTEEEEEEECCCHH
T ss_pred             CCCCCHHHHHHHHHCCCCCEEEECCHHHHHHH-HH-------CC-----CCHHHEEEECCCCEEEECCEEEEEEEEECCC
T ss_conf             11179699999985079745998378999999-87-------59-----9667668814787289877799999435365


Q ss_pred             -------CCCCC-----------CCCCCC--CCCCCCCCCCHHHHCC---CC---CCCC---C----------CCCHHHH
Q ss_conf             -------24721-----------000001--2343211110000013---56---6346---7----------9899999
Q gi|254780758|r  135 -------GHSPG-----------HVIYVN--FENNFAHLGDTLFRSS---IG---RTDI---L----------HGDYQQL  175 (216)
Q Consensus       135 -------GHt~g-----------~~~~~~--~~~~~lftGD~lf~~~---~G---~~d~---~----------~~d~~~~  175 (216)
                             +|...           .++|.+  ++.++.|+||+.+...   +|   +.|+   +          .-++.+.
T Consensus       211 ~~~~~p~~~~~~~~~~~~~~~~~~~gylIe~~g~~Iy~sGDT~~~~~~~~ig~~~~iDvall~iG~~~~~~~~hmt~~eA  290 (379)
T 3bv6_A          211 ALVTLPKGVSSYDKAILDGMDERAVNYLIETSGGSVYHSGDSHYSNYYAKHGNDYQIDVALLSYGENPRGVTDKMTSSDV  290 (379)
T ss_dssp             HHTCCCTTSCSSCGGGGGCHHHHBEEEEEEETTEEEEECTTCCCCTTHHHHHHHSCCSEEEEEBCCCCTTCCCSBCHHHH
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCEEEEECCCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCHHHH
T ss_conf             10014776444676666688765316889719938999679996478999886479989997888888777668899999


Q ss_pred             HHHHHHHHHCCCCCEEEEECCCCC
Q ss_conf             999999985199978998488798
Q gi|254780758|r  176 INSINNKILPLGDEISFVCGHGPN  199 (216)
Q Consensus       176 ~~sl~~~l~~l~~~~~v~PgHG~~  199 (216)
                      .+    ....+.+++ ++|-|=..
T Consensus       291 ~~----aa~~l~~k~-vIP~H~d~  309 (379)
T 3bv6_A          291 LR----AAESLDCQV-VVPFHHDI  309 (379)
T ss_dssp             HH----HHHHHTCSE-EEEESTTS
T ss_pred             HH----HHHHCCCCE-EEEECCCC
T ss_conf             99----999709999-99966345