BLAST/PSIBLAST alignment of GI: 254780758 and GI: 150397440 at iteration 1
>gi|150397440|ref|YP_001327907.1| beta-lactamase domain-containing protein [Sinorhizobium medicae WSM419] Length = 213
>gi|150028955|gb|ABR61072.1| beta-lactamase domain protein [Sinorhizobium medicae WSM419] Length = 213
 Score =  263 bits (672), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 117/211 (55%), Positives = 152/211 (72%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L   I+ VT F+QNCT LFD ES E VVVDPGGD+DII   ++     +K IW+THGH+D
Sbjct: 2   LQAGIIPVTHFEQNCTVLFDSESKEGVVVDPGGDVDIILQTVRENGILLKAIWLTHGHID 61

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GGA +LKE L L I+GPHK D  ++ ++++QA    + M  +N   DRWL+DGDT+  
Sbjct: 62  HAGGAKELKEALGLEIVGPHKADLPLLERLEDQAERFGLAMKVQNVVPDRWLEDGDTVSF 121

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G H+F+V HCPGH+PGHV+Y N    FAH+GD LF  SIGRTD+  G++QQL++SI +KI
Sbjct: 122 GDHLFEVLHCPGHAPGHVVYFNRAQKFAHVGDVLFHGSIGRTDLPGGNHQQLLDSIRDKI 181

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           LPLGDE+ F+CGHGP   +G ERR NPFL+ 
Sbjct: 182 LPLGDEVGFICGHGPGGQVGEERRSNPFLRG 212