BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780758|ref|YP_003065171.1| hypothetical protein
CLIBASIA_03225 [Candidatus Liberibacter asiaticus str. psy62]
         (216 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780758|ref|YP_003065171.1| hypothetical protein CLIBASIA_03225 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040435|gb|ACT57231.1| hypothetical protein CLIBASIA_03225 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 216

 Score =  445 bits (1145), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 216/216 (100%), Positives = 216/216 (100%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG
Sbjct: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT
Sbjct: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN
Sbjct: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           NKILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI
Sbjct: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216


>gi|315121921|ref|YP_004062410.1| hypothetical protein CKC_00855 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495323|gb|ADR51922.1| hypothetical protein CKC_00855 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 216

 Score =  394 bits (1013), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 185/216 (85%), Positives = 202/216 (93%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           MSKLSF+ ++VTPFKQNCTFLFDEESLEAVV+DPGGDLD IKDVI+SRNF VKQIWITHG
Sbjct: 1   MSKLSFYSLKVTPFKQNCTFLFDEESLEAVVIDPGGDLDRIKDVIKSRNFRVKQIWITHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DHVGGAAQLKEDLSL IIGPHKDDA MM  V+EQA+LLS+ MN RN SSD WLQDGD+
Sbjct: 61  HIDHVGGAAQLKEDLSLQIIGPHKDDAMMMNNVEEQAKLLSVCMNERNTSSDHWLQDGDS 120

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           + +G H+FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFR SIG+TDILHG+YQQL+NSIN
Sbjct: 121 VSVGKHVFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRDSIGKTDILHGNYQQLMNSIN 180

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           NKILPLGDEISFVCGHGPNSTIGRERRLNPFLKSN+
Sbjct: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNM 216


>gi|163761577|ref|ZP_02168648.1| putative beta-lactamase family protein [Hoeflea phototrophica
           DFL-43]
 gi|162281173|gb|EDQ31473.1| putative beta-lactamase family protein [Hoeflea phototrophica
           DFL-43]
          Length = 215

 Score =  267 bits (682), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 119/213 (55%), Positives = 152/213 (71%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M  L   I+ VTPF+QNCT LFDE++   VV+DPGGD+D+I   I      ++ IW+THG
Sbjct: 1   MGNLRAGIIPVTPFQQNCTVLFDEDTKSGVVIDPGGDVDVILQTISENGLTIEAIWLTHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DH GGA +L E L + IIGPHKDD  ++  +++QAR+  + M  RN + D+WL+DG+ 
Sbjct: 61  HIDHAGGADELCETLGVKIIGPHKDDVPLLSGLEDQARMFGLDMEVRNVTPDQWLEDGEK 120

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           +  G H F+V+H PGH+PGHVIY N    FAHLGD LF  SIGRTD+  GD+Q LINSI 
Sbjct: 121 VSFGAHEFEVYHTPGHAPGHVIYFNRAQGFAHLGDVLFAGSIGRTDLPGGDHQTLINSIR 180

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           +K+LPLGDEI F+CGHGP   IG ERR NPFLK
Sbjct: 181 DKVLPLGDEIGFICGHGPGGKIGDERRTNPFLK 213


>gi|227822823|ref|YP_002826795.1| metallo-beta-lactamase family protein [Sinorhizobium fredii NGR234]
 gi|227341824|gb|ACP26042.1| metallo-beta-lactamase family protein [Sinorhizobium fredii NGR234]
          Length = 213

 Score =  266 bits (680), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 118/211 (55%), Positives = 152/211 (72%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L   I+ VT F+QNCT LFD E+ E V+VDPGGD+D+I   I+     +K IW+THGH+D
Sbjct: 2   LQAGIIPVTHFQQNCTVLFDSETKEGVIVDPGGDVDVILQTIRENGLALKAIWLTHGHID 61

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GGA +LKE L L IIGPHKDD  ++ +++ QA    + M  +N   DRWL DGDT+  
Sbjct: 62  HAGGAKELKEALGLEIIGPHKDDLPLLERLESQAERFGLAMKVQNVLPDRWLNDGDTVSF 121

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G H+F+V HCPGH+PGHV+Y N   NFAH+GD LF  SIGRTD+  GD+QQL++SI +KI
Sbjct: 122 GDHVFEVLHCPGHAPGHVVYFNRAQNFAHVGDVLFHGSIGRTDLPGGDHQQLLDSIRDKI 181

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           LPLGD++ F+CGHGP   IG ERR NP+L+ 
Sbjct: 182 LPLGDDVGFICGHGPGGRIGEERRTNPYLRG 212


>gi|15966085|ref|NP_386438.1| hypothetical protein SMc01587 [Sinorhizobium meliloti 1021]
 gi|307305639|ref|ZP_07585386.1| beta-lactamase domain protein [Sinorhizobium meliloti BL225C]
 gi|307317642|ref|ZP_07597081.1| beta-lactamase domain protein [Sinorhizobium meliloti AK83]
 gi|15075355|emb|CAC46911.1| Conserved hypothetical protein [Sinorhizobium meliloti 1021]
 gi|306896800|gb|EFN27547.1| beta-lactamase domain protein [Sinorhizobium meliloti AK83]
 gi|306902342|gb|EFN32938.1| beta-lactamase domain protein [Sinorhizobium meliloti BL225C]
          Length = 213

 Score =  265 bits (677), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 118/211 (55%), Positives = 153/211 (72%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L   I+ VT F+QNCT LFD E+ E VVVDPGGD+DII   I+     +K IW+THGH+D
Sbjct: 2   LQAGIIPVTHFEQNCTVLFDSETKEGVVVDPGGDVDIILQTIRENGIALKAIWLTHGHID 61

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GGA +LKE L L I+GPHKDD  ++ ++++QA    + M  +N   DRWL++GDT+  
Sbjct: 62  HAGGAKELKEALGLDIVGPHKDDLPLLERLEDQAERFGLAMKVQNVVPDRWLEEGDTVSF 121

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G H+F+V HCPGH+PGHV+Y N   NFAH+GD LF  SIGRTD+  G++QQL++SI +KI
Sbjct: 122 GDHVFEVLHCPGHAPGHVVYFNRAQNFAHVGDVLFHGSIGRTDLPGGNHQQLLDSIRDKI 181

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           LPLGD + F+CGHGP   IG ERR NPFL+ 
Sbjct: 182 LPLGDNVGFICGHGPGGQIGEERRTNPFLRG 212


>gi|325293561|ref|YP_004279425.1| hydrolase [Agrobacterium sp. H13-3]
 gi|325061414|gb|ADY65105.1| probable hydrolase [Agrobacterium sp. H13-3]
          Length = 222

 Score =  263 bits (673), Expect = 9e-69,   Method: Compositional matrix adjust.
 Identities = 115/214 (53%), Positives = 157/214 (73%), Gaps = 1/214 (0%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M KL   I+ VTPF+QNCT LFDE++ E VVVDPGGD+D+I  V+      +K+IW+THG
Sbjct: 9   MGKLQAGIIPVTPFEQNCTILFDEDTKEGVVVDPGGDVDVILQVVSENGITLKEIWLTHG 68

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DH GGA +L+E LSL +IGPH+DD  ++ +++ QA    I    +N   DRWL +GDT
Sbjct: 69  HLDHAGGAKELREKLSLPVIGPHEDDRPLLERIETQAEKYGIS-GLQNVLPDRWLNEGDT 127

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           +  G H+F+V+HCPGH+PGHVIY N +  FAH+GD LF  S+GRTD+  G+++QL+ SI 
Sbjct: 128 VSFGDHVFEVYHCPGHAPGHVIYYNRDQQFAHVGDVLFAGSVGRTDLPGGNHEQLMASIR 187

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           +K+LPLGD++ F+CGHGP   +G ERR NP+LK 
Sbjct: 188 DKLLPLGDDVGFICGHGPGGRLGEERRTNPYLKG 221


>gi|150397440|ref|YP_001327907.1| beta-lactamase domain-containing protein [Sinorhizobium medicae
           WSM419]
 gi|150028955|gb|ABR61072.1| beta-lactamase domain protein [Sinorhizobium medicae WSM419]
          Length = 213

 Score =  263 bits (672), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 117/211 (55%), Positives = 152/211 (72%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L   I+ VT F+QNCT LFD ES E VVVDPGGD+DII   ++     +K IW+THGH+D
Sbjct: 2   LQAGIIPVTHFEQNCTVLFDSESKEGVVVDPGGDVDIILQTVRENGILLKAIWLTHGHID 61

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GGA +LKE L L I+GPHK D  ++ ++++QA    + M  +N   DRWL+DGDT+  
Sbjct: 62  HAGGAKELKEALGLEIVGPHKADLPLLERLEDQAERFGLAMKVQNVVPDRWLEDGDTVSF 121

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G H+F+V HCPGH+PGHV+Y N    FAH+GD LF  SIGRTD+  G++QQL++SI +KI
Sbjct: 122 GDHLFEVLHCPGHAPGHVVYFNRAQKFAHVGDVLFHGSIGRTDLPGGNHQQLLDSIRDKI 181

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           LPLGDE+ F+CGHGP   +G ERR NPFL+ 
Sbjct: 182 LPLGDEVGFICGHGPGGQVGEERRSNPFLRG 212


>gi|222086575|ref|YP_002545109.1| hydrolase protein [Agrobacterium radiobacter K84]
 gi|221724023|gb|ACM27179.1| hydrolase protein [Agrobacterium radiobacter K84]
          Length = 214

 Score =  258 bits (660), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 116/214 (54%), Positives = 154/214 (71%), Gaps = 1/214 (0%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M  L   I+ VTPF+QNCT LFD E+ E VVVDPGGD+D+I   ++  N  +K IW+THG
Sbjct: 1   MGMLQAGIIPVTPFEQNCTILFDPETNEGVVVDPGGDVDLILQTVRENNITLKAIWLTHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DH GGA +++E L L +IGPH+DD +++  ++ +A +  I    RN   DR+L+DGD 
Sbjct: 61  HIDHAGGADEVREALGLEVIGPHEDDLSLLQDIEGKAEMFGIE-GVRNVVPDRFLKDGDK 119

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           +  G H F+VFHCPGH+PGHVIYVN    FAHLGD LF  SIGRTD+  G++QQL++SI 
Sbjct: 120 VSFGEHEFEVFHCPGHAPGHVIYVNRTQKFAHLGDVLFHGSIGRTDLPGGNHQQLLDSIR 179

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           +K+ PLGD++ F+CGHGP   IG ERR NPFL+ 
Sbjct: 180 DKVFPLGDDVGFICGHGPGGQIGEERRTNPFLRG 213


>gi|116253200|ref|YP_769038.1| beta-lactamase family protein [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115257848|emb|CAK08946.1| putative beta-lactamase family protein [Rhizobium leguminosarum bv.
           viciae 3841]
          Length = 214

 Score =  255 bits (652), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 115/214 (53%), Positives = 152/214 (71%), Gaps = 1/214 (0%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M  L   I+ VTPF+QNCT  FD ++ E VVVDPGGD+ +I   I      +K+IW+THG
Sbjct: 1   MGMLQAGIIPVTPFQQNCTIFFDPDTKEGVVVDPGGDVPLILQAITQNGLTIKEIWLTHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DH GGA++LKE L + ++GPH+DD  ++ +++ QA    I    R+   DRWL+DGD 
Sbjct: 61  HLDHAGGASELKEALGIDVVGPHQDDLPLLQRIETQAEKYGIS-GLRDVVPDRWLKDGDK 119

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           +  G H F+V+H PGH+PGHVIY N   NFAHLGD LF  SIGRTD+  G++QQL++SI 
Sbjct: 120 ISFGAHEFEVYHTPGHAPGHVIYFNRAQNFAHLGDVLFNGSIGRTDLPGGNHQQLLDSIR 179

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           +K+LPLGD++ F+CGHGP S IG ERR NPFLK 
Sbjct: 180 DKVLPLGDDVGFICGHGPGSRIGDERRSNPFLKE 213


>gi|15889480|ref|NP_355161.1| hydrolase [Agrobacterium tumefaciens str. C58]
 gi|15157350|gb|AAK87946.1| hydrolase [Agrobacterium tumefaciens str. C58]
          Length = 214

 Score =  255 bits (651), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 112/214 (52%), Positives = 156/214 (72%), Gaps = 1/214 (0%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M KL   I+ VTPF+QNCT LFD+++ E VVVDPGGD+D+I  V+      +K IW+THG
Sbjct: 1   MGKLQAGIIPVTPFEQNCTILFDQDTKEGVVVDPGGDVDVILQVVAENGITLKAIWLTHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DH GGA +L+E LSL++IGPH+ D  ++ +++ QA+   I    +N   D WL+DGD 
Sbjct: 61  HLDHAGGADELREKLSLSVIGPHEHDRPLLERIEVQAQKYGIS-GLKNVEPDSWLKDGDK 119

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           +  G H+F+V+HCPGH+PGHVIY N + NFAH+GD LF  S+GRTD+  G+++QL+ SI 
Sbjct: 120 VSFGDHVFEVYHCPGHAPGHVIYYNRDQNFAHVGDVLFSGSVGRTDLPGGNHEQLMASIR 179

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           +K+LPLGD++ F+CGHGP   +G ER  NP+LK 
Sbjct: 180 DKLLPLGDDVGFICGHGPGGRLGEERLNNPYLKG 213


>gi|209550332|ref|YP_002282249.1| beta-lactamase [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|209536088|gb|ACI56023.1| beta-lactamase domain protein [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 217

 Score =  255 bits (651), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 115/214 (53%), Positives = 152/214 (71%), Gaps = 1/214 (0%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M  L   ++ VTPF+QNCT  FD E+ E VVVDPGGD+ +I   I      +K+IW+THG
Sbjct: 1   MGMLQAGVIPVTPFQQNCTIFFDPETKEGVVVDPGGDVPLILQAIAQNGLIIKEIWLTHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DH GGA++LKE L + ++GPH+DD  ++ +++ QA    I    RN   DRWL+DGD 
Sbjct: 61  HLDHAGGASELKEALGIDVVGPHQDDLPLLQRIETQAEKYGIS-GLRNVLPDRWLKDGDK 119

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           +  G H F+V+H PGH+PGHVIY N   NFAHLGD LF  SIGRTD+  G++QQL++SI 
Sbjct: 120 ISFGDHEFEVYHAPGHAPGHVIYFNRAQNFAHLGDVLFNGSIGRTDLPGGNHQQLLDSIR 179

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           +K+LPLGD++ F+CGHGP S IG ERR NPFL+ 
Sbjct: 180 DKVLPLGDDVGFICGHGPGSRIGDERRSNPFLQE 213


>gi|190892755|ref|YP_001979297.1| hydrolase [Rhizobium etli CIAT 652]
 gi|190698034|gb|ACE92119.1| putative hydrolase protein [Rhizobium etli CIAT 652]
          Length = 229

 Score =  254 bits (650), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 117/214 (54%), Positives = 151/214 (70%), Gaps = 1/214 (0%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M  L   I+ VTPF+QNCT  FD E+ E VVVDPGGD+ +I   I+     +K+IW+THG
Sbjct: 1   MGMLQAGIIPVTPFQQNCTVFFDPETQEGVVVDPGGDVPLILQAIEKSGLTIKEIWLTHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DH GGA +LKE L + I+GPH+DD  ++ +++ QA    I    RN   D WL+DGD 
Sbjct: 61  HLDHAGGAKELKEALGVDIVGPHQDDLPLLQRIEAQAANYGIS-GLRNVLPDCWLKDGDR 119

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           +  G H F+V+H PGH+PGHVIY N   NFAHLGD LF  SIGRTD+  G++QQL++SI 
Sbjct: 120 VSFGAHEFEVYHAPGHAPGHVIYFNRAQNFAHLGDVLFNGSIGRTDLPGGNHQQLLDSIR 179

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           +K+LPLGDE+ F+CGHGP S IG ERR NPFL+ 
Sbjct: 180 DKVLPLGDEVGFICGHGPGSRIGDERRSNPFLQE 213


>gi|241205716|ref|YP_002976812.1| beta-lactamase [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240859606|gb|ACS57273.1| beta-lactamase domain protein [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 219

 Score =  254 bits (650), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 116/214 (54%), Positives = 151/214 (70%), Gaps = 1/214 (0%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M  L   I+ VTPF+QNCT  FD ++ E VVVDPGGD+ +I   I      +K+IW+THG
Sbjct: 1   MGMLQAGIIPVTPFQQNCTIFFDPDTKEGVVVDPGGDVPLILQAIAQNGLTIKEIWLTHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DH GGA++LKE L + +IGPH+DD  ++ +++ QA    +    RN   DRWL+DGD 
Sbjct: 61  HLDHAGGASELKEALGIDVIGPHQDDLPLLQRIETQAEKYGMS-GLRNVVPDRWLKDGDK 119

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           +  G H F+V H PGH+PGHVIY N   NFAHLGD LF  SIGRTD+  GD+QQL++SI 
Sbjct: 120 ISFGAHEFEVHHTPGHAPGHVIYFNRAQNFAHLGDVLFNGSIGRTDLPGGDHQQLLDSIR 179

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           +K+LPLGD++ F+CGHGP S IG ERR NPFL+ 
Sbjct: 180 DKVLPLGDDVGFICGHGPGSRIGDERRSNPFLQE 213


>gi|86358615|ref|YP_470507.1| putative hydrolase protein [Rhizobium etli CFN 42]
 gi|86282717|gb|ABC91780.1| putative hydrolase protein [Rhizobium etli CFN 42]
          Length = 230

 Score =  254 bits (649), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 113/214 (52%), Positives = 152/214 (71%), Gaps = 1/214 (0%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M  L   I+ VTPF+QNCT  FD ++ E VVVDPGGD+ +I   I+     +K+IW+THG
Sbjct: 1   MGMLQAGIIPVTPFQQNCTVFFDPDTQEGVVVDPGGDVPLILQAIEKSGLTIKEIWLTHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DH GGA++LKE L + ++GPH+DD  ++ +++ QA    I    RN   DRWL+DGD 
Sbjct: 61  HLDHAGGASELKEALGIEVVGPHQDDLPLLQRIETQAAKYGI-TGLRNVIPDRWLKDGDK 119

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           +  G H F+V+  PGH+PGHVIY N   NFAHLGD LF  SIGRTD+  G++QQL++SI 
Sbjct: 120 VSFGAHEFEVYRAPGHAPGHVIYFNRAQNFAHLGDVLFNGSIGRTDLPGGNHQQLLDSIR 179

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           +K+LPLGD++ F+CGHGP S IG ERR NP+L+ 
Sbjct: 180 DKVLPLGDDVGFICGHGPGSRIGDERRSNPYLQE 213


>gi|327188372|gb|EGE55589.1| putative hydrolase protein [Rhizobium etli CNPAF512]
          Length = 227

 Score =  253 bits (646), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 115/211 (54%), Positives = 149/211 (70%), Gaps = 1/211 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L   I+ VTPF+QNCT  FD E+ E VVVDPGGD+ +I   I+     +K+IW+THGH+D
Sbjct: 2   LQAGIIPVTPFQQNCTVFFDPETQEGVVVDPGGDVPLILQAIEKSGLTIKEIWLTHGHLD 61

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GGA +LKE L + I+GPH+DD  ++ +++ QA    I    RN   D WL+DGD +  
Sbjct: 62  HAGGAKELKEALGVDIVGPHQDDLPLLQRIETQAANYGIS-GLRNVLPDSWLKDGDRVSF 120

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G H F+V+H PGH+PGHVIY N   NFAHLGD LF  SIGRTD+  G++QQL++SI +K+
Sbjct: 121 GAHEFEVYHAPGHAPGHVIYFNRAQNFAHLGDVLFNGSIGRTDLPGGNHQQLLDSIRDKV 180

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           LPLGDE+ F+CGHGP   IG ERR NPFL+ 
Sbjct: 181 LPLGDEVGFICGHGPGGRIGDERRSNPFLQE 211


>gi|13472383|ref|NP_103950.1| hydrolase [Mesorhizobium loti MAFF303099]
 gi|14023129|dbj|BAB49736.1| probable hydrolase [Mesorhizobium loti MAFF303099]
          Length = 212

 Score =  250 bits (638), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 116/212 (54%), Positives = 148/212 (69%), Gaps = 1/212 (0%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M +L+  IV VTPF+QNCT LFD +    VVVDPGGD+D +  V++      + IWITHG
Sbjct: 1   MGQLNAGIVPVTPFQQNCTILFDMDDKHGVVVDPGGDIDKVLAVLKDNAITAEAIWITHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DH GGA +LKE L L IIGPH  D  ++  +++Q RL SI   ARN   DR+L +G+T
Sbjct: 61  HIDHAGGAMELKEALCLDIIGPHAADKPLLDNLEKQGRLYSI-AGARNCVPDRFLTEGET 119

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           +  G H+F+V HCPGH+PGHV+Y N    FAH+GD LFR S+GRTD+  GD+  LI SI 
Sbjct: 120 VSFGGHVFEVLHCPGHAPGHVVYYNRAAKFAHVGDVLFRGSVGRTDLPGGDHATLIASIK 179

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           +K+LPLGD+I F+CGHGP    G ERR NPFL
Sbjct: 180 DKLLPLGDDIGFICGHGPGGRFGEERRTNPFL 211


>gi|222149317|ref|YP_002550274.1| hydrolase [Agrobacterium vitis S4]
 gi|221736301|gb|ACM37264.1| hydrolase [Agrobacterium vitis S4]
          Length = 215

 Score =  249 bits (636), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 112/214 (52%), Positives = 152/214 (71%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M +L   I+ VTPF+QNCT  FD E+ E VVVDPGGD++ I  ++Q     +K+IW+THG
Sbjct: 1   MGQLQAGIIPVTPFQQNCTVFFDSETKEGVVVDPGGDVEEILRMVQENGITLKEIWLTHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DH GGA  LK+ L + IIGPH+DD  ++  ++ Q+   ++ +  RN + DR+L++GD 
Sbjct: 61  HLDHAGGAEDLKDALGIQIIGPHRDDKPLLDALEGQSARFNLPIKLRNVTPDRFLEEGDV 120

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           +    H F+V HCPGH+PGHV++ N   NFAHLGD LF  SIGRTD+  G+ QQL+ SI 
Sbjct: 121 VGFSGHEFEVLHCPGHAPGHVVFFNRVQNFAHLGDVLFNGSIGRTDLPGGNPQQLLASIR 180

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           +K+LPLGD++ F+CGHGP S IG ERR NPFLK 
Sbjct: 181 DKVLPLGDDVGFICGHGPGSRIGDERRSNPFLKG 214


>gi|319781905|ref|YP_004141381.1| hydrolase [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317167793|gb|ADV11331.1| hydrolase [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 212

 Score =  245 bits (625), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 112/212 (52%), Positives = 146/212 (68%), Gaps = 1/212 (0%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M +L+  IV VTPF+QNCT LFD +    VVVDPGGD+D +  V++        IWITHG
Sbjct: 1   MGQLNAGIVPVTPFQQNCTILFDMDDKHGVVVDPGGDIDKVLAVLKDNAISAGAIWITHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DH GGA +LKE L + IIGPH+ D +++  ++ Q +   I   ARN   DR+L +G+T
Sbjct: 61  HIDHAGGAMELKEALGVEIIGPHEADKSLLDNLENQGKRYGI-AGARNCVPDRFLAEGET 119

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           +  G H+F+V HCPGH+PGHV+Y N    FAH+GD LFR S+GRTD+  GD+  LI SI 
Sbjct: 120 VSFGGHVFEVLHCPGHAPGHVVYYNGAAKFAHVGDVLFRGSVGRTDLPGGDHAALIASIK 179

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           +K+LPLGD+I F+CGHGP    G ERR NPFL
Sbjct: 180 DKLLPLGDDIGFICGHGPGGRFGEERRTNPFL 211


>gi|121602782|ref|YP_989266.1| metallo-beta-lactamase family protein [Bartonella bacilliformis
           KC583]
 gi|120614959|gb|ABM45560.1| metallo-beta-lactamase family protein [Bartonella bacilliformis
           KC583]
          Length = 214

 Score =  244 bits (622), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 120/214 (56%), Positives = 153/214 (71%), Gaps = 3/214 (1%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M  LS HIV VT F+QNCT LFD ES   V+VDPGGD   I++ IQ     V+ IWITHG
Sbjct: 1   MGDLSLHIVPVTSFQQNCTLLFDNESKRGVLVDPGGDWFRIEEAIQETGVIVEAIWITHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRM-NARNASSDRWLQDGD 119
           HVDHVG A Q KE L++ I+G H DD  +M  V E+A+  S RM + R    D+WL+DGD
Sbjct: 61  HVDHVGAAMQAKETLNVKIMGSHLDDKPVMDDVVERAK--SYRMADVRLCVPDQWLKDGD 118

Query: 120 TLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSI 179
           ++    H+F VFH PGH+PGHVIY N +  FA LGD LFR S+GRTD++ G ++QL++SI
Sbjct: 119 SIDCAGHVFHVFHTPGHAPGHVIYFNEKERFALLGDVLFRGSVGRTDLMLGSHEQLMHSI 178

Query: 180 NNKILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
             K+LPLG++++F+CGHGP STIG ER+ NPFLK
Sbjct: 179 REKVLPLGNDVNFICGHGPGSTIGYERQHNPFLK 212


>gi|319405273|emb|CBI78887.1| putative hydrolase [Bartonella sp. AR 15-3]
          Length = 214

 Score =  243 bits (619), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 116/213 (54%), Positives = 147/213 (69%), Gaps = 1/213 (0%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           MS  S +I+ VTPF+QNCT LFD ES   V+VDPGGD   I+  IQ +   V+ IWITHG
Sbjct: 1   MSDFSVYIIPVTPFQQNCTLLFDNESKRGVLVDPGGDWPKIQQTIQEKGVIVEAIWITHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DHVG A Q KE L + IIG H++D  +M  V E+A++  +  +AR    D+WL+DGD+
Sbjct: 61  HIDHVGAAMQAKEALDIQIIGSHRNDKPVMDDVSERAKIYHMP-DARVCIPDQWLEDGDS 119

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           +    H F VFH PGHSPGHVIY N +  FA LGD LFR +IGRTD     +++LI SI 
Sbjct: 120 VDCAGHTFSVFHTPGHSPGHVIYFNEKRRFALLGDVLFRGAIGRTDFPLCSHEELIKSIK 179

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
            K+LPLGD +SF+CGHGP S IG ER+ NPFL+
Sbjct: 180 EKVLPLGDNVSFICGHGPGSQIGYERQYNPFLQ 212


>gi|90418268|ref|ZP_01226180.1| putative hydrolase [Aurantimonas manganoxydans SI85-9A1]
 gi|90337940|gb|EAS51591.1| putative hydrolase [Aurantimonas manganoxydans SI85-9A1]
          Length = 213

 Score =  242 bits (617), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 110/212 (51%), Positives = 144/212 (67%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M+ L+  IV VTPF+QNC  LFD E    VVVDPGGD+D I + I+     ++ IW+THG
Sbjct: 1   MTTLNAQIVPVTPFQQNCCILFDVEDKIGVVVDPGGDVDRILEAIEKAGIAIEAIWLTHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DH GGA +LKE L + I+GPHK D  ++  + EQAR+  I    R+ + DRWL++G+T
Sbjct: 61  HIDHAGGAMELKEHLGVDIVGPHKADDFLLAGLSEQARMFGIPGAVRDCTPDRWLEEGET 120

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           L    H F+V H PGH+PGHV++ N    F H GD LF  SIGRTD+  GD+  LI SI 
Sbjct: 121 LAFADHRFEVLHTPGHAPGHVVFYNRAAKFLHAGDVLFSGSIGRTDLPGGDHATLIASIK 180

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           +K+LPLGD++ F+CGHGP   +G ERR NPFL
Sbjct: 181 DKVLPLGDDVGFICGHGPGGRLGDERRGNPFL 212


>gi|163867951|ref|YP_001609155.1| hydrolase [Bartonella tribocorum CIP 105476]
 gi|161017602|emb|CAK01160.1| probable hydrolase [Bartonella tribocorum CIP 105476]
          Length = 216

 Score =  241 bits (616), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 117/214 (54%), Positives = 146/214 (68%), Gaps = 1/214 (0%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           MS  S HI+ VTPF+QNCT LFD E    V+VDPGGD   I++VI+ +   V+ IWITHG
Sbjct: 1   MSHFSTHIIPVTPFQQNCTLLFDTEQKGGVLVDPGGDWRRIQEVIEKKGITVEAIWITHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H DHVG A Q KEDL + IIG H DD  +M  V E AR   I  +A     D+WL+DGD+
Sbjct: 61  HFDHVGAAMQAKEDLGVKIIGSHCDDRPVMDAVVESARSYGI-TDASVCIPDQWLEDGDS 119

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           +    H+F+VFH PGHSPGHVIY N +  FA LGD LFR SIGRTD     +++L+ S+ 
Sbjct: 120 VHFSDHVFRVFHTPGHSPGHVIYFNEKERFALLGDVLFRGSIGRTDFPFCSHEKLMRSLR 179

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
            KILPLGD++ F+CGHGP S +G ER+ NPFL+ 
Sbjct: 180 EKILPLGDDVRFICGHGPGSYLGYERQWNPFLQE 213


>gi|161619462|ref|YP_001593349.1| beta-lactamase domain-containing protein [Brucella canis ATCC
           23365]
 gi|163843771|ref|YP_001628175.1| beta-lactamase domain-containing protein [Brucella suis ATCC 23445]
 gi|254704770|ref|ZP_05166598.1| beta-lactamase domain-containing protein [Brucella suis bv. 3 str.
           686]
 gi|260565987|ref|ZP_05836457.1| beta-lactamase domain-containing protein [Brucella suis bv. 4 str.
           40]
 gi|261755466|ref|ZP_05999175.1| beta-lactamase domain-containing protein [Brucella suis bv. 3 str.
           686]
 gi|161336273|gb|ABX62578.1| beta-lactamase domain protein [Brucella canis ATCC 23365]
 gi|163674494|gb|ABY38605.1| beta-lactamase domain protein [Brucella suis ATCC 23445]
 gi|260155505|gb|EEW90585.1| beta-lactamase domain-containing protein [Brucella suis bv. 4 str.
           40]
 gi|261745219|gb|EEY33145.1| beta-lactamase domain-containing protein [Brucella suis bv. 3 str.
           686]
          Length = 218

 Score =  241 bits (615), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 110/212 (51%), Positives = 143/212 (67%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M +L   IV VTPF+QNCT LFD E+ + VV+DPGGDL  I++ I+S+   V+ IWITHG
Sbjct: 1   MGQLQAIIVPVTPFQQNCTILFDGETKKGVVIDPGGDLARIREAIESQGIDVEAIWITHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DH   A  LKE L + IIGPH+DD  ++  +        I    RN + D+WL++GD 
Sbjct: 61  HIDHAAAALNLKEALGVDIIGPHRDDKFLLDNLVAAGLKYGITEGVRNVTPDQWLEEGDK 120

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           + +  H+F VFHCPGH+PGHV++ N E  FA +GD LF  S+GRTD+  GD+  LI SI 
Sbjct: 121 VCVAGHVFDVFHCPGHAPGHVVFFNPEARFAIVGDVLFNGSVGRTDLPGGDHATLIRSIK 180

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
            K+LPLGD+I F+CGHGP    G ERR NPFL
Sbjct: 181 EKLLPLGDDIGFICGHGPGGRFGEERRSNPFL 212


>gi|148559965|ref|YP_001259395.1| metallo-beta-lactamase family protein [Brucella ovis ATCC 25840]
 gi|225627959|ref|ZP_03785995.1| metallo-beta-lactamase family protein [Brucella ceti str. Cudo]
 gi|254689703|ref|ZP_05152957.1| metallo-beta-lactamase family protein [Brucella abortus bv. 6 str.
           870]
 gi|254694193|ref|ZP_05156021.1| metallo-beta-lactamase family protein [Brucella abortus bv. 3 str.
           Tulya]
 gi|254702235|ref|ZP_05164063.1| metallo-beta-lactamase family protein [Brucella suis bv. 5 str.
           513]
 gi|254708184|ref|ZP_05170012.1| metallo-beta-lactamase family protein [Brucella pinnipedialis
           M163/99/10]
 gi|254710554|ref|ZP_05172365.1| metallo-beta-lactamase family protein [Brucella pinnipedialis
           B2/94]
 gi|256032048|ref|ZP_05445662.1| metallo-beta-lactamase family protein [Brucella pinnipedialis
           M292/94/1]
 gi|256061571|ref|ZP_05451712.1| metallo-beta-lactamase family protein [Brucella neotomae 5K33]
 gi|256160244|ref|ZP_05457938.1| metallo-beta-lactamase family protein [Brucella ceti M490/95/1]
 gi|256255450|ref|ZP_05460986.1| metallo-beta-lactamase family protein [Brucella ceti B1/94]
 gi|256257954|ref|ZP_05463490.1| metallo-beta-lactamase family protein [Brucella abortus bv. 9 str.
           C68]
 gi|256369933|ref|YP_003107444.1| metallo-beta-lactamase family protein [Brucella microti CCM 4915]
 gi|260169183|ref|ZP_05755994.1| metallo-beta-lactamase family protein [Brucella sp. F5/99]
 gi|260755236|ref|ZP_05867584.1| beta-lactamase domain-containing protein [Brucella abortus bv. 6
           str. 870]
 gi|260884250|ref|ZP_05895864.1| beta-lactamase domain-containing protein [Brucella abortus bv. 9
           str. C68]
 gi|261214499|ref|ZP_05928780.1| beta-lactamase domain-containing protein [Brucella abortus bv. 3
           str. Tulya]
 gi|261222655|ref|ZP_05936936.1| beta-lactamase domain-containing protein [Brucella ceti B1/94]
 gi|261315689|ref|ZP_05954886.1| beta-lactamase domain-containing protein [Brucella pinnipedialis
           M163/99/10]
 gi|261318127|ref|ZP_05957324.1| beta-lactamase domain-containing protein [Brucella pinnipedialis
           B2/94]
 gi|261325577|ref|ZP_05964774.1| beta-lactamase domain-containing protein [Brucella neotomae 5K33]
 gi|261752807|ref|ZP_05996516.1| beta-lactamase domain-containing protein [Brucella suis bv. 5 str.
           513]
 gi|261758696|ref|ZP_06002405.1| beta-lactamase domain-containing protein [Brucella sp. F5/99]
 gi|265989157|ref|ZP_06101714.1| beta-lactamase domain-containing protein [Brucella pinnipedialis
           M292/94/1]
 gi|265998619|ref|ZP_06111176.1| beta-lactamase domain-containing protein [Brucella ceti M490/95/1]
 gi|294852836|ref|ZP_06793509.1| hydroxyacylglutathione hydrolase [Brucella sp. NVSL 07-0026]
 gi|297248790|ref|ZP_06932508.1| hydroxyacylglutathione hydrolase [Brucella abortus bv. 5 str.
           B3196]
 gi|306843136|ref|ZP_07475757.1| metallo-beta-lactamase family protein [Brucella sp. BO2]
 gi|306844518|ref|ZP_07477107.1| metallo-beta-lactamase family protein [Brucella sp. BO1]
 gi|148371222|gb|ABQ61201.1| metallo-beta-lactamase family protein [Brucella ovis ATCC 25840]
 gi|225617122|gb|EEH14168.1| metallo-beta-lactamase family protein [Brucella ceti str. Cudo]
 gi|256000096|gb|ACU48495.1| metallo-beta-lactamase family protein [Brucella microti CCM 4915]
 gi|260675344|gb|EEX62165.1| beta-lactamase domain-containing protein [Brucella abortus bv. 6
           str. 870]
 gi|260873778|gb|EEX80847.1| beta-lactamase domain-containing protein [Brucella abortus bv. 9
           str. C68]
 gi|260916106|gb|EEX82967.1| beta-lactamase domain-containing protein [Brucella abortus bv. 3
           str. Tulya]
 gi|260921239|gb|EEX87892.1| beta-lactamase domain-containing protein [Brucella ceti B1/94]
 gi|261297350|gb|EEY00847.1| beta-lactamase domain-containing protein [Brucella pinnipedialis
           B2/94]
 gi|261301557|gb|EEY05054.1| beta-lactamase domain-containing protein [Brucella neotomae 5K33]
 gi|261304715|gb|EEY08212.1| beta-lactamase domain-containing protein [Brucella pinnipedialis
           M163/99/10]
 gi|261738680|gb|EEY26676.1| beta-lactamase domain-containing protein [Brucella sp. F5/99]
 gi|261742560|gb|EEY30486.1| beta-lactamase domain-containing protein [Brucella suis bv. 5 str.
           513]
 gi|262553243|gb|EEZ09077.1| beta-lactamase domain-containing protein [Brucella ceti M490/95/1]
 gi|264661354|gb|EEZ31615.1| beta-lactamase domain-containing protein [Brucella pinnipedialis
           M292/94/1]
 gi|294821425|gb|EFG38424.1| hydroxyacylglutathione hydrolase [Brucella sp. NVSL 07-0026]
 gi|297175959|gb|EFH35306.1| hydroxyacylglutathione hydrolase [Brucella abortus bv. 5 str.
           B3196]
 gi|306275129|gb|EFM56885.1| metallo-beta-lactamase family protein [Brucella sp. BO1]
 gi|306286686|gb|EFM58242.1| metallo-beta-lactamase family protein [Brucella sp. BO2]
          Length = 218

 Score =  241 bits (615), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 110/212 (51%), Positives = 143/212 (67%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M +L   IV VTPF+QNCT LFD E+ + VV+DPGGDL  I++ I+S+   V+ IWITHG
Sbjct: 1   MGQLQAIIVPVTPFQQNCTILFDGETKKGVVIDPGGDLARIREAIESQGIDVEAIWITHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DH   A  LKE L + IIGPH+DD  ++  +        I    RN + D+WL++GD 
Sbjct: 61  HIDHAAAALDLKEALGVDIIGPHRDDKFLLDNLVAAGLKYGITEGVRNVTPDQWLEEGDK 120

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           + +  H+F VFHCPGH+PGHV++ N E  FA +GD LF  S+GRTD+  GD+  LI SI 
Sbjct: 121 VCVAGHVFDVFHCPGHAPGHVVFFNPEARFAIVGDVLFNGSVGRTDLPGGDHATLIRSIK 180

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
            K+LPLGD+I F+CGHGP    G ERR NPFL
Sbjct: 181 EKLLPLGDDIGFICGHGPGGRFGEERRSNPFL 212


>gi|225852994|ref|YP_002733227.1| beta-lactamase domain-containing protein [Brucella melitensis ATCC
           23457]
 gi|256114075|ref|ZP_05454845.1| beta-lactamase domain protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|256263524|ref|ZP_05466056.1| beta-lactamase domain-containing protein [Brucella melitensis bv. 2
           str. 63/9]
 gi|265995408|ref|ZP_06107965.1| beta-lactamase domain-containing protein [Brucella melitensis bv. 3
           str. Ether]
 gi|225641359|gb|ACO01273.1| beta-lactamase domain protein [Brucella melitensis ATCC 23457]
 gi|262766521|gb|EEZ12310.1| beta-lactamase domain-containing protein [Brucella melitensis bv. 3
           str. Ether]
 gi|263093554|gb|EEZ17579.1| beta-lactamase domain-containing protein [Brucella melitensis bv. 2
           str. 63/9]
 gi|326409534|gb|ADZ66599.1| beta-lactamase domain-containing protein [Brucella melitensis M28]
 gi|326539242|gb|ADZ87457.1| beta-lactamase domain protein [Brucella melitensis M5-90]
          Length = 218

 Score =  241 bits (614), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 110/212 (51%), Positives = 143/212 (67%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M +L   IV VTPF+QNCT LFD E+ + VV+DPGGDL  I++ I+S+   V+ IWITHG
Sbjct: 1   MRQLQAIIVPVTPFQQNCTILFDGETKKGVVIDPGGDLARIREAIESQGIDVEAIWITHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DH   A  LKE L + IIGPH+DD  ++  +        I    RN + D+WL++GD 
Sbjct: 61  HIDHAAAALDLKEALGVDIIGPHRDDKFLLDNLVAAGLKYGITEGVRNVTPDQWLEEGDK 120

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           + +  H+F VFHCPGH+PGHV++ N E  FA +GD LF  S+GRTD+  GD+  LI SI 
Sbjct: 121 VCVAGHVFDVFHCPGHAPGHVVFFNPEARFAIVGDVLFNGSVGRTDLPGGDHATLIRSIK 180

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
            K+LPLGD+I F+CGHGP    G ERR NPFL
Sbjct: 181 EKLLPLGDDIGFICGHGPGGRFGEERRSNPFL 212


>gi|17986779|ref|NP_539413.1| hydroxyacylglutathione hydrolase [Brucella melitensis bv. 1 str.
           16M]
 gi|256045139|ref|ZP_05448039.1| hydroxyacylglutathione hydrolase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|260565263|ref|ZP_05835747.1| beta-lactamase domain-containing protein [Brucella melitensis bv. 1
           str. 16M]
 gi|265991572|ref|ZP_06104129.1| beta-lactamase domain-containing protein [Brucella melitensis bv. 1
           str. Rev.1]
 gi|17982409|gb|AAL51677.1| hydroxyacylglutathione hydrolase [Brucella melitensis bv. 1 str.
           16M]
 gi|260151331|gb|EEW86425.1| beta-lactamase domain-containing protein [Brucella melitensis bv. 1
           str. 16M]
 gi|263002356|gb|EEZ14931.1| beta-lactamase domain-containing protein [Brucella melitensis bv. 1
           str. Rev.1]
          Length = 218

 Score =  241 bits (614), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 110/212 (51%), Positives = 143/212 (67%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M +L   IV VTPF+QNCT LFD E+ + VV+DPGGDL  I++ I+S+   V+ IWITHG
Sbjct: 1   MRQLQAIIVPVTPFQQNCTILFDGETKKGVVIDPGGDLARIREAIESQGIDVEAIWITHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DH   A  LKE L + IIGPH+DD  ++  +        I    RN + D+WL++GD 
Sbjct: 61  HIDHAAAALDLKEALGVDIIGPHRDDKFLLDNLVAAGLKYGITEGVRNVTPDQWLEEGDK 120

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           + +  H+F VFHCPGH+PGHV++ N E  FA +GD LF  S+GRTD+  GD+  LI SI 
Sbjct: 121 VCVAGHVFDVFHCPGHAPGHVVFFNPEARFAIVGDVLFNGSVGRTDLPGGDHATLIRSIT 180

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
            K+LPLGD+I F+CGHGP    G ERR NPFL
Sbjct: 181 EKLLPLGDDIGFICGHGPGGRFGEERRSNPFL 212


>gi|319403832|emb|CBI77419.1| putative hydrolase [Bartonella rochalimae ATCC BAA-1498]
          Length = 214

 Score =  241 bits (614), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 116/213 (54%), Positives = 149/213 (69%), Gaps = 1/213 (0%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           MS  S +I+ VTPF+QNCT LFD ES   V+VDPGGD   I+  IQ +   V+ IWITHG
Sbjct: 1   MSDFSVYIIPVTPFQQNCTLLFDNESKRGVLVDPGGDWLKIQQAIQKKGVIVEAIWITHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DHVG A Q KE L + IIG H++D  +M  V E+A++  +  +AR    D+WL+DGD+
Sbjct: 61  HIDHVGAAMQAKEVLDIQIIGSHRNDKPVMDDVRERAKIYHMP-DARVCIPDQWLEDGDS 119

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           +    H+F+VFH PGHSPGHVIY N +  FA LGD LFR SIGRTD     +++L+ SI 
Sbjct: 120 VDCAGHVFQVFHTPGHSPGHVIYFNEKKRFALLGDVLFRGSIGRTDFPLCSHEELMRSIK 179

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
            K+LPLGD +SF+CGHGP S IG ER+ NPFL+
Sbjct: 180 EKVLPLGDNVSFICGHGPGSQIGYERQHNPFLQ 212


>gi|239832398|ref|ZP_04680727.1| beta-lactamase domain-containing protein [Ochrobactrum intermedium
           LMG 3301]
 gi|239824665|gb|EEQ96233.1| beta-lactamase domain-containing protein [Ochrobactrum intermedium
           LMG 3301]
          Length = 218

 Score =  240 bits (613), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 113/212 (53%), Positives = 141/212 (66%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M +L   IV VTPF+QNCT LFD E+ + VV+DPGGDLD I D I S+   V+ IWITHG
Sbjct: 1   MGQLQAIIVPVTPFQQNCTILFDSETKKGVVIDPGGDLDRILDAIGSQGVEVEAIWITHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DH G A  LKE L + IIGPHKDD  ++  +        +    RN + DRWL +GD 
Sbjct: 61  HIDHAGAALDLKEALDVDIIGPHKDDKFLLDNLATTGLKYGLTEGVRNVTPDRWLNEGDK 120

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           + +  H F+VFH PGH+PGHV++ N E  FA +GD LF  S+GRTD+  GD+  LI SI 
Sbjct: 121 VSVAGHEFEVFHTPGHAPGHVVFFNPEARFAIVGDVLFNGSVGRTDLPGGDHAALIRSIK 180

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
            K+LPLGD+I F+CGHGP    G ERR NPFL
Sbjct: 181 EKLLPLGDDIGFICGHGPGGRFGEERRSNPFL 212


>gi|319406842|emb|CBI80477.1| putative hydrolase [Bartonella sp. 1-1C]
          Length = 214

 Score =  240 bits (613), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 114/213 (53%), Positives = 148/213 (69%), Gaps = 1/213 (0%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           MS  S +I+ VTPF+QNCT LFD ES   V+VDPGGD   I+  IQ +   V+ IWITHG
Sbjct: 1   MSDFSVYIIPVTPFQQNCTLLFDNESKRGVLVDPGGDWPKIQQTIQKKGVIVEAIWITHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DHVG A Q KE L + IIG H++D  +M  + E+A++  +  +AR    D+WL+DGD+
Sbjct: 61  HIDHVGAAMQAKEALDIQIIGSHRNDKPIMDDIRERAKIYHMP-DARVCIPDQWLEDGDS 119

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           +    H+F+VFH PGHSPGHVIY N +  F  LGD LFR SIGRTD     +++L+ SI 
Sbjct: 120 VNCAGHVFQVFHTPGHSPGHVIYFNEKKRFVLLGDVLFRGSIGRTDFPLCSHEELMRSIK 179

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
            K+LPLGD +SF+CGHGP S IG ER+ NPFL+
Sbjct: 180 EKVLPLGDNVSFICGHGPGSQIGYERQHNPFLR 212


>gi|254714737|ref|ZP_05176548.1| metallo-beta-lactamase family protein [Brucella ceti M644/93/1]
 gi|254717797|ref|ZP_05179608.1| metallo-beta-lactamase family protein [Brucella ceti M13/05/1]
 gi|261219645|ref|ZP_05933926.1| beta-lactamase domain-containing protein [Brucella ceti M13/05/1]
 gi|261322533|ref|ZP_05961730.1| beta-lactamase domain-containing protein [Brucella ceti M644/93/1]
 gi|260924734|gb|EEX91302.1| beta-lactamase domain-containing protein [Brucella ceti M13/05/1]
 gi|261295223|gb|EEX98719.1| beta-lactamase domain-containing protein [Brucella ceti M644/93/1]
          Length = 218

 Score =  240 bits (613), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 110/212 (51%), Positives = 142/212 (66%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M +L   IV VTPF+QNCT LFD E+ + VV+DPGGDL  I++ I+S+   V+ IWITHG
Sbjct: 1   MGQLQAIIVPVTPFQQNCTILFDGETKKGVVIDPGGDLARIREAIESQGIDVEAIWITHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DH   A  LKE L + IIGPH+DD  ++  +        I    RN + D+WL++GD 
Sbjct: 61  HIDHAAAALDLKEALGVDIIGPHRDDKFLLDNLVAAGLKYGITEGVRNVTPDQWLEEGDK 120

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           + +  H+F VFHCPGH+PGHV++ N E  FA +GD LF  S+GRTD+  GD   LI SI 
Sbjct: 121 VCVAGHVFDVFHCPGHAPGHVVFFNPEARFAIVGDVLFNGSVGRTDLPGGDRATLIRSIK 180

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
            K+LPLGD+I F+CGHGP    G ERR NPFL
Sbjct: 181 EKLLPLGDDIGFICGHGPGGRFGEERRSNPFL 212


>gi|23502385|ref|NP_698512.1| metallo-beta-lactamase family protein [Brucella suis 1330]
 gi|23348369|gb|AAN30427.1| metallo-beta-lactamase family protein [Brucella suis 1330]
          Length = 218

 Score =  240 bits (612), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 110/212 (51%), Positives = 142/212 (66%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M +L   IV VTPF+QNCT LFD E+ + VV+DPGGDL  I++ I+S+   V+ IWITHG
Sbjct: 1   MGQLQAIIVPVTPFQQNCTILFDGETKKGVVIDPGGDLARIREAIESQGIDVEAIWITHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DH   A  LKE L + IIGPH+DD  ++  +        I    RN + D+WL++GD 
Sbjct: 61  HIDHAAAALNLKEALGVDIIGPHRDDKFLLDNLVAAGLKYGITEGVRNVTPDQWLEEGDK 120

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           + +  H+F VFHCPGH PGHV++ N E  FA +GD LF  S+GRTD+  GD+  LI SI 
Sbjct: 121 VCVAGHVFDVFHCPGHVPGHVVFFNPEARFAIVGDVLFNGSVGRTDLPGGDHATLIRSIK 180

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
            K+LPLGD+I F+CGHGP    G ERR NPFL
Sbjct: 181 EKLLPLGDDIGFICGHGPGGRFGEERRSNPFL 212


>gi|62290404|ref|YP_222197.1| metallo-beta-lactamase family protein [Brucella abortus bv. 1 str.
           9-941]
 gi|82700326|ref|YP_414900.1| beta-lactamase-like protein [Brucella melitensis biovar Abortus
           2308]
 gi|189024631|ref|YP_001935399.1| Beta-lactamase-like protein [Brucella abortus S19]
 gi|237815909|ref|ZP_04594906.1| metallo-beta-lactamase family protein [Brucella abortus str. 2308
           A]
 gi|254697846|ref|ZP_05159674.1| Beta-lactamase-like protein [Brucella abortus bv. 2 str. 86/8/59]
 gi|254730737|ref|ZP_05189315.1| Beta-lactamase-like protein [Brucella abortus bv. 4 str. 292]
 gi|260546941|ref|ZP_05822680.1| beta-lactamase domain-containing protein [Brucella abortus NCTC
           8038]
 gi|260758456|ref|ZP_05870804.1| beta-lactamase domain-containing protein [Brucella abortus bv. 4
           str. 292]
 gi|260762282|ref|ZP_05874625.1| beta-lactamase domain-containing protein [Brucella abortus bv. 2
           str. 86/8/59]
 gi|62196536|gb|AAX74836.1| metallo-beta-lactamase family protein [Brucella abortus bv. 1 str.
           9-941]
 gi|82616427|emb|CAJ11490.1| Beta-lactamase-like [Brucella melitensis biovar Abortus 2308]
 gi|189020203|gb|ACD72925.1| Beta-lactamase-like protein [Brucella abortus S19]
 gi|237789207|gb|EEP63418.1| metallo-beta-lactamase family protein [Brucella abortus str. 2308
           A]
 gi|260095991|gb|EEW79868.1| beta-lactamase domain-containing protein [Brucella abortus NCTC
           8038]
 gi|260668774|gb|EEX55714.1| beta-lactamase domain-containing protein [Brucella abortus bv. 4
           str. 292]
 gi|260672714|gb|EEX59535.1| beta-lactamase domain-containing protein [Brucella abortus bv. 2
           str. 86/8/59]
          Length = 218

 Score =  239 bits (611), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 109/212 (51%), Positives = 143/212 (67%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M +L   IV VTPF+QNCT LFD E+ + VV+DPGGDL  I++ I+S+   V+ IWITHG
Sbjct: 1   MGQLQAIIVPVTPFQQNCTILFDGETKKGVVIDPGGDLARIREAIESQGIDVEAIWITHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DH   A  LKE L + IIGPH+DD  ++  +        I    RN + D+WL++GD 
Sbjct: 61  HIDHAAAALDLKEALGVDIIGPHRDDKFLLDNLVAAGLKYGITEGVRNVTPDQWLEEGDK 120

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           + +  H+F VF+CPGH+PGHV++ N E  FA +GD LF  S+GRTD+  GD+  LI SI 
Sbjct: 121 VCVAGHVFDVFYCPGHAPGHVVFFNPEARFAIVGDVLFNGSVGRTDLPGGDHATLIRSIK 180

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
            K+LPLGD+I F+CGHGP    G ERR NPFL
Sbjct: 181 EKLLPLGDDIGFICGHGPGGRFGEERRSNPFL 212


>gi|260467120|ref|ZP_05813299.1| beta-lactamase domain protein [Mesorhizobium opportunistum WSM2075]
 gi|259029132|gb|EEW30429.1| beta-lactamase domain protein [Mesorhizobium opportunistum WSM2075]
          Length = 212

 Score =  239 bits (609), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 111/212 (52%), Positives = 142/212 (66%), Gaps = 1/212 (0%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M +L+  IV VTPF+QNCT LFD +    VVVDPGGD+D +  V++        IWITHG
Sbjct: 1   MGQLNAGIVPVTPFQQNCTILFDMDDKRGVVVDPGGDIDKVLAVLKDNAITAGAIWITHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DH GGA  LKE L + IIGPH  D  ++  +  Q R   I   +R+   DR+L +G+T
Sbjct: 61  HIDHAGGAMDLKEALGIEIIGPHAADKPLLDNLANQGRRYGID-GSRDCVPDRFLTEGET 119

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           +  G H+F+V HCPGH+PGHV+Y N    FAH+GD LFR S+GRTD+  GD+  LI SI 
Sbjct: 120 VSFGGHVFEVLHCPGHAPGHVVYYNRAAKFAHVGDVLFRGSVGRTDLPGGDHATLIASIK 179

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           +K+LPLGD+I F+CGHGP    G ERR NPFL
Sbjct: 180 DKLLPLGDDIGFICGHGPGGRFGEERRTNPFL 211


>gi|319898505|ref|YP_004158598.1| hydrolase [Bartonella clarridgeiae 73]
 gi|319402469|emb|CBI76012.1| putative hydrolase [Bartonella clarridgeiae 73]
          Length = 214

 Score =  239 bits (609), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 114/214 (53%), Positives = 150/214 (70%), Gaps = 1/214 (0%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M+ LS +I+ VTPF+QNCT LFD E+   V+VDPGGD   I+  IQ +   V+ IWITHG
Sbjct: 1   MNDLSAYIIPVTPFQQNCTLLFDNENKRGVLVDPGGDWPKIQQTIQDKGVIVESIWITHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DHVG A Q KE L + IIG H++D ++M  V E+A++  +  +AR    D+WL+DGD+
Sbjct: 61  HIDHVGAAMQAKEALDIQIIGSHRNDTSVMDDVSERAKIYHMP-DARVCIPDQWLEDGDS 119

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           +    H+F VFH PGHSPGHVIY N +  FA LGD LFR SIGRTD     Y++L+ SI 
Sbjct: 120 VDCAGHVFTVFHTPGHSPGHVIYFNEKKRFALLGDVLFRGSIGRTDFPLCSYEELMKSIK 179

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
            K+LPLGD+++F+CGHGP S IG ER+ N FL+ 
Sbjct: 180 EKVLPLGDDVNFICGHGPGSQIGYERQHNFFLQE 213


>gi|153008978|ref|YP_001370193.1| beta-lactamase domain-containing protein [Ochrobactrum anthropi
           ATCC 49188]
 gi|151560866|gb|ABS14364.1| beta-lactamase domain protein [Ochrobactrum anthropi ATCC 49188]
          Length = 218

 Score =  238 bits (607), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 111/212 (52%), Positives = 142/212 (66%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M +L   IV VTPF+QNCT LFD E+ + VV+DPGGDLD I++ I S+   V+ IWITHG
Sbjct: 1   MGQLQAIIVPVTPFQQNCTILFDGETKKGVVIDPGGDLDRIREAIDSQGIDVEAIWITHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DH   A  LKE L++ IIGPH+DD  ++  ++       I    RN + DRWL +GD 
Sbjct: 61  HIDHAAAALDLKEALNVDIIGPHRDDKFLLDNLEATGLKYGITEGVRNVTPDRWLDEGDK 120

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           + +  H F VFH PGH+PGHV++ N E  FA +GD LF  S+GRTD+  GD+  LI SI 
Sbjct: 121 VSVAGHEFDVFHTPGHAPGHVVFFNPEARFAIVGDVLFNGSVGRTDLPAGDHAALIRSIK 180

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
            K+LPLGD+I F+CGHGP    G ERR NPFL
Sbjct: 181 EKLLPLGDDIGFICGHGPGGRFGDERRSNPFL 212


>gi|254719552|ref|ZP_05181363.1| metallo-beta-lactamase family protein [Brucella sp. 83/13]
 gi|265984560|ref|ZP_06097295.1| beta-lactamase domain-containing protein [Brucella sp. 83/13]
 gi|306837818|ref|ZP_07470681.1| metallo-beta-lactamase family protein [Brucella sp. NF 2653]
 gi|264663152|gb|EEZ33413.1| beta-lactamase domain-containing protein [Brucella sp. 83/13]
 gi|306407114|gb|EFM63330.1| metallo-beta-lactamase family protein [Brucella sp. NF 2653]
          Length = 218

 Score =  238 bits (606), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 108/212 (50%), Positives = 142/212 (66%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M +L   IV VTPF+QNCT LFD E+ +  V+DPGGDL  I++ I+S+   V+ IWITHG
Sbjct: 1   MGQLQAIIVPVTPFQQNCTILFDGETKKGGVIDPGGDLARIREAIESQGIDVEAIWITHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DH   A  LKE L + IIGPH+DD  ++  +        I    RN + D+WL++GD 
Sbjct: 61  HIDHAAAALDLKEALGVDIIGPHRDDKFLLDNLVAAGLKYGITEGVRNVTPDQWLEEGDK 120

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           + +  H+F VFHCPGH+PGHV++ N E  FA +GD LF  ++GRTD+  GD+  LI SI 
Sbjct: 121 VCVAGHVFDVFHCPGHAPGHVVFFNPEARFAIVGDVLFNGAVGRTDLPGGDHATLIRSIK 180

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
            K+LPLGD+I F+CGHGP    G ERR NPFL
Sbjct: 181 EKLLPLGDDIGFICGHGPGGRFGEERRSNPFL 212


>gi|304391313|ref|ZP_07373257.1| beta-lactamase domain-containing protein [Ahrensia sp. R2A130]
 gi|303296669|gb|EFL91025.1| beta-lactamase domain-containing protein [Ahrensia sp. R2A130]
          Length = 213

 Score =  235 bits (600), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 105/212 (49%), Positives = 146/212 (68%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M KL+  IV VT F+QNCT ++D ++   VV+DPGGD+  I+  I+     V+ IW+THG
Sbjct: 1   MGKLNIQIVPVTAFQQNCTLIWDADTNTGVVIDPGGDVGKIRKAIEDSGIKVEAIWLTHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DH GGA  LK+ L + IIGPH+ D  ++ ++++QA++  +    RN + DRWL  G+T
Sbjct: 61  HIDHAGGAMDLKDALGIDIIGPHEADIPLLSQLEKQAQMFGLDDEVRNVTPDRWLTSGET 120

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           L +G H F V HCPGH+PGHV++ N  N FAH+GD LF  SIGRTD+  GD++ L+NSI 
Sbjct: 121 LSIGEHDFTVSHCPGHAPGHVVFYNEANGFAHVGDVLFAGSIGRTDLPGGDHETLLNSIR 180

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
             ++   DE+ F+CGHG  STIG+ER  NPFL
Sbjct: 181 TVLMEWPDEVQFMCGHGAPSTIGQERASNPFL 212


>gi|85713982|ref|ZP_01044971.1| beta-lactamase-like [Nitrobacter sp. Nb-311A]
 gi|85699108|gb|EAQ36976.1| beta-lactamase-like [Nitrobacter sp. Nb-311A]
          Length = 222

 Score =  234 bits (596), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 107/215 (49%), Positives = 147/215 (68%), Gaps = 1/215 (0%)

Query: 2   SKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGH 61
           +K+   ++ VTPF+QNCT L+ E +   VV+DPGGD+ ++   I+  +  V +IW+THGH
Sbjct: 9   AKVGATVIPVTPFRQNCTLLWCEATKNGVVIDPGGDIPLVMAAIKKADVSVGRIWLTHGH 68

Query: 62  VDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
           +DHVGGAA+L++ L + I GPH  D  ++  V E  R   +    RN + DRWL++GD +
Sbjct: 69  IDHVGGAAELRDTLKVPIEGPHIADKFLLDHVVESGRHYGM-TGMRNFTPDRWLEEGDRI 127

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
            LG   F V HCPGHSPG V++ N E  FAH+GD LF  S+GRTD+  G +  LI SI +
Sbjct: 128 ELGQLTFDVLHCPGHSPGSVVFFNPEMRFAHVGDVLFNGSVGRTDLPGGSHAMLIKSITD 187

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           K+LPLGD+++F+CGHGP STIGRER  NPFL  N+
Sbjct: 188 KLLPLGDDVAFICGHGPGSTIGRERVSNPFLTGNV 222


>gi|114706406|ref|ZP_01439308.1| HYDROXYACYLGLUTATHIONE HYDROLASE [Fulvimarina pelagi HTCC2506]
 gi|114538267|gb|EAU41389.1| HYDROXYACYLGLUTATHIONE HYDROLASE [Fulvimarina pelagi HTCC2506]
          Length = 215

 Score =  233 bits (595), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 105/214 (49%), Positives = 145/214 (67%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M++L+  I+ VT F+QNCT LFD+E+   VVVDPGG+ + I+  +++    V+ IW+THG
Sbjct: 1   MAQLNAQIIPVTEFQQNCTLLFDDETKTGVVVDPGGEAEKIESAVKAAGVTVEAIWLTHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DH GGA +LKE L + IIG HKDD  +M  + EQ ++  +R   RN + DRWL +GD 
Sbjct: 61  HIDHAGGAMELKELLGVDIIGSHKDDKLLMDNLAEQGKMFGLRNEIRNCTPDRWLDEGDR 120

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           +    H F+V H PGH+PGHVI+      F  +GD LF  SIGRTD+  G+++ L+ SI 
Sbjct: 121 VSFAGHEFEVLHTPGHAPGHVIFAYRAAKFIVMGDVLFNGSIGRTDLPGGNHETLLASIR 180

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           +K+LPLGD+  F+CGHGP S +G ERR NPFL  
Sbjct: 181 DKVLPLGDDFGFLCGHGPGSRLGDERRSNPFLSG 214


>gi|240850156|ref|YP_002971549.1| metallo-beta-lactamase family protein [Bartonella grahamii as4aup]
 gi|240267279|gb|ACS50867.1| metallo-beta-lactamase family protein [Bartonella grahamii as4aup]
          Length = 216

 Score =  233 bits (594), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 113/213 (53%), Positives = 145/213 (68%), Gaps = 1/213 (0%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M  L+ HI+ VT F+QNCT LFD E    V+VDPGGD   I+DVI+     V+ IWITHG
Sbjct: 1   MGSLNIHIIPVTTFQQNCTLLFDSECKTGVLVDPGGDWPRIQDVIEKNGVIVEAIWITHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H DHVG A Q KE L++ IIG H+DD  +M  V E A+   I  +A     D+WL+DG+ 
Sbjct: 61  HFDHVGAAMQAKEALNVKIIGSHRDDKPVMDAVSESAKNYDI-TDACICIPDQWLEDGEC 119

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           +    H+FKVFH PGHSPGHVIY N +   A LGD LFR SIGRTD     +++L++S+ 
Sbjct: 120 VHFAGHVFKVFHTPGHSPGHVIYFNEKERLALLGDVLFRGSIGRTDFPFCSHEKLMHSLR 179

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
            K+LPLGD++ F+CGHGP S+IG ER+ NPFL+
Sbjct: 180 EKVLPLGDDVCFICGHGPKSSIGYERQNNPFLQ 212


>gi|49473984|ref|YP_032026.1| hypothetical protein BQ03400 [Bartonella quintana str. Toulouse]
 gi|49239487|emb|CAF25840.1| hypothetical protein BQ03400 [Bartonella quintana str. Toulouse]
          Length = 217

 Score =  233 bits (594), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 113/213 (53%), Positives = 144/213 (67%), Gaps = 1/213 (0%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M+ L  HI+ VTPF+QNCT LFD E    V+VDPGGD   I++VI+     V+ IWITHG
Sbjct: 1   MTNLRTHIIPVTPFQQNCTLLFDNEQKVGVLVDPGGDWFRIQEVIRKTGIIVEAIWITHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H DHVG A Q KE L++ IIG H+DD  +M  V E A+   I  +A     D+WL+DGD+
Sbjct: 61  HFDHVGAAMQAKEALNVKIIGSHRDDKPVMASVSESAKNYGI-TDACTCIPDQWLEDGDS 119

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           +    H+F V H PGHSPGHVIY N +  FA LGD LFR SIGRTD     +++L+ S+ 
Sbjct: 120 VHFVGHVFHVLHTPGHSPGHVIYFNEKERFALLGDVLFRGSIGRTDFPFCSHKELMKSLR 179

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
            KILPLGD++ F+CGHGP S +G ER+ NPFL+
Sbjct: 180 EKILPLGDDVRFICGHGPESQLGYERQWNPFLQ 212


>gi|49475897|ref|YP_033938.1| hypothetical protein BH11740 [Bartonella henselae str. Houston-1]
 gi|49238705|emb|CAF27957.1| hypothetical protein BH11740 [Bartonella henselae str. Houston-1]
          Length = 216

 Score =  231 bits (589), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 112/213 (52%), Positives = 142/213 (66%), Gaps = 1/213 (0%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M     HI+ VT F+QNCT LFD E    V+VDPGGD   I+DVI+     V+ IWITHG
Sbjct: 1   MVSFRTHIIPVTSFQQNCTLLFDNERKVGVLVDPGGDWLQIQDVIRKNGVIVEAIWITHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H DHVG A Q KE L++ IIG H+DD  +M  V E A    I  +AR    D+WL+DGD+
Sbjct: 61  HFDHVGAAMQAKEALNVKIIGSHRDDKPVMDAVRESAESYGI-TDARICVPDQWLEDGDS 119

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           +    H+F+V+H PGHSPGHVIY N +  FA LGD LFR SIGRTD     ++ L+ S+ 
Sbjct: 120 VHFAGHVFRVYHTPGHSPGHVIYFNEKERFALLGDVLFRGSIGRTDFPFCSHKDLMKSLR 179

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
            K+LPLGD++ F+CGHGP S +G ER+ NPFL+
Sbjct: 180 EKVLPLGDDVRFICGHGPGSYLGYERQWNPFLQ 212


>gi|300023989|ref|YP_003756600.1| beta-lactamase [Hyphomicrobium denitrificans ATCC 51888]
 gi|299525810|gb|ADJ24279.1| beta-lactamase domain protein [Hyphomicrobium denitrificans ATCC
           51888]
          Length = 220

 Score =  229 bits (585), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 105/211 (49%), Positives = 143/211 (67%), Gaps = 1/211 (0%)

Query: 2   SKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGH 61
           S L   IV+VTPF+QNCT +++E S    VVDPGGDLD I   I      +++I +THGH
Sbjct: 10  SPLKAAIVRVTPFEQNCTLIWNEASKRGAVVDPGGDLDRIFRGIDEAEIEIEKILLTHGH 69

Query: 62  VDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
           +DH G AA+L+++L + I GPHK DA ++  +++Q  +  I  + RN   DRWL DGD +
Sbjct: 70  IDHAGAAAELRQELGVKIEGPHKADALLLDNLEKQGEMYGIP-DVRNVKPDRWLDDGDVV 128

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
            +  H F +FHCPGHSPG V++ +    FA +GD LFR SIGRTD  +GD+  LI++I  
Sbjct: 129 TVAGHTFNIFHCPGHSPGSVVFFDAAQRFALVGDVLFRGSIGRTDFPYGDHDALISAIKT 188

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           K+LPLGD+I+F+CGHGP    G+ER  NPFL
Sbjct: 189 KLLPLGDDIAFICGHGPPGQFGQERLTNPFL 219


>gi|319408900|emb|CBI82557.1| putative enzyme [Bartonella schoenbuchensis R1]
          Length = 214

 Score =  229 bits (584), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 111/213 (52%), Positives = 145/213 (68%), Gaps = 1/213 (0%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           MS LS HI+ VT F+QNCT LFD +S + V+VDPGGD   I+  IQ  +  ++ IWITHG
Sbjct: 1   MSNLSAHIIPVTSFQQNCTLLFDSKSKKGVLVDPGGDWPKIQATIQEISVSIEAIWITHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           HVDHVG A Q KE+L++ IIG H+ D  +M  V E+A++  +  + R    D+WL+DGD+
Sbjct: 61  HVDHVGAAMQAKEELNVKIIGSHRGDKPIMEDVIERAKVYRM-ADVRICVPDQWLEDGDS 119

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           L    H+F V H PGH+PGHVIY N +   A +GD LFR SIGRTD     ++ L+ SI 
Sbjct: 120 LDCAGHVFDVLHIPGHTPGHVIYFNKKERLALVGDVLFRGSIGRTDFPLSSHEALMTSIK 179

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
            K+LPLGD++SF+ GHG  STIG ERR N FL+
Sbjct: 180 EKVLPLGDDVSFISGHGSGSTIGYERRFNSFLQ 212


>gi|75674312|ref|YP_316733.1| beta-lactamase-like [Nitrobacter winogradskyi Nb-255]
 gi|74419182|gb|ABA03381.1| beta-lactamase-like protein [Nitrobacter winogradskyi Nb-255]
          Length = 224

 Score =  229 bits (584), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 106/215 (49%), Positives = 147/215 (68%), Gaps = 1/215 (0%)

Query: 2   SKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGH 61
           +K+   I+ VTPF+QNCT L+ E + + VV+DPGGD+ +I+  I+     V +IW+THGH
Sbjct: 9   AKVGAAIIPVTPFRQNCTLLWCEATRDGVVIDPGGDIPLIRAAIKQAGVTVGRIWLTHGH 68

Query: 62  VDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
           +DHVGGAA+L++ L + I+GPH  D  ++  V E  R   +    R+   DRWL+DGD +
Sbjct: 69  IDHVGGAAELRDALKVPIMGPHVADKFLLDHVVESGRHYGM-TGMRDFVPDRWLEDGDQV 127

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
            +G   F V HCPGHSPG V++ N + +FAH+GD LF  S+GRTD+  G    LI SI +
Sbjct: 128 EVGQLAFDVLHCPGHSPGSVVFFNADLHFAHVGDVLFNGSVGRTDLPGGSRAVLIKSITD 187

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           K+LPLGD+++F+CGHGP STIG ER  NPFL  N+
Sbjct: 188 KLLPLGDDVAFICGHGPGSTIGHERVSNPFLTGNV 222


>gi|92115864|ref|YP_575593.1| beta-lactamase-like [Nitrobacter hamburgensis X14]
 gi|91798758|gb|ABE61133.1| beta-lactamase-like protein [Nitrobacter hamburgensis X14]
          Length = 230

 Score =  229 bits (583), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 105/215 (48%), Positives = 147/215 (68%), Gaps = 1/215 (0%)

Query: 2   SKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGH 61
           +K    I+ VTPF+QNCT L+ E + +AVV+DPGGD+ +I+  I+     V++IW+THGH
Sbjct: 17  AKAGVTIIPVTPFRQNCTLLWCETTRDAVVIDPGGDVPLIRTSIEQSGVTVRRIWLTHGH 76

Query: 62  VDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
           +DHVGGAA+L++ L + I GPH  D  ++  V E  R   +    RN + DRWL++G+ +
Sbjct: 77  IDHVGGAAELRDALKVPIEGPHIADKFLLDHVVESGRGYGM-TGMRNFTPDRWLEEGEKV 135

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
            +G   F V HCPGHSPG V++ N E  FAH+GD LF  S+GRTD+  G +  LI SI +
Sbjct: 136 KIGELEFDVLHCPGHSPGSVVFFNREMRFAHVGDVLFNGSVGRTDLPGGSHATLIKSITD 195

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           K+LPLGD+++F+CGHGP S+IG ER  NPFL   +
Sbjct: 196 KLLPLGDDVAFICGHGPGSSIGHERASNPFLTDGM 230


>gi|115522261|ref|YP_779172.1| beta-lactamase domain-containing protein [Rhodopseudomonas
           palustris BisA53]
 gi|115516208|gb|ABJ04192.1| beta-lactamase domain protein [Rhodopseudomonas palustris BisA53]
          Length = 242

 Score =  228 bits (581), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 110/215 (51%), Positives = 143/215 (66%), Gaps = 1/215 (0%)

Query: 2   SKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGH 61
           +K    I+ VT F+QNCT L+ E + +AVV+DPGGD+D I   I      V++IW+THGH
Sbjct: 29  AKAGAAIIPVTLFQQNCTLLWCETTKKAVVIDPGGDVDQITAAIAQAGVTVEKIWLTHGH 88

Query: 62  VDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
           VDHVGGA +L+E L + I GPH  D  +M  V E AR   +    RN + DRWL+DG+ L
Sbjct: 89  VDHVGGADELREQLKVPIEGPHIGDQFLMDHVVESARAFGLS-GVRNVTPDRWLEDGERL 147

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
            +G   F+V HCPGHSPG V+Y N    FA +GD LF  SIGRTD+  G++  LINSI  
Sbjct: 148 RIGELSFEVLHCPGHSPGSVVYFNDAMRFAIVGDVLFAGSIGRTDLPGGNHATLINSIQT 207

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           K++PLGD++ F+ GHGP STIG+ER  NPFL   +
Sbjct: 208 KLMPLGDDVGFISGHGPGSTIGQERMTNPFLTGEM 242


>gi|146337644|ref|YP_001202692.1| metallo-hydrolase/oxidoreductase domain-containing protein
           [Bradyrhizobium sp. ORS278]
 gi|146190450|emb|CAL74449.1| putative enzyme with metallo-hydrolase/oxidoreductase domain
           (ycbL-like) [Bradyrhizobium sp. ORS278]
          Length = 222

 Score =  228 bits (581), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 104/211 (49%), Positives = 146/211 (69%), Gaps = 1/211 (0%)

Query: 2   SKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGH 61
           +K    IV VTPF+QNCT L+ E + +A+V+DPGGD+  I+  I   N  V++IW+THGH
Sbjct: 9   AKAGAMIVPVTPFEQNCTILWCEATKKAIVIDPGGDVPNIQAAIAQANVTVEKIWLTHGH 68

Query: 62  VDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
           +DHVGGAA L++ L + I GPH  D  ++  V E  +   I    R+ + DRWL++GDT+
Sbjct: 69  IDHVGGAADLRDALKVPIEGPHIADKYLLDNVVESGKRFGI-TGVRDVTPDRWLEEGDTV 127

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
            +G  +F + HCPGHSPG V++ N +  FAH+GD LF  S+GRTD+  G ++ LI+SI +
Sbjct: 128 QIGELVFDILHCPGHSPGSVVFFNKQMRFAHVGDVLFNGSVGRTDLPGGSHETLISSIKD 187

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           K+LPLGD+I F+CGHG  S+ G+ER  NPFL
Sbjct: 188 KLLPLGDDIGFICGHGAGSSFGQERMTNPFL 218


>gi|86747841|ref|YP_484337.1| Beta-lactamase-like [Rhodopseudomonas palustris HaA2]
 gi|86570869|gb|ABD05426.1| Beta-lactamase-like [Rhodopseudomonas palustris HaA2]
          Length = 222

 Score =  228 bits (580), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 104/215 (48%), Positives = 145/215 (67%), Gaps = 1/215 (0%)

Query: 2   SKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGH 61
           +K    I+ VTPF+QNCT L+ E + +AVVVDPGGD+  I   I+     V++IW+THGH
Sbjct: 9   AKAGAAIIPVTPFQQNCTLLWCEATRKAVVVDPGGDVPEILAAIEKTGVSVEKIWLTHGH 68

Query: 62  VDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
           +DHVGGAA+L++ L + I GPH+DD  ++  V    R   I    R+ ++DRWL  GD++
Sbjct: 69  IDHVGGAAELRDALKVPIEGPHRDDQFLLDNVVASGRSFGI-AGVRDVTTDRWLDQGDSV 127

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
            +G   F++ HCPGHSPG V++ N    FA +GD LF  S+GRTD+  G +  LI SI +
Sbjct: 128 SVGELTFQILHCPGHSPGSVVFFNEAMRFALVGDVLFAGSVGRTDLPGGSHATLIRSITD 187

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           K+LPLGD++ F+CGHGP S+IG+ER  NPFL   +
Sbjct: 188 KLLPLGDDVGFICGHGPGSSIGQERMTNPFLTGAM 222


>gi|39933645|ref|NP_945921.1| hydrolase [Rhodopseudomonas palustris CGA009]
 gi|39647491|emb|CAE26012.1| probable hydrolase [Rhodopseudomonas palustris CGA009]
          Length = 221

 Score =  227 bits (578), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 105/211 (49%), Positives = 141/211 (66%), Gaps = 1/211 (0%)

Query: 2   SKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGH 61
           +K    I+ VTPF+QNCT L+ E + +AVVVDPGGD+  I   I+     V  IW+THGH
Sbjct: 8   AKAGAAIIPVTPFQQNCTLLWCEATRKAVVVDPGGDVPEILAAIEKTKVDVGAIWLTHGH 67

Query: 62  VDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
           +DHVGGAA L++ L + +IGPH+DD  ++  V    R   I    R+ + DRWL DGD++
Sbjct: 68  IDHVGGAADLRDALKVEVIGPHRDDQFLLDNVVNSGRSFGID-GVRDVTPDRWLDDGDSV 126

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
            +G   F++ HCPGHSPG V++ N    FA +GD LF  S+GRTD+  G +  LI SI  
Sbjct: 127 SIGELNFQILHCPGHSPGSVVFFNDAMRFAFVGDVLFAGSVGRTDLPGGSHATLIQSITQ 186

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           K+LPLGD++ F+CGHGP S+ G+ERR NPFL
Sbjct: 187 KLLPLGDDVGFICGHGPGSSFGQERRTNPFL 217


>gi|220925685|ref|YP_002500987.1| beta-lactamase domain-containing protein [Methylobacterium nodulans
           ORS 2060]
 gi|219950292|gb|ACL60684.1| beta-lactamase domain protein [Methylobacterium nodulans ORS 2060]
          Length = 213

 Score =  226 bits (577), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 106/206 (51%), Positives = 138/206 (66%), Gaps = 1/206 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           I+ VTPF+QNCT L+ E +  A VVDPGGDLD I   ++     V++I +THGH+DH GG
Sbjct: 9   IIPVTPFQQNCTLLWCEATKRAAVVDPGGDLDRILAAVEKTGVAVEKILLTHGHIDHAGG 68

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           AA+LKE L + I GPH  D  ++ ++        I   AR  + DRWL +GDT+ +G   
Sbjct: 69  AAELKERLGVPIEGPHAADKPLLDRLPGTGAAYGIE-GARAVTPDRWLGEGDTVTIGELT 127

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
           F V HCPGHSPG V+ V+ E  FA +GD LFR S+GRTD+  GD+  LI SI  K+LPLG
Sbjct: 128 FDVLHCPGHSPGSVVLVSREARFAQVGDVLFRGSVGRTDLPGGDHAALIASIKTKLLPLG 187

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLK 213
           D+++F+ GHGP STIG ER  NPFL+
Sbjct: 188 DDLAFIPGHGPTSTIGEERLTNPFLQ 213


>gi|110634487|ref|YP_674695.1| beta-lactamase-like [Mesorhizobium sp. BNC1]
 gi|110285471|gb|ABG63530.1| beta-lactamase-like protein [Chelativorans sp. BNC1]
          Length = 215

 Score =  225 bits (574), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 109/212 (51%), Positives = 144/212 (67%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           MS L   IV VTPF+QNCT LFDEE    +VVDPGG++D I+  I+     ++ IW+THG
Sbjct: 1   MSTLRAGIVPVTPFQQNCTILFDEEEKRGIVVDPGGEVDRIRAAIEQNGLTIEAIWLTHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DH GGA  LK+ L + I+GPH+ +  ++  +  Q R+  +    R+ + DR+L +GD 
Sbjct: 61  HIDHAGGAMDLKDALGVEILGPHEAERDLLLNLAAQGRMFGLAEPVRDVTPDRFLNEGDV 120

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           +    H FKVFHCPGHSPGHV++ N    FAH+GD LF+ SIGRTD+  GD+  LI SI 
Sbjct: 121 VSFAGHSFKVFHCPGHSPGHVVFYNDAAKFAHVGDVLFQGSIGRTDLPGGDHAALIRSIK 180

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           +K+LPLGD+I F+CGHGP    G ERR NPFL
Sbjct: 181 DKLLPLGDDIGFLCGHGPGGRFGGERRTNPFL 212


>gi|253688169|ref|YP_003017359.1| beta-lactamase domain protein [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|251754747|gb|ACT12823.1| beta-lactamase domain protein [Pectobacterium carotovorum subsp.
           carotovorum PC1]
          Length = 215

 Score =  224 bits (571), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 103/212 (48%), Positives = 141/212 (66%), Gaps = 1/212 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + IV VT F QNCT L+ E++ EA +VDPGGD + IK  +      VKQI +THGH+D
Sbjct: 1   MKYQIVPVTAFSQNCTLLWCEKTNEAAIVDPGGDAEKIKRAVADAGISVKQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L E   + IIGP  +DA  +  +  Q+R+  +   A    S RWLQ+GD + L
Sbjct: 61  HVGAAAELAEHYQVAIIGPQIEDAFWLEGLPAQSRMFGLEECAPLTPS-RWLQEGDEVSL 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     VFHCPGH+PGH+++ + E+  A +GD +F   +GRTD   GD+Q LI SI NK+
Sbjct: 120 GETTLAVFHCPGHTPGHIVFFDAESRLAQVGDVIFNGGVGRTDFPQGDHQALIASIKNKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSN 215
           LPLGD+++F+ GHGP ST+G ERR NPFL+ +
Sbjct: 180 LPLGDDVTFIPGHGPMSTLGYERRTNPFLRED 211


>gi|316932038|ref|YP_004107020.1| metallo-hydrolase/oxidoreductase domain-containing protein
           [Rhodopseudomonas palustris DX-1]
 gi|315599752|gb|ADU42287.1| metallo-hydrolase/oxidoreductase domain-containing protein
           [Rhodopseudomonas palustris DX-1]
          Length = 222

 Score =  224 bits (570), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 104/211 (49%), Positives = 143/211 (67%), Gaps = 1/211 (0%)

Query: 2   SKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGH 61
           +K    I+ VTPF+QNCT L+ + + +AVVVDPGGD+  I   I++    V+ IW+THGH
Sbjct: 9   AKAGAAIIPVTPFQQNCTLLWCDTARKAVVVDPGGDVPEILAAIENTKVAVEAIWLTHGH 68

Query: 62  VDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
           +DHVGGAA L++ L + IIGPH+DD  ++  V    R   I    R+ + DRWL DGD++
Sbjct: 69  IDHVGGAADLRDALKVEIIGPHRDDQFLLDNVVNSGRSFGIG-GVRDVTPDRWLDDGDSV 127

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
            +G   F++ HCPGHSPG V++ +    FA +GD LF  S+GRTD+  G +  LI+SI  
Sbjct: 128 RVGELTFQILHCPGHSPGSVVFFSEAMRFALVGDVLFAGSVGRTDLPGGSHATLIDSITR 187

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           K+LPLGD+I F+CGHGP S+ G+ER  NPFL
Sbjct: 188 KLLPLGDDIGFICGHGPGSSFGQERLTNPFL 218


>gi|192289001|ref|YP_001989606.1| beta-lactamase domain protein [Rhodopseudomonas palustris TIE-1]
 gi|192282750|gb|ACE99130.1| beta-lactamase domain protein [Rhodopseudomonas palustris TIE-1]
          Length = 221

 Score =  224 bits (570), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 104/211 (49%), Positives = 140/211 (66%), Gaps = 1/211 (0%)

Query: 2   SKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGH 61
           +K    I+ VTPF+QNCT L+ E + +AVVVDPGGD+  I   I+     V  IW+THGH
Sbjct: 8   AKAGAAIIPVTPFQQNCTLLWCEATRKAVVVDPGGDVPEILAAIEKTKVDVGAIWLTHGH 67

Query: 62  VDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
           +DHVGGAA L++ L + +IGPH+DD  ++  V    R   I    R+ + DRWL DGD++
Sbjct: 68  IDHVGGAADLRDALKVEVIGPHRDDQFLLDNVVNSGRSFGID-GVRDVTPDRWLDDGDSV 126

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
            +G   F++ HCPGHSPG V++ N    FA +GD LF  S+GRTD+  G +  LI SI  
Sbjct: 127 SIGELNFQILHCPGHSPGSVVFFNDAMRFAFVGDVLFAGSVGRTDLPGGSHATLIQSITQ 186

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           K+LPLGD++ F+CGHGP S+ G+ER  NPFL
Sbjct: 187 KLLPLGDDVGFICGHGPGSSFGQERLTNPFL 217


>gi|16125435|ref|NP_419999.1| glyoxalase II family protein [Caulobacter crescentus CB15]
 gi|221234178|ref|YP_002516614.1| Zn-dependent hydrolase [Caulobacter crescentus NA1000]
 gi|13422507|gb|AAK23167.1| glyoxalase II family protein [Caulobacter crescentus CB15]
 gi|220963350|gb|ACL94706.1| Zn-dependent hydrolase, glyoxalase II family [Caulobacter
           crescentus NA1000]
          Length = 273

 Score =  221 bits (564), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 101/209 (48%), Positives = 142/209 (67%), Gaps = 1/209 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           I  VTP +QNCT ++  ++L+A V+DPGG++D +   I  +   +++IWITHGH+DH GG
Sbjct: 46  IAPVTPLQQNCTIVWCAKTLKAAVIDPGGEVDRLLKAIADKGLTLEKIWITHGHMDHAGG 105

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           AA+LK    + I GPHKDD   + ++ +   +  +   AR   +DRWL DGDT+ LG   
Sbjct: 106 AAELKARTGVPIEGPHKDDQFWIDRIQDSGEMYGMP-EARIFVTDRWLDDGDTVTLGETE 164

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
           F+VFHCPGH+PGHV++ + E  FA +GD LF+ SIGRTD   G++Q LI+SI  K+ PLG
Sbjct: 165 FEVFHCPGHTPGHVVFFHRETKFAQVGDVLFQGSIGRTDFPMGNHQDLIDSITQKLWPLG 224

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           +++ FV GHGP ST G ERR NPF+   +
Sbjct: 225 EDVRFVPGHGPMSTFGAERRGNPFVGDRV 253


>gi|114327594|ref|YP_744751.1| zinc-dependent hydrolase [Granulibacter bethesdensis CGDNIH1]
 gi|114315768|gb|ABI61828.1| Zn-dependent hydrolase, glyoxalase II family [Granulibacter
           bethesdensis CGDNIH1]
          Length = 225

 Score =  221 bits (563), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 103/216 (47%), Positives = 148/216 (68%), Gaps = 8/216 (3%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L   ++ VTPF+QNCT L+DEE+   VV+DPGGD+  I   I      V+ IW+THGH+D
Sbjct: 12  LRLAVIPVTPFEQNCTLLWDEETNRGVVIDPGGDVASIMAAIDHHGVLVEGIWLTHGHLD 71

Query: 64  HVGGAAQLK------EDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQD 117
           H GG  +LK        L++ + GP + D  +M  +  Q+    I    +NA+SDRWL++
Sbjct: 72  HAGGVEELKTALQDRSGLAVPVSGPDRRDQFLMDDIARQSAAYGIP-GMKNATSDRWLEE 130

Query: 118 GDTLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLIN 177
           GDTL +G H+F+V HCPGH+PGH++ ++   +FA +GD LF+ S+GRTD  +G+  +L+N
Sbjct: 131 GDTLSIGRHVFQVLHCPGHTPGHIVLIH-PAHFAIVGDVLFQGSVGRTDFPYGNTDELLN 189

Query: 178 SINNKILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           SI+ K+LPLGDE++F+CGHGP ST G ER+ NPFL+
Sbjct: 190 SIHTKLLPLGDEVAFLCGHGPGSTFGAERKSNPFLQ 225


>gi|261821334|ref|YP_003259440.1| beta-lactamase [Pectobacterium wasabiae WPP163]
 gi|261605347|gb|ACX87833.1| beta-lactamase domain protein [Pectobacterium wasabiae WPP163]
          Length = 215

 Score =  221 bits (562), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 102/212 (48%), Positives = 140/212 (66%), Gaps = 1/212 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + IV VT F QNCT L+ E++ EA +VDPGGD + IK  +      VKQI +THGH+D
Sbjct: 1   MKYQIVPVTAFSQNCTLLWCEKTNEAAIVDPGGDAEKIKHAVADAGILVKQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L E   + IIGP  +DA  +  +  Q+R+  +   A    S RWLQDGD   +
Sbjct: 61  HVGAAAELAEHYQVPIIGPQIEDAFWLEGLPAQSRMFGLEECAPLTPS-RWLQDGDEARV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     VFHCPGH+PGH+++ + E+  A +GD +F   +GRTD   GD+Q LI SI NK+
Sbjct: 120 GETTLAVFHCPGHTPGHIVFFDAESRLAQVGDVIFNGGVGRTDFPQGDHQALIASIKNKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSN 215
           LPLGD+++F+ GHGP ST+G ER+ NPFL+ +
Sbjct: 180 LPLGDDVTFIPGHGPMSTLGHERKTNPFLRED 211


>gi|227111941|ref|ZP_03825597.1| putative metallo-beta-lactamase [Pectobacterium carotovorum subsp.
           brasiliensis PBR1692]
          Length = 215

 Score =  220 bits (561), Expect = 9e-56,   Method: Compositional matrix adjust.
 Identities = 100/212 (47%), Positives = 141/212 (66%), Gaps = 1/212 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + IV VT F QNCT L+ E++ EA +VDPGGD + IK  +      VKQ+ +THGH+D
Sbjct: 1   MKYQIVPVTAFSQNCTLLWCEKTNEAAIVDPGGDAEKIKRAVADAGISVKQVLLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L E   + IIGP  +DA  +  +  Q+R+  +   A    S RWLQ+GD + +
Sbjct: 61  HVGAAAELAEHYQVAIIGPQIEDAFWLEGLPAQSRMFGLEECAPLTPS-RWLQEGDEVNV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     VFHCPGH+PGH+++ + E+  A +GD +F   +GRTD   GD+Q LI SI NK+
Sbjct: 120 GETTLAVFHCPGHTPGHIVFFDAESRLAQVGDVIFNGGVGRTDFPQGDHQALIASIKNKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSN 215
           LPLGD+++F+ GHGP ST+G ER+ NPFL+ +
Sbjct: 180 LPLGDDVTFIPGHGPMSTLGHERKTNPFLRED 211


>gi|148258837|ref|YP_001243422.1| metallo-hydrolase/oxidoreductase domain-containing protein
           [Bradyrhizobium sp. BTAi1]
 gi|146411010|gb|ABQ39516.1| putative enzyme with metallo-hydrolase/oxidoreductase domain
           [Bradyrhizobium sp. BTAi1]
          Length = 222

 Score =  220 bits (561), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 101/211 (47%), Positives = 141/211 (66%), Gaps = 1/211 (0%)

Query: 2   SKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGH 61
           +K    IV VTPF+QNCT L+ E + +A+V+DPGGD+  I+  I      V++IW+THGH
Sbjct: 9   AKAGAMIVPVTPFEQNCTILWCEATKKAIVIDPGGDVPNIQAAIAQAKVTVEKIWLTHGH 68

Query: 62  VDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
           +DHVGGAA L++ L + I GPH  D  ++  V        I    R+ + DRWL++GDT+
Sbjct: 69  IDHVGGAADLRDALKVPIEGPHIADKFLLDNVVASGARFGI-TGVRDVTPDRWLEEGDTV 127

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
            +G  +F + HCPGHSPG V++ N    FAH+GD LF  S+GRTD+  G ++ LI SI +
Sbjct: 128 EIGELVFDILHCPGHSPGSVVFFNKAMRFAHVGDVLFNGSVGRTDLPGGSHETLIRSIKD 187

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           K+LPLGD++ F+CGHG  S+ G+ER  NPFL
Sbjct: 188 KLLPLGDDVGFICGHGAGSSFGQERMTNPFL 218


>gi|90421898|ref|YP_530268.1| beta-lactamase-like [Rhodopseudomonas palustris BisB18]
 gi|90103912|gb|ABD85949.1| beta-lactamase-like [Rhodopseudomonas palustris BisB18]
          Length = 222

 Score =  219 bits (559), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 102/215 (47%), Positives = 144/215 (66%), Gaps = 1/215 (0%)

Query: 2   SKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGH 61
           +K    I+ VT F+QNCT L+ E + +AVVVDPGG++  I   I+     V++IW+THGH
Sbjct: 9   AKAGAAIIPVTLFQQNCTLLWCETTRKAVVVDPGGEVPQILAAIKQAEVTVEKIWLTHGH 68

Query: 62  VDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
           +DHVGGAA L++DL + I GPH+ D  ++  V     +  +    R+   DRWL++G+T+
Sbjct: 69  IDHVGGAADLRDDLKVPIEGPHRADKYLLNNVVTSGEMFGM-TGMRDVLPDRWLEEGETV 127

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
            +G   F + HCPGHSPG V+Y N +  FA +GD LF+ SIGRTD+  G +  L+ SI  
Sbjct: 128 SVGELSFSILHCPGHSPGSVVYFNDQMRFALVGDVLFKGSIGRTDLSGGCHATLMESITR 187

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           K+LPLGD++SF+CGHGP ST+G ER  NPFL  ++
Sbjct: 188 KLLPLGDDVSFICGHGPGSTLGHERLSNPFLTGDL 222


>gi|27376011|ref|NP_767540.1| hydrolase [Bradyrhizobium japonicum USDA 110]
 gi|27349150|dbj|BAC46165.1| bll0900 [Bradyrhizobium japonicum USDA 110]
          Length = 230

 Score =  219 bits (559), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 102/215 (47%), Positives = 144/215 (66%), Gaps = 1/215 (0%)

Query: 2   SKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGH 61
           +K    IV VT F+QNCT ++DE   +AVV+DPGGD+  I + I+     V++IW+THGH
Sbjct: 17  AKAGAIIVPVTLFEQNCTIIWDEPGKKAVVIDPGGDVPKILEAIKQTGVTVEKIWLTHGH 76

Query: 62  VDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
           +DHVGGAA+L++ L + I GPH+ D  ++  V E      +    RN + +RWL++GDT+
Sbjct: 77  IDHVGGAAELRDALKVPIEGPHQADKFLLDNVVESGARFGM-TGVRNFAPNRWLEEGDTV 135

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
            +G   F + HCPGHSPG V + N E  FAH+GD LF  S+GRTD+  G +  LI+SI  
Sbjct: 136 SIGGLQFDILHCPGHSPGSVAFFNKELRFAHVGDVLFAGSVGRTDLPGGSHATLISSIKT 195

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           K+LPLGD++ F+CGHG  S+IG+ER  NPF+   +
Sbjct: 196 KLLPLGDDVGFICGHGAGSSIGQERMTNPFITGEM 230


>gi|271500172|ref|YP_003333197.1| beta-lactamase domain-containing protein [Dickeya dadantii Ech586]
 gi|270343727|gb|ACZ76492.1| beta-lactamase domain protein [Dickeya dadantii Ech586]
          Length = 212

 Score =  219 bits (559), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 96/210 (45%), Positives = 139/210 (66%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + I+ VT F QNCT L+ E++L+A +VDPGG+ D IK  +      V QI +THGH+D
Sbjct: 1   MKYQIIPVTAFSQNCTLLWCEKTLQAAIVDPGGEADKIKQAVAQAGVTVTQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA L E     I+GP ++DA  +  +  Q+R+  +  +    +  RWL+DGDT+ +
Sbjct: 61  HVGAAAALSEYFQAPIVGPQREDAFWLDGLPAQSRMFGLN-DCPPLTPARWLEDGDTVTV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G  +  V HCPGH+PGHV++V+ +  FA +GD +FR  +GR+D   G++Q LI SI  K+
Sbjct: 120 GESVLSVLHCPGHTPGHVVFVDKQARFAQVGDVIFRGGVGRSDFPQGNHQALIASIRTKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
            PLGD+I+F+ GHGP ST G ERR NPF++
Sbjct: 180 FPLGDDIAFIPGHGPMSTFGEERRTNPFVR 209


>gi|299132887|ref|ZP_07026082.1| beta-lactamase domain protein [Afipia sp. 1NLS2]
 gi|298593024|gb|EFI53224.1| beta-lactamase domain protein [Afipia sp. 1NLS2]
          Length = 221

 Score =  219 bits (559), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 104/210 (49%), Positives = 142/210 (67%), Gaps = 1/210 (0%)

Query: 3   KLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHV 62
           K    I+ VTPF+QNC  L+ E++ +AVVVDPGGD+  I + I+     V+ IW+THGHV
Sbjct: 9   KAGATIIPVTPFQQNCMLLWCEQTKKAVVVDPGGDVLDILNAIKQAGVKVEHIWLTHGHV 68

Query: 63  DHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLL 122
           DHVGGA +L+E L + I GPH  D  ++  V + AR   +    R+ + D WL +GD + 
Sbjct: 69  DHVGGADELREHLKVPITGPHIADKFLLDHVVDSARRYGLT-GLRDVTPDTWLSEGDKVS 127

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
           +G   F++ HCPGHSPG +++ N    FA +GD LF  SIGRTD+  GD++ L+ SI +K
Sbjct: 128 VGELTFELLHCPGHSPGSMVFFNPAMKFAIMGDVLFNGSIGRTDLPGGDHETLLASIRDK 187

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           +LPLGDE+ F+CGHGP STIG+ER  NPFL
Sbjct: 188 VLPLGDEVGFICGHGPGSTIGQERLTNPFL 217


>gi|251789273|ref|YP_003003994.1| beta-lactamase domain-containing protein [Dickeya zeae Ech1591]
 gi|247537894|gb|ACT06515.1| beta-lactamase domain protein [Dickeya zeae Ech1591]
          Length = 212

 Score =  219 bits (558), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 97/212 (45%), Positives = 138/212 (65%), Gaps = 1/212 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + I+ VT F QNCT L+ E++L+A +VDPGG+ D IK  +      + QI +THGH+D
Sbjct: 1   MKYQIIPVTAFGQNCTLLWCEKTLQAAIVDPGGEADKIKQAVAQAGVTITQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG A  L E     I+GP + DA  +  +  Q+R+  +  +    +  RWL+DGDT+ L
Sbjct: 61  HVGAAVALAEHFQAPIVGPQRADAFWLDGLPAQSRMFGLS-DCPPLTPTRWLEDGDTITL 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G  +  V HCPGH+PGHV++V+  + FA +GD +FR  +GR+D   GD+Q LI SI NK+
Sbjct: 120 GESVLSVLHCPGHTPGHVVFVDKLSRFAQVGDVIFRGGVGRSDFPQGDHQALIASIRNKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSN 215
            PLGD+I+F+ GHGP ST G ERR NPF++  
Sbjct: 180 FPLGDDIAFIPGHGPMSTFGEERRTNPFVRDT 211


>gi|227329502|ref|ZP_03833526.1| putative metallo-beta-lactamase [Pectobacterium carotovorum subsp.
           carotovorum WPP14]
          Length = 215

 Score =  219 bits (558), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 100/212 (47%), Positives = 140/212 (66%), Gaps = 1/212 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + IV VT F QNCT L+ E++ EA +VDPGGD + IK  +      VKQI +THGH+D
Sbjct: 1   MKYQIVPVTAFSQNCTLLWCEKTNEAAIVDPGGDAEKIKRAVADAGISVKQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L E   + IIGP  +DA  +  +  Q+R+  +   A    S RWLQ+GD + +
Sbjct: 61  HVGAAAELAEHYQVAIIGPQIEDAFWLEGLPAQSRMFGLEECAPLTPS-RWLQEGDEVSV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     VFHCPGH+PGH+++ + E+  A +GD +F   +GRTD   GD+Q LI SI NK+
Sbjct: 120 GETTLAVFHCPGHTPGHIVFFDAESRLAQVGDVIFNGGVGRTDFPQGDHQALIASIKNKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSN 215
           LPLGD+++F+ GHGP S +G ER+ NPFL+ +
Sbjct: 180 LPLGDDVTFIPGHGPMSNLGHERKTNPFLRED 211


>gi|50121468|ref|YP_050635.1| putative metallo-beta-lactamase [Pectobacterium atrosepticum
           SCRI1043]
 gi|49611994|emb|CAG75443.1| conserved hypothetical protein [Pectobacterium atrosepticum
           SCRI1043]
          Length = 215

 Score =  219 bits (557), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 101/212 (47%), Positives = 141/212 (66%), Gaps = 1/212 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + IV VT F QNCT L+ E++ EA +VDPGGD + IK  +      VKQI +THGH+D
Sbjct: 1   MKYQIVPVTAFSQNCTLLWCEKTNEASIVDPGGDAEKIKRAVADVGISVKQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L E   + IIGP  +DA  +  +  Q+R+  +   A    S RWLQ+GD + +
Sbjct: 61  HVGAAAELAEHYQVAIIGPQIEDAFWLEGLPAQSRMFGLEECAPLTPS-RWLQEGDEVNV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     VFHCPGH+PGH+++ + E+  A +GD +F   +GRTD   GD+Q LI SI NK+
Sbjct: 120 GGTTLAVFHCPGHTPGHIVFFDAESRLAQVGDVIFNGGVGRTDFPQGDHQALIASIKNKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSN 215
           LPLGD+++F+ GHGP ST+G ER+ NPFL+ +
Sbjct: 180 LPLGDDVTFIPGHGPMSTLGHERKTNPFLRED 211


>gi|170743432|ref|YP_001772087.1| beta-lactamase domain-containing protein [Methylobacterium sp.
           4-46]
 gi|168197706|gb|ACA19653.1| beta-lactamase domain protein [Methylobacterium sp. 4-46]
          Length = 213

 Score =  219 bits (557), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 103/206 (50%), Positives = 137/206 (66%), Gaps = 1/206 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           I+ VTPF+QNCT L+ E +  A V+DPGGDLD I   I+     V++I +THGH+DH GG
Sbjct: 9   IIPVTPFQQNCTLLWCEATKRAAVIDPGGDLDRILAAIEKAGVTVEKILLTHGHIDHAGG 68

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           AA+L+E L + I GPH+ D  ++ ++        I   AR  + DRWL +GD + +G   
Sbjct: 69  AAELRERLGVIIEGPHEADKPLLDRLPGTGAAYGIE-GARAVTPDRWLAEGDVVTVGDLS 127

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
           F V HCPGHSPG V+ V+ E  FA +GD LFR S+GRTD+  GD+  LI SI  K+LPLG
Sbjct: 128 FDVLHCPGHSPGSVVLVSREARFAQVGDVLFRGSVGRTDLPGGDHAALIASIKTKLLPLG 187

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLK 213
           D++  + GHGP STIG+ER  NPFL+
Sbjct: 188 DDVVLIPGHGPTSTIGQERLDNPFLQ 213


>gi|91974616|ref|YP_567275.1| beta-lactamase-like [Rhodopseudomonas palustris BisB5]
 gi|91681072|gb|ABE37374.1| beta-lactamase-like [Rhodopseudomonas palustris BisB5]
          Length = 222

 Score =  219 bits (557), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 101/215 (46%), Positives = 144/215 (66%), Gaps = 1/215 (0%)

Query: 2   SKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGH 61
           +K    I+ VTPF+QNCT L+ E + +AVVVDPGGD+  I   I+     V++IW+THGH
Sbjct: 9   TKAGAAIIPVTPFQQNCTLLWCEATRKAVVVDPGGDVPEILAAIEKTGVSVEKIWLTHGH 68

Query: 62  VDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
           +DHVGGAA+L++ L + I GPH+DD  ++  V    R   I    R+ + DRWL  GD++
Sbjct: 69  IDHVGGAAELRDALGVQIEGPHRDDLFLLENVVNSGRSFGIG-GVRDVTPDRWLDHGDSV 127

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
            +G   F++ HCPGHSPG V++ N    FA +GD LF  S+GRTD+  G++  LI+SI +
Sbjct: 128 SVGELTFQILHCPGHSPGSVVFFNDAMRFALVGDVLFAGSVGRTDLPGGNHATLISSITD 187

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           ++LPLGD++ F+CGHG  S+ G+ER  NPFL   +
Sbjct: 188 RLLPLGDDVGFICGHGAGSSFGQERLTNPFLNGAM 222


>gi|307131494|ref|YP_003883510.1| putative metal-binding enzyme [Dickeya dadantii 3937]
 gi|306529023|gb|ADM98953.1| predicted metal-binding enzyme [Dickeya dadantii 3937]
          Length = 212

 Score =  218 bits (556), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 95/210 (45%), Positives = 141/210 (67%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + I+ VT F QNCT L+ E++L+A +VDPGG+ D IK V+      V QI +THGH+D
Sbjct: 1   MKYQIIPVTAFSQNCTLLWCEKTLQAAIVDPGGEADKIKQVVAQTGVTVTQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA L E   + I+GP + DA  +  +  Q+R+  +  +       RWL++GDT+ +
Sbjct: 61  HVGAAAALAEYFQVPIVGPQQADAFWLDGLPAQSRMFGLD-DCPPLVPTRWLEEGDTVAI 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G  +  V HCPGH+PGHV++++ +  FA +GD +FR  +GR+D   G++Q L++SI NK+
Sbjct: 120 GESVLSVLHCPGHTPGHVVFIDEQARFAQVGDVIFRGGVGRSDFPQGNHQALVDSIRNKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
            PLGD+I F+ GHGP ST+G ERR NPF++
Sbjct: 180 FPLGDDIVFIPGHGPTSTLGEERRTNPFVR 209


>gi|188581759|ref|YP_001925204.1| beta-lactamase domain protein [Methylobacterium populi BJ001]
 gi|179345257|gb|ACB80669.1| beta-lactamase domain protein [Methylobacterium populi BJ001]
          Length = 214

 Score =  218 bits (554), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 98/207 (47%), Positives = 144/207 (69%), Gaps = 1/207 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           I+ VTPF+QNCT ++D+E+    VVDPGGDLD I+  I+S+   V++I +THGH+DH GG
Sbjct: 9   IIPVTPFQQNCTLIWDDETKTGAVVDPGGDLDRIEAAIRSQGVKVEKILLTHGHIDHAGG 68

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           AA+LKE L + + GPH+ D  ++  + E      +   AR  + DRWL +GDT+ +G   
Sbjct: 69  AAELKERLGVPVEGPHEADRFLLDSLPETGANYGLE-GARAVTPDRWLDEGDTVTVGGLT 127

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
           F ++H PGHSPG V++++ +  FA +GD +F+ SIGRTD+  G ++QLI  I  K+LPLG
Sbjct: 128 FDIWHAPGHSPGSVVFMSRDARFALVGDVVFQGSIGRTDLPGGSHEQLIRMIKEKVLPLG 187

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLKS 214
           D+++F+ GHGP  T+G+ER  NPFL+ 
Sbjct: 188 DDVAFIPGHGPTGTLGQERLTNPFLQG 214


>gi|209883297|ref|YP_002287154.1| beta-lactamase domain protein [Oligotropha carboxidovorans OM5]
 gi|209871493|gb|ACI91289.1| beta-lactamase domain protein [Oligotropha carboxidovorans OM5]
          Length = 235

 Score =  216 bits (551), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 103/210 (49%), Positives = 140/210 (66%), Gaps = 1/210 (0%)

Query: 3   KLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHV 62
           K    I+ VTPF+QNCT L+ E + +A V+DPGGD+  I + I+     V+ IW+THGHV
Sbjct: 23  KAGASIIPVTPFQQNCTLLWCETTKKAAVIDPGGDVLDILNAIKQAGVKVEHIWLTHGHV 82

Query: 63  DHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLL 122
           DHVGGAA+L++ L + I GPH  D  ++  V E AR   +    R+ + D WL +GDT+ 
Sbjct: 83  DHVGGAAELRDHLKVPITGPHIADKFLLDNVVETARNYGL-TGLRDVTPDNWLNEGDTVS 141

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
           +G   F + HCPGHSPG +++ +    FA +GD LF  SIGRTD+  GD+  L+ SI +K
Sbjct: 142 VGELTFDLLHCPGHSPGSMVFFSKALKFAIMGDVLFNGSIGRTDLPGGDHATLLASIRDK 201

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           +LPLGD++ F+CGHG  STIG ERR NPFL
Sbjct: 202 VLPLGDDVGFICGHGAGSTIGHERRTNPFL 231


>gi|329890029|ref|ZP_08268372.1| metallo-beta-lactamase superfamily protein [Brevundimonas diminuta
           ATCC 11568]
 gi|328845330|gb|EGF94894.1| metallo-beta-lactamase superfamily protein [Brevundimonas diminuta
           ATCC 11568]
          Length = 233

 Score =  216 bits (550), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 96/212 (45%), Positives = 137/212 (64%), Gaps = 1/212 (0%)

Query: 2   SKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGH 61
           + +   +  VTP +QNCT ++  ++ +A V+DPGG +D I   +  R   +  IWITHGH
Sbjct: 6   APIGVFVTPVTPLQQNCTTVWCTQTKKAAVIDPGGSVDAILGEVARRGLTLDAIWITHGH 65

Query: 62  VDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
           +DH G AA+++E   L I+GPH +D   +  +  Q +   +   AR+ +  RWL DGD L
Sbjct: 66  LDHAGAAAEMQEKTGLDIVGPHPEDQFWIDLIPTQGQKYGLP-EARSFTPTRWLDDGDVL 124

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
            LG   ++VFHCPGH+PGHVI+ N E  FA +GD LF+ S+GRTD    D+Q L+ +I  
Sbjct: 125 TLGETTWEVFHCPGHTPGHVIFFNREARFAQVGDVLFQGSVGRTDFPRSDHQALLTAITT 184

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           K+ PLGD+++FV GHGP+ST G ERR NPF+ 
Sbjct: 185 KLWPLGDDVTFVPGHGPHSTFGAERRTNPFVS 216


>gi|254501195|ref|ZP_05113346.1| metallo-beta-lactamase superfamily, putative [Labrenzia alexandrii
           DFL-11]
 gi|222437266|gb|EEE43945.1| metallo-beta-lactamase superfamily, putative [Labrenzia alexandrii
           DFL-11]
          Length = 232

 Score =  215 bits (547), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 99/212 (46%), Positives = 141/212 (66%), Gaps = 1/212 (0%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M  +   IV VT F+QNC+ +++  ++   VVDPGGD+D I   ++ +   V++I +THG
Sbjct: 21  MPPIQIMIVPVTGFQQNCSVIWNPATMVGAVVDPGGDVDTIMAAVKEKGVKVEKIVLTHG 80

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DH+GGAA L E LS+ + GPH+ D  ++ +V +QA    +   A+  S D+W+Q+GD 
Sbjct: 81  HIDHIGGAADLAERLSVPVEGPHEADQPLIDRVADQAAQFGMG-EAKPVSPDKWMQEGDV 139

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           L +    F V HCPGHSPGH+++++ E   A  GD LF  SIGRTD+  G ++ LI SI 
Sbjct: 140 LTMAGREFDVLHCPGHSPGHLVFIDKELRLAISGDVLFAGSIGRTDLPGGSHETLIKSIT 199

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
            K+LPLGD+ISF+ GHGP ST G ER+ NPFL
Sbjct: 200 EKLLPLGDDISFLPGHGPASTFGHERQTNPFL 231


>gi|167645553|ref|YP_001683216.1| beta-lactamase domain-containing protein [Caulobacter sp. K31]
 gi|167347983|gb|ABZ70718.1| beta-lactamase domain protein [Caulobacter sp. K31]
          Length = 237

 Score =  214 bits (546), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 99/205 (48%), Positives = 137/205 (66%), Gaps = 1/205 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           I  VTP +QNCT ++  ++L+A V+DPGG++  +   ++ +   +++IWITHGH+DH GG
Sbjct: 10  IAPVTPLQQNCTIVWCAKTLKAAVIDPGGEVPRLMKALEDQGLTLEKIWITHGHMDHAGG 69

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           AA+LK    + I GPHKDD   + ++        I   AR   +DRWL DGD + LG   
Sbjct: 70  AAELKRLTGVPIEGPHKDDQFWIDQIQSTGERYGIP-EARIFVTDRWLDDGDVVTLGETQ 128

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
           F+V HCPGH+PGHVI+ N E  FA +GD LF+ SIGRTD   G++Q L+++I  K+ PLG
Sbjct: 129 FEVLHCPGHTPGHVIFFNREARFAQVGDVLFKGSIGRTDFPRGNHQDLLDAITGKLWPLG 188

Query: 188 DEISFVCGHGPNSTIGRERRLNPFL 212
           D++ FV GHGP ST G ERR NPF+
Sbjct: 189 DDVQFVPGHGPMSTFGAERRSNPFV 213


>gi|23009016|ref|ZP_00050224.1| COG0491: Zn-dependent hydrolases, including glyoxylases
           [Magnetospirillum magnetotacticum MS-1]
          Length = 214

 Score =  214 bits (546), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 97/207 (46%), Positives = 145/207 (70%), Gaps = 1/207 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           I+ VTPF+QNCT ++D+ +    VVDPGGDLD I+  I+S+   V++I +THGH+DH GG
Sbjct: 9   IIPVTPFQQNCTLIWDDATKVGAVVDPGGDLDRIEAAIRSQGVTVEKILLTHGHIDHAGG 68

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           AA+LKE L + + GPH+ D  ++  + E      +   AR  + DRWL +GDT+ +G   
Sbjct: 69  AAELKERLGVPVEGPHEADRYLLDSLPETGASYGLD-GARAVTPDRWLDEGDTVHVGGLT 127

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
           F + H PGHSPG V++++ +  FA +GD +F+ SIGRTD+  G+++QLI +I +K+LPLG
Sbjct: 128 FDILHAPGHSPGSVVFMSRDARFALVGDVVFQGSIGRTDLPGGNHEQLIRAIKDKVLPLG 187

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLKS 214
           D+++F+ GHGP  T+G+ER  NPFL+ 
Sbjct: 188 DDVAFIPGHGPTGTLGQERLSNPFLQG 214


>gi|294636883|ref|ZP_06715213.1| metallo-beta-lactamase family protein [Edwardsiella tarda ATCC
           23685]
 gi|291089913|gb|EFE22474.1| metallo-beta-lactamase family protein [Edwardsiella tarda ATCC
           23685]
          Length = 229

 Score =  214 bits (545), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 99/211 (46%), Positives = 140/211 (66%), Gaps = 1/211 (0%)

Query: 3   KLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHV 62
           K+ +HI+ VT F+QNCT L+ E++ EA VVDPGG+   I   I +R+  V QI +THGH+
Sbjct: 14  KMKYHIIPVTAFQQNCTLLWCEQTREAAVVDPGGESAKILREIAARDLTVTQILLTHGHI 73

Query: 63  DHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLL 122
           DHVG AA+L + LS+ I GP ++D   + ++ +QA +     + +     RWLQ GD L 
Sbjct: 74  DHVGAAARLAQTLSVPIYGPQQEDQYWLEQLSQQADMFGF-TDCQPFMPTRWLQQGDELT 132

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
           +G     V HCPGH+PGHV+Y   +   A +GD LFR SIGR+D   G++Q LINSI  +
Sbjct: 133 VGKERLAVLHCPGHTPGHVVYFCEQARLAQVGDVLFRGSIGRSDFAGGNHQDLINSIWTR 192

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           +  LGD+++F+ GHGP STIG ERR NP+++
Sbjct: 193 LFTLGDDVAFIPGHGPMSTIGEERRSNPYVR 223


>gi|254417839|ref|ZP_05031563.1| metallo-beta-lactamase superfamily, putative [Brevundimonas sp.
           BAL3]
 gi|196184016|gb|EDX78992.1| metallo-beta-lactamase superfamily, putative [Brevundimonas sp.
           BAL3]
          Length = 233

 Score =  214 bits (545), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 96/212 (45%), Positives = 137/212 (64%), Gaps = 1/212 (0%)

Query: 2   SKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGH 61
           S +   +  VTP +QNCT ++   + +A V+DPGG +D +   ++ R   + QIWITHGH
Sbjct: 6   SPIGVFVTPVTPLQQNCTTVWCTATNKAAVIDPGGAVDAVLGEVERRGLTIDQIWITHGH 65

Query: 62  VDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
           +DH GGAA+++E   + I GP K D   + ++ E  R+  +  +AR  + DRWL+DGDT+
Sbjct: 66  LDHAGGAAEMQEKTGVQITGPQKADQFWIDRIVESGRMYGL-PDARPFTPDRWLEDGDTV 124

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
            LG   ++V HCPGH+PGHVI+ N    FA +GD LF+ S+GRTD    D   LI ++  
Sbjct: 125 SLGETTWEVRHCPGHTPGHVIFFNRAARFAQVGDVLFKGSVGRTDFPMSDPPALIRAVVE 184

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           K+ PLGD+++FV GHGP ST G ERR NPF+ 
Sbjct: 185 KLWPLGDDVTFVPGHGPISTFGEERRTNPFVS 216


>gi|170746764|ref|YP_001753024.1| beta-lactamase domain-containing protein [Methylobacterium
           radiotolerans JCM 2831]
 gi|170653286|gb|ACB22341.1| beta-lactamase domain protein [Methylobacterium radiotolerans JCM
           2831]
          Length = 214

 Score =  213 bits (542), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 97/206 (47%), Positives = 143/206 (69%), Gaps = 1/206 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           I+ VTPF+QNCT ++D+ +    VVDPGGDLD I+  I+ +   V++I +THGHVDH  G
Sbjct: 9   IIPVTPFQQNCTLIWDDATKVGAVVDPGGDLDRIEAAIREQGVTVEKILLTHGHVDHAAG 68

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           A +L+E L + I GPH+ D  ++  + E A    +   AR  + DRWL +GD + +G   
Sbjct: 69  ADELRERLGVPIEGPHQADKFLLDSLPETAANYGLGA-ARPVTPDRWLDEGDAVTVGGLA 127

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
           F + HCPGHSPG V++V+ +  FA +GD +F+ S+GRTD+  G+++QLI++I  K+LPLG
Sbjct: 128 FDILHCPGHSPGSVVFVSRDARFALVGDVVFKGSVGRTDLPGGNHEQLIHAIKEKVLPLG 187

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLK 213
           D+++F+ GHGP ST+G ER  NPFL+
Sbjct: 188 DDVAFIPGHGPTSTLGAERVSNPFLQ 213


>gi|163851997|ref|YP_001640040.1| beta-lactamase domain-containing protein [Methylobacterium
           extorquens PA1]
 gi|218530750|ref|YP_002421566.1| beta-lactamase [Methylobacterium chloromethanicum CM4]
 gi|254561719|ref|YP_003068814.1| metal-binding hydrolase [Methylobacterium extorquens DM4]
 gi|163663602|gb|ABY30969.1| beta-lactamase domain protein [Methylobacterium extorquens PA1]
 gi|218523053|gb|ACK83638.1| beta-lactamase domain protein [Methylobacterium chloromethanicum
           CM4]
 gi|254268997|emb|CAX24958.1| putative metal-binding hydrolase [Methylobacterium extorquens DM4]
          Length = 214

 Score =  213 bits (541), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 95/207 (45%), Positives = 143/207 (69%), Gaps = 1/207 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           I+ VTPF+QNCT ++D+ +    VVDPGGDLD I+  I+++   V++I +THGH+DH GG
Sbjct: 9   IIPVTPFQQNCTLIWDDATKVGAVVDPGGDLDRIEAAIRAQGVTVEKILLTHGHIDHAGG 68

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           AA+LKE L + + GPH+ D  ++  + E      I   AR  + DRWL +G+T+ +G   
Sbjct: 69  AAELKERLGVPVEGPHEADKFLLDSLPETGASYGID-GARAITPDRWLNEGETVTVGGLT 127

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
           F ++H PGHSPG V++++ +  FA +GD +F+ S+GRTD+  G ++QLI  I  K+LPLG
Sbjct: 128 FDIWHAPGHSPGSVVFMSRDARFALVGDVVFQGSVGRTDLPGGSHEQLIRMIREKVLPLG 187

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLKS 214
           D+++F+ GHGP  T+G+ER  NPFL+ 
Sbjct: 188 DDVAFIPGHGPTGTLGQERMTNPFLQG 214


>gi|240139125|ref|YP_002963600.1| putative metal-binding hydrolase [Methylobacterium extorquens AM1]
 gi|240009097|gb|ACS40323.1| putative metal-binding hydrolase [Methylobacterium extorquens AM1]
          Length = 214

 Score =  212 bits (539), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 95/207 (45%), Positives = 143/207 (69%), Gaps = 1/207 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           I+ VTPF+QNCT ++D+ +    VVDPGGDLD I+  I+++   V++I +THGH+DH GG
Sbjct: 9   IIPVTPFQQNCTLIWDDATKVGAVVDPGGDLDRIEAAIRAQGVTVEKILLTHGHIDHAGG 68

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           AA+LKE L + + GPH+ D  ++  + E      I   AR  + DRWL +G+T+ +G   
Sbjct: 69  AAELKERLGVPVEGPHEADKFLLDSLPETGVSYGID-GARAITPDRWLNEGETVTVGGLT 127

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
           F ++H PGHSPG V++++ +  FA +GD +F+ S+GRTD+  G ++QLI  I  K+LPLG
Sbjct: 128 FDIWHAPGHSPGSVVFMSRDARFALVGDVVFQGSVGRTDLPGGSHEQLIRMIREKVLPLG 187

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLKS 214
           D+++F+ GHGP  T+G+ER  NPFL+ 
Sbjct: 188 DDVAFIPGHGPTGTLGQERMTNPFLQG 214


>gi|302382851|ref|YP_003818674.1| beta-lactamase [Brevundimonas subvibrioides ATCC 15264]
 gi|302193479|gb|ADL01051.1| beta-lactamase domain protein [Brevundimonas subvibrioides ATCC
           15264]
          Length = 242

 Score =  211 bits (538), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 95/212 (44%), Positives = 133/212 (62%), Gaps = 1/212 (0%)

Query: 2   SKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGH 61
           S +   +  VTP +QNCT ++   +++A V+DPGG +DI+   I  R   + QIWITHGH
Sbjct: 15  SPVGVFVTPVTPLQQNCTTVWCTATMKAAVIDPGGSVDIVMGEIARRGLTLDQIWITHGH 74

Query: 62  VDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
           +DH GGAA++ E     I+GPH  D   +  +  Q ++  +   AR     RWL +GDT+
Sbjct: 75  LDHAGGAAEMAEKSGAPIVGPHPADQFWIDGIPAQGQMYGLP-EARTFVPTRWLDEGDTV 133

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
            LG   + V HCPGH+PGHVI+ N +  FA +GD LF+ S+GRTD    D   L+ S+  
Sbjct: 134 ELGETTWDVRHCPGHTPGHVIFYNAKARFAQVGDVLFKGSVGRTDFPQSDPDALVRSVVE 193

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           K+ PLGD+++FV GHGP ST+G ERR NPF+ 
Sbjct: 194 KLWPLGDDVTFVPGHGPISTLGEERRTNPFVS 225


>gi|254470479|ref|ZP_05083883.1| hydrolase [Pseudovibrio sp. JE062]
 gi|211960790|gb|EEA95986.1| hydrolase [Pseudovibrio sp. JE062]
          Length = 221

 Score =  211 bits (537), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 99/213 (46%), Positives = 144/213 (67%), Gaps = 1/213 (0%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           +S +   +V VT F+QNC+ ++++ + +AVVVDPGGD+D I   ++     V+ I ITHG
Sbjct: 10  LSGIQITVVPVTAFQQNCSIVWNKNTQKAVVVDPGGDVDHILAALKELGVTVEHILITHG 69

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DH+GGAA+L E L + +IGPH+ D  ++ +V++QA+   +    R    D+WL +GD 
Sbjct: 70  HIDHIGGAAELAETLGVKVIGPHEADRPLIDRVEDQAKQFGLDA-VRKVEPDQWLVEGDV 128

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           +  G   F+V HCPGH+PGHV++ N +   A  GD LF  SIGRTD+  GD+  LI SI 
Sbjct: 129 VTAGGAEFQVLHCPGHAPGHVVFYNTDLKLAISGDVLFAGSIGRTDLPGGDHDTLIASIK 188

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
            K+LPLGD+I+F+ GHGP S++G ER  NP+LK
Sbjct: 189 EKLLPLGDDITFLPGHGPASSLGHERLNNPYLK 221


>gi|292492147|ref|YP_003527586.1| beta-lactamase [Nitrosococcus halophilus Nc4]
 gi|291580742|gb|ADE15199.1| beta-lactamase domain protein [Nitrosococcus halophilus Nc4]
          Length = 212

 Score =  211 bits (537), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 99/212 (46%), Positives = 136/212 (64%), Gaps = 1/212 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + F I+ VT F QNCT L  EE+ +A VVDPGGDLD I + +++    +++I +THGH+D
Sbjct: 1   MKFEILPVTRFMQNCTLLGCEETGKAAVVDPGGDLDQILEKVEASQLKIEKILVTHGHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GG  +L   L + I GP  +D   +  +  Q+ +      A     DRWL+ GDT+  
Sbjct: 61  HAGGVTELARRLDVPIEGPQIEDKFWIDSLPSQSEMFGFP-PAEAFVPDRWLEQGDTVSF 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G  +  V+HCPGH+PGHVI+ + +++ A +GD LF+ SIGRTD   GDY  LI SI  ++
Sbjct: 120 GKVVLNVYHCPGHTPGHVIFFHLDSHLALVGDVLFQGSIGRTDFPRGDYDALIRSIRERL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSN 215
           LPLGDE+ F+ GHGP ST G ERR NPFL+ N
Sbjct: 180 LPLGDEVRFIPGHGPMSTFGEERRSNPFLREN 211


>gi|54309516|ref|YP_130536.1| glyoxylase II family protein [Photobacterium profundum SS9]
 gi|46913952|emb|CAG20734.1| hypothetical glyoxylase II family protein [Photobacterium profundum
           SS9]
          Length = 236

 Score =  210 bits (535), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 98/213 (46%), Positives = 139/213 (65%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L F IV VTPF+QNC+ ++ +E+ EA +VDPGGD+ ++K  +Q    +V Q+ +THGH+D
Sbjct: 22  LQFEIVPVTPFQQNCSIVWCDETKEAAIVDPGGDIHLLKAKVQQLGLNVTQLLLTHGHLD 81

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVGG A L  +L + IIGPHKDDA  +  +  Q+ +    +    A + +WL +GD + +
Sbjct: 82  HVGGTAPLAAELDVPIIGPHKDDAFWLEGLPRQSEMFGFPLTEAFAPT-QWLSEGDEITI 140

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V H PGH+PGHVI  N +   A +GD LF+  +GRTD   GDYQ LI+SI  K+
Sbjct: 141 GNQKLQVIHTPGHTPGHVILFNDDAKVAFVGDVLFKGGVGRTDFDQGDYQTLIDSIKGKL 200

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            PLG++++FV GHGP ST G ER  NPF+   +
Sbjct: 201 WPLGNDVTFVPGHGPLSTFGHERVSNPFVADEM 233


>gi|120555435|ref|YP_959786.1| beta-lactamase domain-containing protein [Marinobacter aquaeolei
           VT8]
 gi|120325284|gb|ABM19599.1| beta-lactamase domain protein [Marinobacter aquaeolei VT8]
          Length = 215

 Score =  210 bits (534), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 99/209 (47%), Positives = 135/209 (64%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L + IV VTPF+QNCT L+  E+ +A VVDPGGDLD I    +     ++++ +TH H+D
Sbjct: 3   LKYKIVPVTPFEQNCTLLWCTETHKAAVVDPGGDLDRILAAAEDEGVILEKVLLTHAHID 62

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GG A+L +   L I GPHKDD   +  +  QA++          + DRWL+DGDT+ +
Sbjct: 63  HAGGTAELAKSAGLPIEGPHKDDNFWIQGLAMQAQMFGFPA-PEVFTPDRWLEDGDTVTV 121

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V H PGH+PGHV++ +  +  A +GD LF  SIGRTD   GDY  LI+SI  K+
Sbjct: 122 GNETLEVLHTPGHTPGHVVFFHRGSKLAQVGDVLFNGSIGRTDFPKGDYNTLIHSIREKL 181

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
            PLGD++SF+CGHGP ST G+ER  NPF+
Sbjct: 182 FPLGDDVSFICGHGPMSTFGQERATNPFV 210


>gi|121592662|ref|YP_984558.1| beta-lactamase domain-containing protein [Acidovorax sp. JS42]
 gi|120604742|gb|ABM40482.1| beta-lactamase domain protein [Acidovorax sp. JS42]
          Length = 212

 Score =  210 bits (534), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 95/209 (45%), Positives = 138/209 (66%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L +H V VTPF+QNC+ ++ +++ +A V+DPGGDLD++    Q    H+K IW+TH H+D
Sbjct: 2   LQYHTVPVTPFQQNCSLVWCDQTQDAAVIDPGGDLDVLLAEAQRLGLHLKAIWLTHAHID 61

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GG  +L + L L IIGPH+ D   +  + +Q+ +      A+  +  RWL DGDT+ +
Sbjct: 62  HAGGTGELAQRLHLPIIGPHEGDQYWIDGLAQQSAMFGF-APAQPFTPTRWLHDGDTVAI 120

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGH+PGHV++   + + A +GD LF  SIGRTD   G++QQLI+SI  ++
Sbjct: 121 GHESLSVRHCPGHTPGHVVFHAPQIDRAFVGDVLFAGSIGRTDFPGGNHQQLIDSITQRL 180

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
            P+GD+  F+ GHGP ST GRERR NP++
Sbjct: 181 WPMGDQTVFIPGHGPESTFGRERRSNPYV 209


>gi|227356809|ref|ZP_03841194.1| zinc (Zn2+)-dependent hydrolase [Proteus mirabilis ATCC 29906]
 gi|227163099|gb|EEI48034.1| zinc (Zn2+)-dependent hydrolase [Proteus mirabilis ATCC 29906]
          Length = 215

 Score =  210 bits (534), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 95/212 (44%), Positives = 143/212 (67%), Gaps = 2/212 (0%)

Query: 6   FHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHV 65
           +HI+ VT + QNCT ++ ++S EA +VDPGGD++ +   I+ R   + ++ +THGH DHV
Sbjct: 2   YHIIPVTNYMQNCTLIWCDDSKEAAIVDPGGDVETLIAEIEQRQLKLTKVLLTHGHFDHV 61

Query: 66  GGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGT 125
            G AQ+ E   + + GPHKDD  ++  +++Q R+ +   + ++ + D+WL +GDT+ +G 
Sbjct: 62  AGTAQIVEHFHVPVYGPHKDDNFLIEDLEQQCRMFNFP-SGKSFTPDQWLNEGDTVTIGK 120

Query: 126 HI-FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKIL 184
            I   V HCPGH+PGH+I+VN +N    +GD LFR SIGRTD   G++  LI SI NK+L
Sbjct: 121 TINLSVLHCPGHTPGHIIFVNHQNKLISMGDVLFRESIGRTDFPRGNHADLIASIKNKVL 180

Query: 185 PLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           PLGD+  F+ GHGP S +G ER+ NPFL+  +
Sbjct: 181 PLGDDYLFIPGHGPMSNLGHERQYNPFLQDEM 212


>gi|118591838|ref|ZP_01549233.1| probable hydrolase [Stappia aggregata IAM 12614]
 gi|118435481|gb|EAV42127.1| probable hydrolase [Stappia aggregata IAM 12614]
          Length = 229

 Score =  209 bits (533), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 96/212 (45%), Positives = 139/212 (65%), Gaps = 1/212 (0%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M  +   ++ VTPF+QNC+ ++D  ++   VVDPGGD+D I   ++ +   V++I +THG
Sbjct: 18  MPPIQVMVLAVTPFQQNCSLIWDPSTMRGTVVDPGGDVDKILAAVKKQGVKVEKIVLTHG 77

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DHVGGAA L E L + + GPH+ D  ++ +V +QA    +    +  + DRW+ +GD 
Sbjct: 78  HIDHVGGAADLAEALKVPVEGPHEADQMLIDRVADQAVQFGVE-GVKPVTPDRWMVEGDQ 136

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           + +   +F V HCPGHSPGH+++ + E  FA  GD LF  SIGRTD+  GD+  LI SI 
Sbjct: 137 VEIAGRMFDVLHCPGHSPGHLVFFDKELRFAISGDVLFAGSIGRTDLPGGDHATLIKSIR 196

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
            K+LPLGD+++F+ GHG  STIG ER  NPFL
Sbjct: 197 EKLLPLGDDVAFLPGHGQASTIGHERETNPFL 228


>gi|307944230|ref|ZP_07659571.1| beta-lactamase domain protein [Roseibium sp. TrichSKD4]
 gi|307772576|gb|EFO31796.1| beta-lactamase domain protein [Roseibium sp. TrichSKD4]
          Length = 229

 Score =  209 bits (533), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 97/210 (46%), Positives = 139/210 (66%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +S  ++ VTPF+QNC+ ++  E+ +  VVDPGGD++ I  VI+     V++I +THGH+D
Sbjct: 21  VSIVVIPVTPFQQNCSLIWSPETKKGAVVDPGGDVETIVKVIKEYGVEVEKIILTHGHID 80

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+GGAA L   L + +IGPHK D  ++ +V +QA+   +  + +    D WL +GD +  
Sbjct: 81  HIGGAADLAAQLGVKVIGPHKADEPLIERVADQAKQFGLP-DVKPVRPDEWLDEGDMVEF 139

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
               F+V HCPGH+PGHV++ + +  FA  GD LF  SIGRTD+  GD+  LI SI  K+
Sbjct: 140 AGRNFEVLHCPGHAPGHVVFFDRDLRFAFSGDVLFAGSIGRTDLPLGDHDTLIRSIKEKM 199

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           LPLGD++SF+ GHG  STIG ER+ NPF K
Sbjct: 200 LPLGDDVSFLPGHGEASTIGHERQTNPFFK 229


>gi|329850773|ref|ZP_08265618.1| metallo-beta-lactamase superfamily protein [Asticcacaulis
           biprosthecum C19]
 gi|328841088|gb|EGF90659.1| metallo-beta-lactamase superfamily protein [Asticcacaulis
           biprosthecum C19]
          Length = 230

 Score =  209 bits (533), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 100/213 (46%), Positives = 141/213 (66%), Gaps = 2/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +   I  VTP +QNCT ++  ++ +A ++DPGGDLD I + I++R   V++IWITHGH D
Sbjct: 8   IRLFIAPVTPLQQNCTVVWCTKTNKAAIIDPGGDLDPILEEIKARGLTVEKIWITHGHAD 67

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GGAA+LKE   ++I GPH+DD   +  +    +   I  N R+ ++DRWL+DGDT+ L
Sbjct: 68  HAGGAAELKERTGVSIEGPHEDDQFWIDNIPSMGQRYGI-ANMRSFTTDRWLKDGDTVTL 126

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   + V HCPGH+PGHVI+ +  + FA +GD LF  SIGRTD   G++  LI+SI  K+
Sbjct: 127 GETTWDVIHCPGHTPGHVIFYHAPSQFAQVGDVLFAGSIGRTDFPRGNHADLIHSITQKL 186

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            PLGD + FV GHGP S+  +ER  NPF+   +
Sbjct: 187 WPLGD-VRFVPGHGPMSSFHQERLGNPFVGDRV 218


>gi|183598379|ref|ZP_02959872.1| hypothetical protein PROSTU_01771 [Providencia stuartii ATCC 25827]
 gi|188020555|gb|EDU58595.1| hypothetical protein PROSTU_01771 [Providencia stuartii ATCC 25827]
          Length = 215

 Score =  209 bits (533), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 93/213 (43%), Positives = 140/213 (65%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++ I+ VTPF+QNC  ++DE ++EAV+VDPGG+ + +   I+ R   + +I +THGH D
Sbjct: 1   MNYMIIPVTPFQQNCQVIWDENTMEAVIVDPGGEAEKLIAAIEERGLKLTKILLTHGHAD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G  A + +  S  I GP K+DA  +  + EQ  + +I     + + D WL++G T+  
Sbjct: 61  HIGATAIISKHFSAPIYGPQKEDAFWIEALAEQHAMFNIE-GGPSFTPDYWLEEGQTVHC 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           GT  F V HCPGH+PGH+I+VN  +    +GD LF+  +GR+D   GD+Q LI SI NK+
Sbjct: 120 GTMAFDVLHCPGHTPGHIIFVNHADKLISMGDVLFKGGVGRSDFPRGDHQALIASIKNKV 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           LPLGD+  F+ GHGP S +G ER+ NPFL+ ++
Sbjct: 180 LPLGDDYQFIPGHGPMSDLGHERKTNPFLQDDL 212


>gi|197284626|ref|YP_002150498.1| metallo-beta-lactamase superfamily protein [Proteus mirabilis
           HI4320]
 gi|194682113|emb|CAR41707.1| metallo-beta-lactamase superfamily protein [Proteus mirabilis
           HI4320]
          Length = 216

 Score =  209 bits (532), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 94/214 (43%), Positives = 144/214 (67%), Gaps = 2/214 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + +HI+ VT + QNCT ++ +++ EA +VDPGGD++ +   I+ R   + ++ +THGH D
Sbjct: 1   MMYHIIPVTNYMQNCTVIWCDDTKEAAIVDPGGDVETLIAEIEQRQLKLTKVLLTHGHFD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HV G AQ+ E   + + GPHKDD  ++  +++Q R+ +   + ++ + D+WL +GDT+ +
Sbjct: 61  HVAGTAQIVEHFHVPVYGPHKDDNFLIEDLEQQCRMFNFP-SGKSFTPDQWLNEGDTVTI 119

Query: 124 GTHI-FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
           G  I   V HCPGH+PGH+I+VN +N    +GD LFR SIGRTD   G++  LI SI NK
Sbjct: 120 GKTITLSVLHCPGHTPGHIIFVNHQNKLISMGDVLFRESIGRTDFPRGNHADLIASIKNK 179

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           +LPLGD+  F+ GHGP S +G ER+ NPFL+  +
Sbjct: 180 VLPLGDDYLFIPGHGPMSNLGHERQYNPFLQDEM 213


>gi|149925325|ref|ZP_01913589.1| beta-lactamase-like protein [Limnobacter sp. MED105]
 gi|149825442|gb|EDM84650.1| beta-lactamase-like protein [Limnobacter sp. MED105]
          Length = 214

 Score =  209 bits (532), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 91/210 (43%), Positives = 142/210 (67%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L +H + VTPF QNC+ ++  E+ +A ++DPGGDLD +   I  RN  ++ IW+TH H+D
Sbjct: 2   LRYHTIPVTPFAQNCSIVWCSETNKAAIIDPGGDLDQLTKAIADRNLELQAIWLTHAHID 61

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GG A+L   L+L IIGPH+ D   + ++ +Q+R+ +  + ++  + +RWL DGDT+ +
Sbjct: 62  HAGGVAELAAKLNLPIIGPHEGDQFWIDRLADQSRMFNFPL-SKPFTPNRWLADGDTVQI 120

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGH+PGHV++ + E   A +GD LF  S+GRTD   GD++ LI+SI N++
Sbjct: 121 GNCTLNVRHCPGHTPGHVVFHSEEAKRAFVGDVLFVGSMGRTDFPGGDHETLIDSIRNRL 180

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
            P+G++  F+ GHGP  + G+ERR NP+++
Sbjct: 181 WPMGNDTVFIPGHGPEGSFGQERRSNPYVR 210


>gi|90414500|ref|ZP_01222475.1| hypothetical glyoxylase II family protein [Photobacterium profundum
           3TCK]
 gi|90324408|gb|EAS40970.1| hypothetical glyoxylase II family protein [Photobacterium profundum
           3TCK]
          Length = 217

 Score =  209 bits (532), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 97/214 (45%), Positives = 139/214 (64%), Gaps = 1/214 (0%)

Query: 3   KLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHV 62
            L F IV VTPF+QNC+ ++ +E+ +A +VDPGGD+ ++K  +Q    +V Q+ +THGH+
Sbjct: 2   SLQFEIVPVTPFQQNCSIVWCDETKDAAIVDPGGDIHLLKAKVQQLGLNVTQLLLTHGHL 61

Query: 63  DHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLL 122
           DHVGG A L  +L + IIGPHKDDA  +  +  Q+ +    +    A + +WL +GD + 
Sbjct: 62  DHVGGTAPLAAELDVPIIGPHKDDAFWLEGLPRQSEMFGFPLTEAFAPT-QWLSEGDEIT 120

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
           +G    +V H PGH+PGHVI  N +   A +GD LF+  +GRTD   GDYQ LI+SI  K
Sbjct: 121 VGNQKLQVIHTPGHTPGHVILFNDDAKVAFVGDVLFKGGVGRTDFPQGDYQTLIDSIKGK 180

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           + PLG++++FV GHGP ST G ER  NPF+   +
Sbjct: 181 LWPLGNDVTFVPGHGPLSTFGNERVSNPFVADEM 214


>gi|254787816|ref|YP_003075245.1| Zn-dependent Hydrolase, including glyoxylase [Teredinibacter
           turnerae T7901]
 gi|237684880|gb|ACR12144.1| Zn-dependent Hydrolase, including glyoxylase [Teredinibacter
           turnerae T7901]
          Length = 215

 Score =  209 bits (531), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 97/212 (45%), Positives = 138/212 (65%), Gaps = 1/212 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L + I  VTP++QNC+ ++ +++  A V+DPGGD+  I  ++   + HV++I +THGH+D
Sbjct: 2   LQYRIQPVTPYQQNCSVIWCDQTGSAAVIDPGGDIASITGLLDRLDIHVEKIILTHGHLD 61

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVGG A+LK  L + +IGPH+ D   +  + +QAR+++        + DRWL DGD + L
Sbjct: 62  HVGGTAELKAALEVPVIGPHQGDGFWLSALADQARMMNF-APVPPFNPDRWLNDGDQIAL 120

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGHV+     +  A +GD LF  SIGRTD   GD+  LI SI  K+
Sbjct: 121 GKLTLEVLHCPGHTPGHVVLFEKHSKMAFVGDVLFAGSIGRTDFPRGDHASLIASIREKL 180

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSN 215
            PLGD+I+FV GHGP ST G ERR NPF+  +
Sbjct: 181 FPLGDDITFVPGHGPTSTFGEERRTNPFVSDS 212


>gi|269139500|ref|YP_003296201.1| metallo-beta-lactamase superfamily protein [Edwardsiella tarda
           EIB202]
 gi|267985161|gb|ACY84990.1| metallo-beta-lactamase superfamily protein [Edwardsiella tarda
           EIB202]
 gi|304559389|gb|ADM42053.1| Hypothetical metal-binding enzyme [Edwardsiella tarda FL6-60]
          Length = 215

 Score =  209 bits (531), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 96/210 (45%), Positives = 139/210 (66%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + +HI+ VT F+QNCT L+ E + EA +VDPGG+   I   I +R+  V QI +THGH+D
Sbjct: 1   MKYHIIPVTAFQQNCTLLWCEATREAAIVDPGGESAKILREIGARDLKVTQILLTHGHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L + LS+ I GP ++D   + ++ +QA +     + +     RWLQ GDTL +
Sbjct: 61  HVGAAARLAQTLSVPIYGPQQEDQYWLDQLSQQADMFGF-TDCQPFMPTRWLQQGDTLAV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGH+PGHV+Y   +   A +GD LFR SIGR+D   G+++ L+NSI  ++
Sbjct: 120 GEEQLTVLHCPGHTPGHVVYFCEKARLAQVGDVLFRGSIGRSDFAGGNHRDLLNSIWTRL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
             LGD+++F+ GHGP STIG ERR NP+++
Sbjct: 180 FTLGDDVAFIPGHGPMSTIGEERRSNPYVR 209


>gi|254293478|ref|YP_003059501.1| beta-lactamase [Hirschia baltica ATCC 49814]
 gi|254042009|gb|ACT58804.1| beta-lactamase domain protein [Hirschia baltica ATCC 49814]
          Length = 234

 Score =  209 bits (531), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 95/209 (45%), Positives = 136/209 (65%), Gaps = 1/209 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           I+ VTP +QNC+ +FDEES EAV VDPGGD++ ++  ++     + QIW+THGH+DH G 
Sbjct: 23  IIPVTPLQQNCSLIFDEESKEAVFVDPGGDVEQLEAALKHFGLKLTQIWLTHGHLDHAGA 82

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           A  LKE  ++ I+GPHK+D  ++  ++ Q     I    RN  SD++L DGDTL    H 
Sbjct: 83  AQSLKESWNVDIVGPHKEDQWLLDDIEAQGAKYGI-TTGRNTKSDKYLDDGDTLEFAGHT 141

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
           F V HCPGH+PGHV+  N     A +GD +F  SIGRTD   G++Q+L++SI  K+ PLG
Sbjct: 142 FGVVHCPGHTPGHVVIYNESAQLAFVGDVIFHGSIGRTDFPRGNHQELLDSITQKLWPLG 201

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            ++ F+ GHG  ST G+ER  N ++  ++
Sbjct: 202 KDMRFIPGHGQMSTFGQERLTNNYVADSV 230


>gi|302608186|emb|CBW44442.1| putative metal-binding hydrolase [Marinobacter
           hydrocarbonoclasticus]
          Length = 215

 Score =  209 bits (531), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 99/209 (47%), Positives = 135/209 (64%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L + IV VTPF+QNCT L+  E+ +A VVDPGGDLD I    +     +++I +TH H+D
Sbjct: 3   LKYKIVPVTPFEQNCTLLWCTETHKAAVVDPGGDLDRILAAAEDEGVILEKILLTHAHID 62

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GG A+L +   L I GPHKDD   +  +  QA++          + +RWL+DGDT+ +
Sbjct: 63  HAGGTAELAKSAGLPIEGPHKDDNFWIQGLAMQAQMFGFPA-PEVFTPNRWLEDGDTVTV 121

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V H PGH+PGHV++ +  +  A +GD LF  SIGRTD   GDY  LI+SI  K+
Sbjct: 122 GNETLEVLHTPGHTPGHVVFFHRGSKLAQVGDVLFNGSIGRTDFPKGDYNTLIHSIREKL 181

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
            PLGD++SF+CGHGP ST G+ER  NPF+
Sbjct: 182 FPLGDDVSFICGHGPMSTFGQERATNPFV 210


>gi|238920324|ref|YP_002933839.1| hypothetical protein NT01EI_2434 [Edwardsiella ictaluri 93-146]
 gi|238869893|gb|ACR69604.1| conserved hypothetical protein [Edwardsiella ictaluri 93-146]
          Length = 215

 Score =  209 bits (531), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 96/213 (45%), Positives = 139/213 (65%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + +HI+ VT F+QNCT L+ E + EA +VDPGG+   I   I +R+  V QI +THGH+D
Sbjct: 1   MKYHIIPVTAFQQNCTLLWCETTREAAIVDPGGESAKILREIGARDLKVTQILLTHGHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L + LS+ I GP ++D   + ++ +QA +     + +     RWLQ GDTL +
Sbjct: 61  HVGAAARLAQTLSVPIYGPQQEDKYWLDQLPQQADMFGF-TDCQPFMPTRWLQQGDTLAV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGH+PGHV+Y       A +GD LFR SIGR+D   G+++ L+NSI  ++
Sbjct: 120 GEEQLTVLHCPGHTPGHVVYFCERARLAQVGDVLFRGSIGRSDFAGGNHRDLLNSIWTRL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
             LGD+++F+ GHGP STIG ERR NP+++  +
Sbjct: 180 FTLGDDVAFIPGHGPMSTIGEERRSNPYVRDEL 212


>gi|295690071|ref|YP_003593764.1| glyoxalase II family Zn-dependent hydrolase [Caulobacter segnis
           ATCC 21756]
 gi|295431974|gb|ADG11146.1| Zn-dependent hydrolase, glyoxalase II family [Caulobacter segnis
           ATCC 21756]
          Length = 236

 Score =  209 bits (531), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 93/205 (45%), Positives = 138/205 (67%), Gaps = 1/205 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           I  VTP +QNCT ++  ++++A ++DPGG++D +   +  +   +++IWITHGH+DH GG
Sbjct: 9   IAPVTPLQQNCTIVWCTKTMKAAIIDPGGEVDRLLKALADKGLTLEKIWITHGHMDHAGG 68

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           AA+LK    + I GPH+ D   + ++ +   +  +   AR   +DRWL DGD + LG   
Sbjct: 69  AAELKVRTGVPIEGPHEADQFWIDRIQQSGEMYGMP-EARIFVTDRWLHDGDKVTLGETE 127

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
           F+V HCPGH+PGHV++ + E  FA +GD LF+ SIGRTD   G++Q LI++I  K+ PLG
Sbjct: 128 FEVLHCPGHTPGHVVFFHRETKFAQVGDVLFQGSIGRTDFPMGNHQDLIDAITQKLWPLG 187

Query: 188 DEISFVCGHGPNSTIGRERRLNPFL 212
           D++ FV GHGP S+ G ERR NPF+
Sbjct: 188 DDVRFVPGHGPMSSFGAERRGNPFV 212


>gi|255292545|dbj|BAH89658.1| putative beta-lactamase [uncultured bacterium]
          Length = 212

 Score =  209 bits (531), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 93/209 (44%), Positives = 139/209 (66%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L +H + VT F+QNC+ ++ +++++A V+DPGGDLD++    + R  H+K IW+TH H+D
Sbjct: 2   LHYHTIPVTAFQQNCSLVWCDQTMDAAVIDPGGDLDVLLAEAKRRGLHLKAIWLTHAHID 61

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GG  +L + L L IIGPH+ D   +  + +Q+ +      A+  +  RWL DGDT+ +
Sbjct: 62  HAGGTGELAQRLHLPIIGPHEGDQYWIDGLAQQSAMFGF-APAQPFTPTRWLHDGDTVAI 120

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGH+PGHV++   + + A +GD LF  SIGRTD   G++QQLI+SI  ++
Sbjct: 121 GHESLSVRHCPGHTPGHVVFHAPQIDRAFVGDVLFAGSIGRTDFPGGNHQQLIDSITQRL 180

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
            P+GD+  F+ GHGP ST GRERR NP++
Sbjct: 181 WPMGDQTVFIPGHGPESTFGRERRSNPYV 209


>gi|192358886|ref|YP_001983591.1| metallo-beta-lactamase superfamily protein [Cellvibrio japonicus
           Ueda107]
 gi|190685051|gb|ACE82729.1| metallo-beta-lactamase superfamily protein [Cellvibrio japonicus
           Ueda107]
          Length = 215

 Score =  208 bits (530), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 95/209 (45%), Positives = 142/209 (67%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L + I+ VT ++QNCT L+ +++ EA VVDPGGD+  I   ++     + QI +THGH+D
Sbjct: 2   LQYQIIPVTHYQQNCTLLWCDQTREAAVVDPGGDVARILAEVERLQLKLTQILLTHGHLD 61

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVGG A L +   L +IGPH+DD   +G + +QA+++     A N + DR+L +GD +++
Sbjct: 62  HVGGTAALVQLRQLPVIGPHQDDMFWIGMLSQQAQMMGFAPVA-NFTPDRFLHEGDKVMV 120

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +VFHCPGH+PGHV++   E   A +GD LF+ S+GR+D   G++QQL++SI  K+
Sbjct: 121 GQAELEVFHCPGHTPGHVVFFCREAGLAQVGDVLFQGSVGRSDFPRGNHQQLVDSIRTKL 180

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
            PLGD + F+ GHGP S+ G+ERR NPF+
Sbjct: 181 FPLGDAVKFIPGHGPMSSFGQERRTNPFV 209


>gi|317491482|ref|ZP_07949918.1| metallo-beta-lactamase superfamily protein [Enterobacteriaceae
           bacterium 9_2_54FAA]
 gi|316921029|gb|EFV42352.1| metallo-beta-lactamase superfamily protein [Enterobacteriaceae
           bacterium 9_2_54FAA]
          Length = 215

 Score =  208 bits (530), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 95/209 (45%), Positives = 138/209 (66%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + I+ VT F+QNCT L+ E++ +A +VDPGG+   I   +++    V QI +THGH+D
Sbjct: 1   MKYKIIPVTAFQQNCTLLWCEDTHQAAIVDPGGEPAKILREVEALGLTVTQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG A QL + L++ I GP +DD   +  +  Q+++     N    +  RWL DGDTL +
Sbjct: 61  HVGAAGQLAKSLNVPIYGPQEDDLFWLEGLPAQSKMFGF-TNCDPLTPTRWLNDGDTLQV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +VFHCPGH+PGHVI+ N E+  A +GD LF   +GR+D   GD+Q LINSI  K+
Sbjct: 120 GNQTLQVFHCPGHTPGHVIFFNEESRLAQVGDVLFSGGVGRSDFPRGDHQALINSIKTKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
            PLG++++F+ GHGP ST G+ER+ NPF+
Sbjct: 180 WPLGNDVAFIPGHGPMSTFGQERQTNPFV 208


>gi|319761071|ref|YP_004125008.1| beta-lactamase domain-containing protein [Alicycliphilus
           denitrificans BC]
 gi|330822929|ref|YP_004386232.1| beta-lactamase domain-containing protein [Alicycliphilus
           denitrificans K601]
 gi|317115632|gb|ADU98120.1| beta-lactamase domain-containing protein [Alicycliphilus
           denitrificans BC]
 gi|329308301|gb|AEB82716.1| beta-lactamase domain protein [Alicycliphilus denitrificans K601]
          Length = 212

 Score =  208 bits (530), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 92/212 (43%), Positives = 140/212 (66%), Gaps = 1/212 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L +H + VT F+QNC+ ++ +++++A V+DPGGDLD++    + R  H+K IW+TH H+D
Sbjct: 2   LHYHTIPVTAFQQNCSLVWCDQTMDAAVIDPGGDLDVLLAEAKRRGLHLKAIWLTHAHID 61

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GG  +L + L+L IIGPH+ D   +  + +Q ++      A + +  RWL DGDT+ +
Sbjct: 62  HAGGTGELAQRLALPIIGPHEGDQYWIDGLPQQGQMFGFP-PALHFTPTRWLHDGDTVTI 120

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGH+PGHV++   + +   +GD LF  SIGRTD   G++QQLI+SI  ++
Sbjct: 121 GRETLHVRHCPGHTPGHVVFHAPQVDRCFVGDVLFAGSIGRTDFPGGNHQQLIDSITQRL 180

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSN 215
            P+GD+  F+ GHGP ST GRERR NP++ + 
Sbjct: 181 WPMGDQTVFIPGHGPESTFGRERRSNPYVGNT 212


>gi|237749349|ref|ZP_04579829.1| Zn-dependent hydrolase [Oxalobacter formigenes OXCC13]
 gi|229380711|gb|EEO30802.1| Zn-dependent hydrolase [Oxalobacter formigenes OXCC13]
          Length = 211

 Score =  208 bits (529), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 95/211 (45%), Positives = 139/211 (65%), Gaps = 2/211 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + F I+ VTPF+QNCT ++DE + +A VVDPGGD+  I D ++ R   ++++++THGH+D
Sbjct: 1   MKFQIIPVTPFQQNCTLMWDENTNKAAVVDPGGDISKISDALKQRGLTLEKVFVTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKV-DEQARLLSIRMNARNASSDRWLQDGDTLL 122
           H GGA +L E+  + I GPHKDDA ++ ++  EQ+R+  +       +  RWL  GD + 
Sbjct: 61  HCGGAKKLAEEFDVPIEGPHKDDAYLLEQLGSEQSRMWGLPA-GEPFTPTRWLDQGDEVT 119

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
           +G    KVFHCPGHSPGH+I+ +  +  A  GD LF  S+GRTD+  G + QL  SI   
Sbjct: 120 VGNETLKVFHCPGHSPGHIIFFHAPSKVAISGDVLFAGSVGRTDLPKGSFTQLSKSIKEN 179

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           +  LGD++ F+ GHGP S+IG ER+ N F+K
Sbjct: 180 MYTLGDDVQFIPGHGPVSSIGYERKGNAFVK 210


>gi|88801050|ref|ZP_01116598.1| glyoxylase II family protein [Reinekea sp. MED297]
 gi|88776189|gb|EAR07416.1| glyoxylase II family protein [Reinekea sp. MED297]
          Length = 216

 Score =  208 bits (529), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 90/213 (42%), Positives = 138/213 (64%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L + I+ VT   QNC+ ++ +++L+A++VD GG+++ +K V Q++  ++K +W+THGH+D
Sbjct: 2   LQYQIIPVTALAQNCSLVWCDQTLDAIIVDAGGEVEKLKSVAQAKGLNLKAVWLTHGHLD 61

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GGA  L+E L L +IGPH +D   +  +++Q ++  +    RN   D WL++G TL +
Sbjct: 62  HAGGAQDLREQLGLPVIGPHPEDQFWLEGIEQQCQMYGLS-GMRNVQPDEWLKEGATLQV 120

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V   PGH+PGHV+  +     A +GD LF  SIGRTD   GD+  LI SI  K+
Sbjct: 121 GQETLEVLETPGHTPGHVVLFHRAQKLAWVGDVLFAGSIGRTDFPRGDHGTLIRSITEKL 180

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            PLGD++ F+ GHGP ST G ERR NPF+  ++
Sbjct: 181 WPLGDDVRFIPGHGPESTFGAERRSNPFVSDSV 213


>gi|241766992|ref|ZP_04764784.1| beta-lactamase domain protein [Acidovorax delafieldii 2AN]
 gi|241362505|gb|EER58414.1| beta-lactamase domain protein [Acidovorax delafieldii 2AN]
          Length = 212

 Score =  208 bits (529), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 93/209 (44%), Positives = 136/209 (65%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L +H V VTPF+QNC+ ++ + +  A V+DPGGDLD +   ++ R   ++QIW+TH H+D
Sbjct: 2   LQYHTVPVTPFQQNCSIVWCDATRRAAVIDPGGDLDTVLAEVERRGLTLEQIWLTHAHID 61

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GGA +L +   L I+GPH  D   +  + +Q+ +      A++ S  RWL DGD + +
Sbjct: 62  HAGGAGELAQRKQLPIVGPHPGDQFWIDGLPQQSAMFGF-APAQHFSPTRWLHDGDQVQI 120

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGH+PGHV++   + + A +GD LF  SIGRTD   G++QQLI+SI  ++
Sbjct: 121 GNETLNVRHCPGHTPGHVVFHAPQIDRAFVGDVLFAGSIGRTDFPQGNHQQLIDSITQRL 180

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
            P+GD+  F+ GHGP ST GRERR NP++
Sbjct: 181 WPMGDQTVFIPGHGPESTFGRERRSNPYV 209


>gi|296282445|ref|ZP_06860443.1| glyoxalase II family protein [Citromicrobium bathyomarinum JL354]
          Length = 213

 Score =  208 bits (529), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 95/205 (46%), Positives = 138/205 (67%), Gaps = 2/205 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           I+ VTP +QNC+ ++  ++ +A ++DPGGDLD +K  +      +++I ITHGH+DH G 
Sbjct: 5   ILPVTPLQQNCSLIWCTQTNKAALIDPGGDLDKLKAGVAKAGVELEKILITHGHLDHCGQ 64

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           A  L ++L L I GPH+ D   + ++DE       +M A +   DRWL+DGDT+ +G   
Sbjct: 65  AGMLAQELGLPIEGPHEADRFWIARLDEDGA--RFQMEAASFEPDRWLEDGDTVTVGNLT 122

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
            +V HCPGH+PGHVI+ N +  FA +GD LF+ SIGRTD    D+Q LI++I  K+ PLG
Sbjct: 123 LEVIHCPGHTPGHVIFFNRDRKFAIVGDVLFQGSIGRTDFPMSDHQSLIDAITRKLWPLG 182

Query: 188 DEISFVCGHGPNSTIGRERRLNPFL 212
           D+++F+ GHGP ST G+ERR NPF+
Sbjct: 183 DDVTFIPGHGPTSTFGQERRTNPFV 207


>gi|197105365|ref|YP_002130742.1| glyoxalase II family protein [Phenylobacterium zucineum HLK1]
 gi|196478785|gb|ACG78313.1| glyoxalase II family protein [Phenylobacterium zucineum HLK1]
          Length = 225

 Score =  208 bits (529), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 95/209 (45%), Positives = 137/209 (65%), Gaps = 1/209 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           I  VTP +QNCT ++  ++++A V+DPGG++  +   ++ +   +++IWITHGH+DH GG
Sbjct: 14  IAPVTPLQQNCTIVWCVKTMKAAVIDPGGEVPRLLQALKDQGLTLEKIWITHGHLDHAGG 73

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
            A LKE     I GPH DDA  +  ++       +  +AR+   DRWLQDGD + LG   
Sbjct: 74  TAALKEATGAPIEGPHPDDAFWIEDIESSGARWGMP-DARSFIPDRWLQDGDVVTLGETE 132

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
           F+V HCPGH+PGHV++ + +  FA +GD LF+ SIGRTD   G++  LI SI  K+ PLG
Sbjct: 133 FEVIHCPGHTPGHVVFFHRQARFAQVGDVLFQGSIGRTDFPRGNHADLIASITKKLWPLG 192

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           +++ FV GHGP ST G+ERR NPF+   +
Sbjct: 193 EDVRFVPGHGPMSTFGQERRSNPFVADAV 221


>gi|304312538|ref|YP_003812136.1| Metallo-beta-lactamase family protein [gamma proteobacterium HdN1]
 gi|301798271|emb|CBL46493.1| Metallo-beta-lactamase family protein [gamma proteobacterium HdN1]
          Length = 220

 Score =  207 bits (528), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 97/209 (46%), Positives = 139/209 (66%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L F +V VTP++QNCT L+ +E+L+A VVDPGGDLD +  V +     V++I +TH H+D
Sbjct: 8   LKFQVVPVTPYEQNCTVLWCDETLKAAVVDPGGDLDRVLAVCKKHGVQVEKILLTHPHID 67

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H G AA L E L + I GP K D   +  + +Q+ ++     A+  + DRWL+DGD + +
Sbjct: 68  HAGAAATLAEKLGVPIEGPQKADLFWIQGLPQQSVMMRFP-PAKLFTPDRWLEDGDQVSV 126

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G  +F V HCPGH+PGHV++   +   A +GD LF  SIGRTD   G+++ L++SI  K+
Sbjct: 127 GNVVFDVIHCPGHTPGHVVFYQPDAKLALVGDVLFNGSIGRTDFPLGNFESLVHSIRQKL 186

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
            PLGD+I+F+ GHGP ST G ER+ NPF+
Sbjct: 187 FPLGDDIAFIPGHGPMSTFGHERKTNPFV 215


>gi|253990244|ref|YP_003041600.1| hypothetical protein PAU_02767 [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253781694|emb|CAQ84857.1| conserved hypothetical protein [Photorhabdus asymbiotica]
          Length = 215

 Score =  207 bits (528), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 93/213 (43%), Positives = 140/213 (65%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + I+ VT F QNCT +++EE+ EA +VDPGG+   +   I++R   + QI +THGH D
Sbjct: 1   MKYQIIPVTAFMQNCTLIWNEETNEAAIVDPGGEAAKLIAEIENRGLKLTQILLTHGHFD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG  A++ +  ++ + GP ++DA  +  +  Q+R+  I     +   DRWL +GD L +
Sbjct: 61  HVGATAEVAKHFNVPVYGPQQEDAFWIEGLQAQSRMFGIE-ECPSFEPDRWLNEGDELRV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGH+PGHV++VN  +   ++GD LF+  IGR+D   G++QQLINSI +K+
Sbjct: 120 GGIDLSVLHCPGHTPGHVVFVNHADKLIYMGDVLFKGGIGRSDFPRGNHQQLINSIKDKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           LPLGD+  F+ GHGP ST+G ER+ NPFL+  +
Sbjct: 180 LPLGDDYEFIPGHGPMSTLGYERQTNPFLQDEV 212


>gi|194291110|ref|YP_002007017.1| enzyme with metallo-hydrolase/oxidoreductase domain [Cupriavidus
           taiwanensis LMG 19424]
 gi|193224945|emb|CAQ70956.1| putative enzyme with metallo-hydrolase/oxidoreductase domain
           [Cupriavidus taiwanensis LMG 19424]
          Length = 216

 Score =  207 bits (527), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 93/209 (44%), Positives = 138/209 (66%), Gaps = 1/209 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           ++ VTPF+QNC+ L DE +  A V DPGGDLD I+  ++ +   +++I++THGHVDH  G
Sbjct: 5   LIPVTPFQQNCSLLIDESTGAAAVCDPGGDLDRIRAAVKEQGVTLEKIFLTHGHVDHCAG 64

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           AA L  +L + I GP +D+   + ++ EQ R      +A +   DRWL++GDT+  G   
Sbjct: 65  AAALSRELGIPIEGPQQDERFWIEQLPEQTRRFGF-GHAESFEPDRWLENGDTVQFGNET 123

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
            +V+HCPGH+PGHV++ +  N  A +GD LF  SIGRTD   G++  LI SI  ++ PLG
Sbjct: 124 LEVYHCPGHTPGHVVFFSRPNRLAVVGDVLFAGSIGRTDFPRGNHADLIRSIRTRLWPLG 183

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           ++++F+ GHGP ST G ERR NPF+  ++
Sbjct: 184 EDVTFIPGHGPVSTFGEERRTNPFVADHL 212


>gi|269102896|ref|ZP_06155593.1| hydroxyacylglutathione hydrolase [Photobacterium damselae subsp.
           damselae CIP 102761]
 gi|268162794|gb|EEZ41290.1| hydroxyacylglutathione hydrolase [Photobacterium damselae subsp.
           damselae CIP 102761]
          Length = 217

 Score =  207 bits (527), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 91/214 (42%), Positives = 140/214 (65%), Gaps = 1/214 (0%)

Query: 3   KLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHV 62
            L + IV VTPF+QNC+ ++ +++ +A ++DPGGD+++IK  +Q     V ++ +THGH+
Sbjct: 2   SLQYRIVPVTPFQQNCSIVWCDKTNQAAIIDPGGDINVIKQHVQELGLTVTKLLLTHGHL 61

Query: 63  DHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLL 122
           DHVGG   L ++L++ +IGP K+D   +  +  Q+ +    M   +    +WL+DGDT+ 
Sbjct: 62  DHVGGTEPLAQELNVPVIGPQKEDIFWLQGLPRQSEMFGFPM-TESFDPTQWLEDGDTVT 120

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
           +G  +  V H PGH+PGHV++ +     A +GD LF   IGRTD   GDYQ LINSI  K
Sbjct: 121 VGEEVLSVLHTPGHTPGHVVFFSDSAKVAFVGDVLFNGGIGRTDFPRGDYQTLINSIKGK 180

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           + PLG++++F+ GHGP+ST GRER  NPF+   +
Sbjct: 181 LWPLGNDVTFIPGHGPSSTFGRERASNPFVADEM 214


>gi|242239072|ref|YP_002987253.1| beta-lactamase [Dickeya dadantii Ech703]
 gi|242131129|gb|ACS85431.1| beta-lactamase domain protein [Dickeya dadantii Ech703]
          Length = 211

 Score =  207 bits (526), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 93/210 (44%), Positives = 137/210 (65%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + I+ VT F QNCT L+ E++L+A +VDPGG+ + I   ++     VKQI +THGH+D
Sbjct: 1   MKYQIIPVTAFSQNCTLLWCEKTLQAAIVDPGGEAEKIIRGVEQVGVTVKQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG A  L E   + +IGP + DA  +  +  Q+R+  ++ +       RWLQDGD + +
Sbjct: 61  HVGAAVTLAEHYQVPVIGPQEADAFWLNGLPAQSRMFGLQ-DCPPLVPARWLQDGDRISV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G  +  V HCPGH+PGHV++V+ +   A +GD LFR  +GR+D   G++  LINSI  ++
Sbjct: 120 GECVMTVLHCPGHTPGHVVFVDEQARLAQVGDVLFRGGVGRSDFPGGNHDALINSIQTQL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
            PLGD+I+F+ GHGP ST G ERR NPF++
Sbjct: 180 FPLGDDITFIPGHGPTSTFGEERRTNPFVR 209


>gi|114799929|ref|YP_759378.1| metallo-beta-lactamase superfamily protein [Hyphomonas neptunium
           ATCC 15444]
 gi|114740103|gb|ABI78228.1| metallo-beta-lactamase superfamily [Hyphomonas neptunium ATCC
           15444]
          Length = 244

 Score =  206 bits (525), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 96/214 (44%), Positives = 137/214 (64%), Gaps = 1/214 (0%)

Query: 3   KLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHV 62
           KL   I+ VTP +QN + ++  +++E V VDPGG++D +          +  +W+THGH+
Sbjct: 9   KLEIRIIPVTPLQQNTSMIWSTQTMEGVFVDPGGEIDKLMQAADHFGVKIVAVWLTHGHL 68

Query: 63  DHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLL 122
           DHVG A  +K+     IIGPHKDD  ++ +V+       IR + +N + DR+L DGD L 
Sbjct: 69  DHVGAAMAVKDRTGCPIIGPHKDDQWLLDEVEASGARYGIR-DGKNVTPDRYLDDGDVLE 127

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
           L  + F V HCPGH+PGHV+  + E   A +GD LFR S+GRTD   G++QQLI+SI  K
Sbjct: 128 LAGNKFGVAHCPGHTPGHVVIYHPEGALAFVGDVLFRGSVGRTDFPRGNHQQLIDSITQK 187

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           + PLGD++ FV GHGP ST G+ER+ NPF+   +
Sbjct: 188 LWPLGDDMRFVPGHGPLSTFGQERQDNPFVADAV 221


>gi|113869519|ref|YP_728008.1| hydroxyacylglutathione hydrolase [Ralstonia eutropha H16]
 gi|113528295|emb|CAJ94640.1| hydroxyacylglutathione hydrolase [Ralstonia eutropha H16]
          Length = 216

 Score =  206 bits (525), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 93/209 (44%), Positives = 140/209 (66%), Gaps = 1/209 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           ++ VTPF+QNC+ L DE +  A V DPGGDLD I++ ++ +   +++I++THGHVDH  G
Sbjct: 5   LIPVTPFQQNCSLLIDESTGRAAVCDPGGDLDRIREAVREQGVTLEKIFLTHGHVDHCAG 64

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           AA L  +L + I GP +D+   + ++ EQ R      +A +   DRWL++GDT+  G   
Sbjct: 65  AAALARELDIPIEGPQQDERFWIEQLPEQTRRFGF-GHAESFEPDRWLENGDTVQFGNET 123

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
            +V+HCPGH+PGHV++ +  N  A +GD LF  SIGRTD+  G++  LI SI  ++ PLG
Sbjct: 124 LEVYHCPGHTPGHVVFFSRANRLAVVGDVLFAGSIGRTDLPRGNHADLIRSIRTRLWPLG 183

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           ++++F+ GHGP ST G ERR NPF+  ++
Sbjct: 184 EDVTFIPGHGPVSTFGVERRNNPFVADHL 212


>gi|311694082|gb|ADP96955.1| metallo-beta-lactamase family protein [marine bacterium HP15]
          Length = 215

 Score =  206 bits (525), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 93/209 (44%), Positives = 137/209 (65%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L++ I+ VTPF+QNC+ ++ E++  A VVDPGGDL+ I+  +      V++I +TH H+D
Sbjct: 3   LNYRIIPVTPFQQNCSLIWCEKTRRAAVVDPGGDLEKIRAAVAEEGVTVEKILLTHAHID 62

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GG A+L ++L + I GP K+D   +  + +QA++          + DRWL+DG  + +
Sbjct: 63  HAGGTAELTKELGIPIEGPQKEDNFWIVGLPQQAQMFGFPA-PEVFTPDRWLEDGQQVTV 121

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGHV++ + E+  A +GD LF  SIGRTD   GD+  LI SI  ++
Sbjct: 122 GNQTLEVLHCPGHTPGHVVFYHKESGLALVGDVLFHGSIGRTDFPKGDHATLIRSIREQL 181

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
            PLGDE++F+ GHGP ST GRER  NPF+
Sbjct: 182 FPLGDEVAFIPGHGPMSTFGRERATNPFV 210


>gi|209519172|ref|ZP_03267976.1| beta-lactamase domain protein [Burkholderia sp. H160]
 gi|209500398|gb|EEA00450.1| beta-lactamase domain protein [Burkholderia sp. H160]
          Length = 214

 Score =  206 bits (525), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 96/209 (45%), Positives = 134/209 (64%), Gaps = 1/209 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           ++ VTPF+QNC+ L  E +  A VVDPGGDLD+I+  I  +N  V+++ +THGH+DH  G
Sbjct: 5   LIPVTPFQQNCSLLVCEATGRAAVVDPGGDLDVIQREIARQNVSVEKVLLTHGHIDHCAG 64

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           A  L     + I GPH D+   + K+ +Q+        A     DRWLQDGD+   G   
Sbjct: 65  AKTLATHYGVPIEGPHPDERFWLDKLPDQSTRFGFPA-ADAFEPDRWLQDGDSAQFGDET 123

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
           F+V+HCPGH+PGHV++ + E+  A +GD LF  SIGRTD   G++  LI SI +K+ PLG
Sbjct: 124 FEVYHCPGHTPGHVVFFSREHRLALVGDVLFAGSIGRTDFPRGNHADLIRSIRDKLWPLG 183

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           D+++FV GHGP ST G ERR NP++   +
Sbjct: 184 DDVTFVPGHGPTSTFGAERRTNPYVADGV 212


>gi|73542951|ref|YP_297471.1| Beta-lactamase-like [Ralstonia eutropha JMP134]
 gi|72120364|gb|AAZ62627.1| Beta-lactamase-like [Ralstonia eutropha JMP134]
          Length = 216

 Score =  206 bits (524), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 94/209 (44%), Positives = 136/209 (65%), Gaps = 1/209 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           ++ VTPF+QNC+ L DE + +A V DPGGDLD I + ++ +   +++I++THGHVDH  G
Sbjct: 5   LIPVTPFQQNCSLLIDEHTGKAAVCDPGGDLDRILEAVKEQGVTLEKIFLTHGHVDHCAG 64

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           AA L   L + I GPH+D+   + ++ EQ R       A      RWLQDGDT+  G   
Sbjct: 65  AAALSRQLGIPIEGPHEDERFWIDQLPEQTRRFGF-GQAEVFEPQRWLQDGDTVQFGGET 123

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
            +V+HCPGH+PGHV++ +  N  A +GD LF  SIGRTD   G++  L+ SI  ++ PLG
Sbjct: 124 LEVYHCPGHTPGHVVFFSRANRLAVVGDVLFAGSIGRTDFPRGNHADLVRSIRTRLWPLG 183

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           ++++F+ GHGP ST G ERR NPF+  ++
Sbjct: 184 EDVTFIPGHGPVSTFGEERRNNPFVADHL 212


>gi|330445735|ref|ZP_08309387.1| metallo-beta-lactamase superfamily protein [Photobacterium
           leiognathi subsp. mandapamensis svers.1.1.]
 gi|328489926|dbj|GAA03884.1| metallo-beta-lactamase superfamily protein [Photobacterium
           leiognathi subsp. mandapamensis svers.1.1.]
          Length = 217

 Score =  206 bits (523), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 94/213 (44%), Positives = 137/213 (64%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L + IV VTPF+QNC+ ++ +E+ +A +VDPGGD++ +K V++     V Q+ +THGH+D
Sbjct: 3   LKYQIVPVTPFQQNCSIIWCDETNQAAIVDPGGDVEQLKKVVEELGVTVTQLILTHGHLD 62

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVGG   L E L++ +IGPHKDD   +  +  Q+ +    M        +WL+DGD + +
Sbjct: 63  HVGGTEPLAEALNVPVIGPHKDDVFWLQGLPRQSEMFGFPMT-EAFDPTQWLEDGDEIKV 121

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +VFH PGH+PGHV+  N +   A +GD LF+  IGRTD   GD+  LIN+I  K+
Sbjct: 122 GNQTLQVFHTPGHTPGHVVLFNDDAKIAFVGDVLFKGGIGRTDFPRGDHPTLINAIKTKL 181

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            PLG++++FV GHGP ST G ER  NPF+   +
Sbjct: 182 WPLGNDVTFVPGHGPLSTFGHERATNPFVADEM 214


>gi|288941205|ref|YP_003443445.1| hypothetical protein Alvin_1479 [Allochromatium vinosum DSM 180]
 gi|288896577|gb|ADC62413.1| conserved hypothetical protein [Allochromatium vinosum DSM 180]
          Length = 210

 Score =  205 bits (522), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 94/209 (44%), Positives = 137/209 (65%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + F I+ VT F+QNCT L+   +  A +VDPGG+ D I+ ++       ++I +THGH+D
Sbjct: 1   MEFQILPVTGFQQNCTLLWCARTRRAAIVDPGGEPDRIEALLSQLELEPERILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG +A+L + L++ I GPH DDA +   + EQ R+      A     DRWLQ GD + +
Sbjct: 61  HVGASAELAQRLAIPIEGPHPDDAFLFQSLPEQCRMFGFPPVA-VFEPDRWLQHGDRIAV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGH+++   E+  A +GD LFR SIGRTD   G+++QL++SI +++
Sbjct: 120 GDESLEVIHCPGHTPGHIVFHQAESQLAQVGDVLFRGSIGRTDFPRGNHRQLLDSIRHRL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
            PLGD + F+ GHGP ST G+ERR NPF+
Sbjct: 180 FPLGDAVRFIPGHGPMSTFGKERRSNPFV 208


>gi|293396752|ref|ZP_06641028.1| metallo-beta-lactamase [Serratia odorifera DSM 4582]
 gi|291421016|gb|EFE94269.1| metallo-beta-lactamase [Serratia odorifera DSM 4582]
          Length = 215

 Score =  205 bits (522), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 92/212 (43%), Positives = 140/212 (66%), Gaps = 1/212 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++ I+ VT F QNCT ++ +E+ +A +VDPGG+ + ++  +      + QI +THGH+D
Sbjct: 1   MNYKIIPVTAFSQNCTLIWCDETRQAALVDPGGEAEKLQAAVAEAGVTLTQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L E   + I GP K+DA  +  +  Q+R+  +   A   +  RWL +GDT+ +
Sbjct: 61  HVGAAAELAEHYQVPIYGPDKEDAFWLDGLPAQSRMFGLEECA-PLTPTRWLAEGDTVQV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    KV HCPGH+PGH++++N E   A +GD LF   +GRTD   GD+Q LIN+I++K+
Sbjct: 120 GAMTLKVLHCPGHTPGHIVFINDEARLALVGDVLFNGGVGRTDFPRGDHQALINAIHSKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSN 215
           LP GD+++F+ GHGP ST G+ER  NPFL+  
Sbjct: 180 LPQGDDMAFIPGHGPMSTFGQERLHNPFLREE 211


>gi|89094954|ref|ZP_01167885.1| putative metallo-beta-lactamase family protein [Oceanospirillum sp.
           MED92]
 gi|89080820|gb|EAR60061.1| putative metallo-beta-lactamase family protein [Oceanospirillum sp.
           MED92]
          Length = 209

 Score =  205 bits (522), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 93/210 (44%), Positives = 139/210 (66%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + I+ VTPF+QNC+ ++ E++ +A VVDPGGDLD +   +      +++I +TH H+D
Sbjct: 1   MKYRIIPVTPFQQNCSLIWCEKTNKAAVVDPGGDLDKVLAAVAEEGVELEKILLTHAHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GG A+L    SL I GPHK D   +  +++Q  + +        + DRWL+DGD +L+
Sbjct: 61  HAGGTAELSSGHSLPIEGPHKGDQFWIDGIEQQCAMFNFP-PCEGFTPDRWLEDGDEVLV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    KV H PGH+PGHV++ N E+  A +GD LF  SIGRTD   G++Q+LI+SI NK+
Sbjct: 120 GEISLKVIHSPGHTPGHVVFFNPEDQVALVGDVLFNGSIGRTDFPQGNHQELISSIKNKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
            PLG+++ F+ GHGP ST G+E + NPF++
Sbjct: 180 FPLGEDVEFIPGHGPGSTFGQEMQSNPFVR 209


>gi|295675208|ref|YP_003603732.1| putative metallo-beta-lactamase family protein [Burkholderia sp.
           CCGE1002]
 gi|295435051|gb|ADG14221.1| putative metallo-beta-lactamase family protein [Burkholderia sp.
           CCGE1002]
          Length = 214

 Score =  205 bits (521), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 96/209 (45%), Positives = 135/209 (64%), Gaps = 1/209 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           ++ VTPF+QNC+ L  E +  A VVDPGGDLD+I+  I  +N  V+++ +THGH+DH  G
Sbjct: 5   LIPVTPFQQNCSLLVCETTGRAAVVDPGGDLDLIQREIARQNVAVEKVLLTHGHIDHCAG 64

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           A  L     + I GPH D+   + K+ +Q+        A +   DRWLQDGDT+  G   
Sbjct: 65  AKTLATHYGVPIEGPHPDERFWLDKLPDQSTRFGFPA-ADSFEPDRWLQDGDTVQFGGEN 123

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
           F+V+HCPGH+PGHV++ +  +  A +GD LF  SIGRTD   G++  LI SI +K+ PLG
Sbjct: 124 FEVYHCPGHTPGHVVFFSRAHRLALVGDVLFAGSIGRTDFPRGNHADLIRSIRDKLWPLG 183

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           D+++FV GHGP ST G ERR NP++   +
Sbjct: 184 DDVTFVPGHGPTSTFGAERRTNPYVADGV 212


>gi|217968892|ref|YP_002354126.1| beta-lactamase [Thauera sp. MZ1T]
 gi|217506219|gb|ACK53230.1| beta-lactamase domain protein [Thauera sp. MZ1T]
          Length = 213

 Score =  205 bits (521), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 98/207 (47%), Positives = 134/207 (64%), Gaps = 1/207 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           IV VTPF+QNC+ L+ E + +A VVDPGGDLD I   +      V++I ITHGH+DH GG
Sbjct: 6   IVPVTPFQQNCSILWCERTKKAAVVDPGGDLDRILAAVAELGVTVEKILITHGHIDHAGG 65

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
            A+L  +L + I GP ++D   +  + +Q+++     +  +   DRWL DGDT+ +G   
Sbjct: 66  TAKLARELGVPIEGPQEEDRFWIEGMPQQSKMFGFP-DVESFEPDRWLHDGDTVTVGEQT 124

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
            KV H PGH+PGHV++V+     A +GD LF  SIGRTD   GD+Q LI SI  K+ PLG
Sbjct: 125 LKVIHTPGHTPGHVVFVHEGARLAIVGDVLFAGSIGRTDFPRGDHQTLIRSIREKLFPLG 184

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLKS 214
           D+I+F+ GHGP ST G ER  NPF+ +
Sbjct: 185 DDITFIPGHGPTSTFGEERDSNPFVGA 211


>gi|37525684|ref|NP_929028.1| hypothetical protein plu1749 [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|36785112|emb|CAE14042.1| unnamed protein product [Photorhabdus luminescens subsp. laumondii
           TTO1]
          Length = 215

 Score =  204 bits (520), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 91/213 (42%), Positives = 139/213 (65%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + I+ VT F QNCT +++E+S EA +VDPGG+ + +   I+ R   + QI +THGH D
Sbjct: 1   MKYQIIPVTAFMQNCTLIWNEDSKEAAIVDPGGEAEKLIAEIERRGLKLTQILLTHGHFD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG  A++ +  +  + GP ++DA  +  +  Q+R+  I     +   DRWL +GD L +
Sbjct: 61  HVGATAEVAKHFNAPVYGPQQEDAFWIEGLQAQSRMFGIE-ECPSFEPDRWLNEGDELRV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGH+PGHV++VN  +   ++GD LF+  +GR+D   G+++QLINSI +K+
Sbjct: 120 GGVDLSVLHCPGHTPGHVVFVNHVDKLIYMGDVLFKGGVGRSDFPRGNHRQLINSIKDKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           LPLGD+  F+ GHGP ST+G ER+ NPFL+  +
Sbjct: 180 LPLGDDYEFIPGHGPMSTLGHERQTNPFLQDEV 212


>gi|222109441|ref|YP_002551705.1| beta-lactamase domain-containing protein [Acidovorax ebreus TPSY]
 gi|221728885|gb|ACM31705.1| beta-lactamase domain protein [Acidovorax ebreus TPSY]
          Length = 212

 Score =  204 bits (519), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 94/209 (44%), Positives = 133/209 (63%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L +  + VT F+QN + ++ +E+++A V+DPGGDLD +   +Q     +K IW+TH H+D
Sbjct: 2   LHYRTLPVTAFQQNSSIVWCDETMDAAVIDPGGDLDALVAEVQRLGLQLKAIWLTHAHID 61

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GG  +L E LSL IIGPH  D   +  + +Q+ +      AR  +  RWL DGDT+ +
Sbjct: 62  HAGGTGELAERLSLPIIGPHTGDQYWIDALPQQSAMFGFP-PARQFAPTRWLHDGDTVTI 120

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGH+PGHV++   +   A +GD LF  SIGRTD   G++QQLI SI  ++
Sbjct: 121 GHETLNVRHCPGHTPGHVVFHAPQIGRAFVGDVLFAGSIGRTDFPQGNHQQLIASITQRL 180

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
            P+GD+  F+ GHGP ST GRERR NP++
Sbjct: 181 WPMGDQTVFIPGHGPESTFGRERRSNPYV 209


>gi|157369971|ref|YP_001477960.1| beta-lactamase domain-containing protein [Serratia proteamaculans
           568]
 gi|157321735|gb|ABV40832.1| beta-lactamase domain protein [Serratia proteamaculans 568]
          Length = 215

 Score =  204 bits (519), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 92/212 (43%), Positives = 138/212 (65%), Gaps = 1/212 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + +HI+ VT F QNC+ ++ E + +A +VDPGG+ + +K  I  +   V QI +THGH+D
Sbjct: 1   MKYHIIPVTAFSQNCSLIWCESTQQAALVDPGGEPEKLKAEIARQGVTVTQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L E   + I GP K DA  +  +  Q+R+  +   A   +  +WL++GD++ +
Sbjct: 61  HVGAAAELAEFYQVPIYGPDKRDAFWLDGLPAQSRMFGLEECA-PLTPTQWLEEGDSVQV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    KV HCPGH+PGH++++N +   A +GD LF   +GR+D   GD+Q LINSI  K+
Sbjct: 120 GEMTLKVLHCPGHTPGHIVFINDQARLALVGDVLFNGGVGRSDFPQGDHQALINSIRTKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSN 215
           LP GD+++F+ GHGP ST G+ER  NPFL+  
Sbjct: 180 LPQGDDMAFIPGHGPMSTFGQERETNPFLREE 211


>gi|89073967|ref|ZP_01160473.1| hypothetical glyoxylase II family protein [Photobacterium sp.
           SKA34]
 gi|89050295|gb|EAR55799.1| hypothetical glyoxylase II family protein [Photobacterium sp.
           SKA34]
          Length = 217

 Score =  204 bits (519), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 94/214 (43%), Positives = 136/214 (63%), Gaps = 1/214 (0%)

Query: 3   KLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHV 62
            L + IV VTPF+QNC+ ++ +E+ +A +VDPGGD++ +  V+      V Q+ +THGH+
Sbjct: 2   SLKYQIVPVTPFQQNCSIIWCDETNQAAIVDPGGDIEQLTKVVDELGLTVTQLILTHGHL 61

Query: 63  DHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLL 122
           DHVGG A L + L++ +IGPHKDD   +  +  Q+ +    M      + +WL DGD + 
Sbjct: 62  DHVGGTAPLSQSLNVPVIGPHKDDEFWLQGLPRQSEMFGFPMTEAFEPT-QWLNDGDKIN 120

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
           +G    +V H PGH+PGHVI  + + N A +GD LF+  IGRTD   GD+  LIN+I  K
Sbjct: 121 VGNQTLQVLHTPGHTPGHVILFSSDANVAFVGDVLFKGGIGRTDFPRGDHPTLINAIKTK 180

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           + PLGD+++FV GHGP ST G ER  NPF+   +
Sbjct: 181 LWPLGDDVTFVPGHGPLSTFGHERATNPFVADEM 214


>gi|270261210|ref|ZP_06189483.1| hypothetical protein SOD_a04350 [Serratia odorifera 4Rx13]
 gi|270044694|gb|EFA17785.1| hypothetical protein SOD_a04350 [Serratia odorifera 4Rx13]
          Length = 215

 Score =  204 bits (519), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 90/212 (42%), Positives = 137/212 (64%), Gaps = 1/212 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + I+ VT F QNC+ ++ E + +A +VDPGG+ + +K  +  +   + QI +THGH+D
Sbjct: 1   MKYQIIPVTAFSQNCSLIWCESTQQAALVDPGGEAEKLKAEVAKQGVTITQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L E   + I GP K+DA  +  +  Q+R+  +   A   +  +WLQ+GD + +
Sbjct: 61  HVGAAAELAEHYQVPIYGPDKEDAFWLDGLPAQSRMFGLEECA-PLTPTQWLQEGDKVQV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   F V HCPGH+PGH++++N +   A +GD LF   +GR+D   GD+Q LINSI  K+
Sbjct: 120 GEMTFNVLHCPGHTPGHIVFINEKARLALVGDVLFNGGVGRSDFPRGDHQALINSIRTKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSN 215
           LP GD+++F+ GHGP ST G+ER  NPFL+  
Sbjct: 180 LPQGDDMAFIPGHGPMSTFGQERETNPFLREE 211


>gi|327393349|dbj|BAK10771.1| metallo-beta-lactamase family protein YcbL [Pantoea ananatis
           AJ13355]
          Length = 209

 Score =  204 bits (518), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 90/210 (42%), Positives = 139/210 (66%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++HI+ VT F QNC+ ++ E + E+ +VDPGGD D I+  +   +    QI +THGH+D
Sbjct: 1   MNYHIIPVTAFAQNCSVIWCETTRESALVDPGGDADTIRQTLAQLDLKPAQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L     + ++GP K DA  +  +  Q+++  +   A   + DRWL++GDT+ +
Sbjct: 61  HVGAAAELAAFWQVPLVGPQKQDAFWLESLPTQSQMFGLEYCAP-LTPDRWLEEGDTVQV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGH+PGH+++ + +      GD +F   +GRTD   G++Q LI++INNK+
Sbjct: 120 GQVTLDVLHCPGHTPGHIVFFDAKGRLLVSGDVIFSGGVGRTDFPQGNHQHLIDAINNKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           LPLGD+++F+ GHGP ST+GRER  NPFL+
Sbjct: 180 LPLGDDVTFLPGHGPVSTLGRERLTNPFLQ 209


>gi|119476230|ref|ZP_01616581.1| metallo-beta-lactamase superfamily protein [marine gamma
           proteobacterium HTCC2143]
 gi|119450094|gb|EAW31329.1| metallo-beta-lactamase superfamily protein [marine gamma
           proteobacterium HTCC2143]
          Length = 214

 Score =  204 bits (518), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 97/208 (46%), Positives = 137/208 (65%), Gaps = 1/208 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           IV VTP++QNC+ L  EE+ +A VVDPGGDL+ I+  +   +  +++I++THGH+DH   
Sbjct: 5   IVPVTPYQQNCSILVCEETKKAAVVDPGGDLEKIESALTQLDVVLEKIFLTHGHMDHCAI 64

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           AAQ++E   + I GPH DD   + K+ E  ++     +A    SDRWL +GDT+  G   
Sbjct: 65  AAQVREKYGIPIEGPHVDDKFWIEKLPESCQMSGFP-HADVFDSDRWLVEGDTVQFGNQT 123

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
             V HCPGH+PGHVI+ N E+  A +GD LF+ SIGRTD   GD++ L+ SI  K+ PLG
Sbjct: 124 LAVRHCPGHTPGHVIFFNAESRVAIVGDVLFQGSIGRTDFPRGDHETLVQSIREKLWPLG 183

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLKSN 215
           D+++F+ GHGP ST G ER  NPF+  +
Sbjct: 184 DDVAFIPGHGPTSTFGHERETNPFVADS 211


>gi|319760549|ref|YP_004124487.1| metallo-beta-lactamase superfamily protein [Candidatus Blochmannia
           vafer str. BVAF]
 gi|318039263|gb|ADV33813.1| metallo-beta-lactamase superfamily protein [Candidatus Blochmannia
           vafer str. BVAF]
          Length = 211

 Score =  204 bits (518), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 98/210 (46%), Positives = 143/210 (68%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + +H++ VT F QNC+ ++ E++ +A+VVDPGG+ + +  VI + N  + +I +THGH+D
Sbjct: 1   MKYHVIPVTSFNQNCSIVWCEQTHDAIVVDPGGEKEKLFRVIDNLNVRINKIVLTHGHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNA-SSDRWLQDGDTLL 122
           HVG A  LK+  ++ I GPHKDD  +M  +  Q ++L I+     A S D WL+DGD + 
Sbjct: 61  HVGHAVDLKKYYNVPIWGPHKDDEFLMNDLTLQCQILKIKEYCNCAVSPDFWLKDGDIIE 120

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
           +G  +FKV HCPGHSPGHV++ N    F  +GD LF+ ++GR+D+  G Y  LINSI NK
Sbjct: 121 VGYEVFKVLHCPGHSPGHVVFWNESCKFIIMGDVLFKKNVGRSDLPGGSYVTLINSIKNK 180

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           +L L D+I+F+ GHGP S+IG ER+ N FL
Sbjct: 181 LLVLEDDINFLPGHGPISSIGYERKNNTFL 210


>gi|238753521|ref|ZP_04614884.1| hypothetical protein yruck0001_20510 [Yersinia ruckeri ATCC 29473]
 gi|238708474|gb|EEQ00829.1| hypothetical protein yruck0001_20510 [Yersinia ruckeri ATCC 29473]
          Length = 215

 Score =  204 bits (518), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 91/209 (43%), Positives = 138/209 (66%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + +HI+ VT F QNCT ++ E +  A +VDPGGD + I   +      V Q+ +THGH+D
Sbjct: 1   MKYHIIPVTAFSQNCTLIWCETTSLAALVDPGGDAEKIIAEVSRMGVTVTQLLLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L E   + I+GP K+D   +  +  Q+R+  +    ++    RWL++GD + +
Sbjct: 61  HVGAAAELAEFYQVPILGPEKEDRFWLEGLPAQSRMFGLS-ECQSFEPTRWLEEGDEVSV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGH+PGH++++N ++  A  GD +F+  +GR+D   GD+QQLINSI NK+
Sbjct: 120 GNMRLSVLHCPGHTPGHIVFINQDDRLALTGDVIFKGGVGRSDFPRGDHQQLINSIRNKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           LPLGD+++F+ GHGP ST+G ER+ NPF+
Sbjct: 180 LPLGDDMAFIPGHGPMSTMGHERQTNPFI 208


>gi|315499969|ref|YP_004088772.1| beta-lactamase domain protein [Asticcacaulis excentricus CB 48]
 gi|315417981|gb|ADU14621.1| beta-lactamase domain protein [Asticcacaulis excentricus CB 48]
          Length = 229

 Score =  203 bits (517), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 95/209 (45%), Positives = 132/209 (63%), Gaps = 2/209 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           +  VTP +QNCT ++  ++ +A V+DPGGD+  +   IQ R   +++IW+THGH DH GG
Sbjct: 11  VAPVTPLQQNCTVVWCTKTHKAAVIDPGGDIKPVLAEIQRRGLTIEKIWVTHGHADHAGG 70

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
              L E     I GPH DD   + ++ E A+   I  +AR+    RWL  GDT+ LG   
Sbjct: 71  TQALHEATGAPIEGPHADDRFWIERIPEDAKRWGI-YDARSFEPTRWLTHGDTVTLGETE 129

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
           ++V HCPGH+PGHVI+ + E+ FA +GD LFR SIGRTD   G++  LIN+I  ++ PLG
Sbjct: 130 WQVIHCPGHTPGHVIFYHPESQFAQVGDILFRGSIGRTDFPRGNHTDLINAITTRLWPLG 189

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           D + FVCGHGP S+   ER  NPF+   +
Sbjct: 190 D-VQFVCGHGPMSSFAAERAHNPFVGDRV 217


>gi|90579551|ref|ZP_01235360.1| hypothetical glyoxylase II family protein [Vibrio angustum S14]
 gi|90439125|gb|EAS64307.1| hypothetical glyoxylase II family protein [Vibrio angustum S14]
          Length = 217

 Score =  203 bits (517), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 94/214 (43%), Positives = 136/214 (63%), Gaps = 1/214 (0%)

Query: 3   KLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHV 62
            L + IV VTPF+QNC+ ++ +E+ +A +VDPGGD++ +  V+      V Q+ +THGH+
Sbjct: 2   SLKYQIVPVTPFQQNCSIIWCDETNQAAIVDPGGDIEQLTKVVDELGLTVTQLILTHGHL 61

Query: 63  DHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLL 122
           DHVGG A L + L++ +IGPHKDD   +  +  Q+ +    M      + +WL DGD + 
Sbjct: 62  DHVGGTAPLAQSLNVPVIGPHKDDEFWLQGLPRQSEMFGFPMTEAFEPT-QWLNDGDEIH 120

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
           +G    +V H PGH+PGHVI  + + N A +GD LF+  IGRTD   GD+  LIN+I  K
Sbjct: 121 VGNQTLQVLHTPGHTPGHVILFSNDANVAFVGDVLFKGGIGRTDFPRGDHPTLINAIKTK 180

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           + PLGD+++FV GHGP ST G ER  NPF+   +
Sbjct: 181 LWPLGDDVTFVPGHGPLSTFGHERATNPFVADEM 214


>gi|94312364|ref|YP_585574.1| beta-lactamase-like protein [Cupriavidus metallidurans CH34]
 gi|93356216|gb|ABF10305.1| putative metal-binding hydrolase [Cupriavidus metallidurans CH34]
          Length = 222

 Score =  203 bits (517), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 93/215 (43%), Positives = 137/215 (63%), Gaps = 1/215 (0%)

Query: 2   SKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGH 61
           +++   ++ VTPF+QNC+ L DE +  A V DPGGDLD I   ++ +   +++I++THGH
Sbjct: 5   AQMKALLIPVTPFQQNCSLLIDETTQRAAVCDPGGDLDRILSAVKEQGVTLEKIFLTHGH 64

Query: 62  VDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
           VDH  GAA L   L + I GP +++   + ++ EQ R      +      DRWL++GDT+
Sbjct: 65  VDHCAGAATLSRQLGIPIEGPQQEERFWIEQLPEQTRRFGF-GHPEAFEPDRWLENGDTV 123

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
             G    +V+HCPGH+PGHV++ +  N  A +GD LF  SIGRTD   G++  LI SI  
Sbjct: 124 TFGNETLEVYHCPGHTPGHVVFFSRPNKLAIVGDVLFAGSIGRTDFPRGNHADLIRSIRT 183

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           ++ PLGD+++FV GHGP ST G ERR NPF+  ++
Sbjct: 184 RLWPLGDDVTFVPGHGPVSTFGEERRNNPFVADHL 218


>gi|85058983|ref|YP_454685.1| hypothetical protein SG1005 [Sodalis glossinidius str. 'morsitans']
 gi|84779503|dbj|BAE74280.1| conserved hypothetical protein [Sodalis glossinidius str.
           'morsitans']
          Length = 209

 Score =  203 bits (516), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 91/210 (43%), Positives = 136/210 (64%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + +HI+ VT F QNC+ ++ E++  A +VDPGG+   ++  + +    VK+IW+THGH+D
Sbjct: 1   MKYHIMPVTAFSQNCSLVWCEQTGNAALVDPGGEAPRLRQEVATLGVTVKEIWLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG A+ L     + I+GPH+D+  ++  +  Q ++  +       + DRWL DG TL +
Sbjct: 61  HVGAASSLAAFYDVPIVGPHRDEEPLLASLPGQCQMFGVETTP-PLTLDRWLADGATLSI 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   F V HCPGHSPGHV++ N    F  +GD LF   IGRTD+  GD   L+ SI++++
Sbjct: 120 GKLSFHVLHCPGHSPGHVVFWNKAAKFILMGDVLFNGGIGRTDLPGGDMPTLMRSIHHQL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           +PL D+I+F+ GHGP ST+G ERR NPFL+
Sbjct: 180 MPLADDIAFLPGHGPMSTLGHERRTNPFLQ 209


>gi|268590139|ref|ZP_06124360.1| metallo-beta-lactamase family protein [Providencia rettgeri DSM
           1131]
 gi|291314412|gb|EFE54865.1| metallo-beta-lactamase family protein [Providencia rettgeri DSM
           1131]
          Length = 215

 Score =  203 bits (516), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 92/213 (43%), Positives = 138/213 (64%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + I+ VTPF QNC  ++DE +L+AVVVDPGG+ + +   I++    + +I +THGH D
Sbjct: 1   MKYTIIPVTPFMQNCQVIWDENTLDAVVVDPGGEAEKLISAIENLGLKLTKILLTHGHSD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G +A L +  S+ I GP K+DA  +  + EQ  +  I     + + D WL++GD +  
Sbjct: 61  HIGASATLSKHFSVPIYGPQKEDAFWIENLAEQNAMFYIG-ECPDFTPDYWLEEGDKVTC 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   F V HCPGH+PGH+I+VN  +    +GD LF+  +GR+D   G++Q LI+SI NK+
Sbjct: 120 GNITFDVLHCPGHTPGHIIFVNHADKLISMGDVLFKGGVGRSDFPRGNHQDLISSIKNKV 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           LPLGD+  F+ GHGP S +G ER+ NPFL+  +
Sbjct: 180 LPLGDDYQFIPGHGPMSNLGFERKTNPFLQDEL 212


>gi|120608985|ref|YP_968663.1| beta-lactamase domain-containing protein [Acidovorax citrulli
           AAC00-1]
 gi|120587449|gb|ABM30889.1| beta-lactamase domain protein [Acidovorax citrulli AAC00-1]
          Length = 240

 Score =  202 bits (515), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 94/209 (44%), Positives = 132/209 (63%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L +H   VT F+QNC+ ++ + +  A V+DPGGDLD +   ++ R   ++QIW+TH H+D
Sbjct: 30  LHYHTHPVTAFQQNCSLVWCDATQAAAVIDPGGDLDQVLAEVERRGLRLEQIWLTHAHID 89

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GGA +L E LSL I GPH  D   +  + +Q+ +      AR  +  RWL DGDT+ +
Sbjct: 90  HAGGAGELAERLSLPITGPHPGDQFWIDGLPQQSAMFGF-PPARPFTPTRWLHDGDTVQI 148

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGH+PGHV++   +     +GD LF  SIGRTD   G++Q LI+SI  ++
Sbjct: 149 GNETLHVRHCPGHTPGHVVFHAPQIQRCFVGDVLFAGSIGRTDFPQGNHQDLIDSIVQRL 208

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
            P+GDE  F+ GHGP ST GRERR NP++
Sbjct: 209 WPMGDETVFIPGHGPESTFGRERRSNPYV 237


>gi|212709811|ref|ZP_03317939.1| hypothetical protein PROVALCAL_00859 [Providencia alcalifaciens DSM
           30120]
 gi|212687622|gb|EEB47150.1| hypothetical protein PROVALCAL_00859 [Providencia alcalifaciens DSM
           30120]
          Length = 211

 Score =  202 bits (515), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 92/210 (43%), Positives = 138/210 (65%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + I+ VTPF QNC  ++DE S++AV+VDPGG+ + +   I+SR   + +I +THGH D
Sbjct: 1   MKYTIIPVTPFMQNCQVIWDENSMKAVIVDPGGEAEKLISAIESRGLTLTKILLTHGHSD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G +A L +   + I GP K+DA  +  + EQ  +  I  +  + + D WL++GD++  
Sbjct: 61  HIGASAPLAKHFGVPIYGPQKEDAFWIESLAEQNAMFYIG-DCPDFTPDHWLEEGDSITC 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   F V HCPGH+PGH+++VN  +    +GD LF+  +GR+D   G++Q LI SI NK+
Sbjct: 120 GDIKFDVLHCPGHTPGHIVFVNHADKLISMGDVLFKGGVGRSDFPRGNHQDLIASIKNKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           LPLGD+  F+ GHGP ST+G ER  NPFL+
Sbjct: 180 LPLGDDYHFIPGHGPMSTLGYERISNPFLQ 209


>gi|83592857|ref|YP_426609.1| beta-lactamase-like [Rhodospirillum rubrum ATCC 11170]
 gi|83575771|gb|ABC22322.1| Beta-lactamase-like [Rhodospirillum rubrum ATCC 11170]
          Length = 214

 Score =  202 bits (515), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 92/210 (43%), Positives = 137/210 (65%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L   I+ VTPF+QNCT L+ +E++   +VD GGD+D +   ++     ++++ +THGH+D
Sbjct: 3   LKATILPVTPFQQNCTLLWCDETMAGALVDAGGDVDRLLQAVEKTGVRLEKLLVTHGHLD 62

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GG A+++E L L + GPH DDA ++  + +QA         R+   DRWL  GD + L
Sbjct: 63  HAGGVAEIQERLGLPVEGPHADDAFLIEGMADQALRFGFP-EGRSFVPDRWLVQGDKVSL 121

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGHV++       A +GD LFR SIGRTD   GD+  L+ SI++++
Sbjct: 122 GALTLEVLHCPGHTPGHVVFFEPTARVAQVGDVLFRGSIGRTDFPRGDHATLLASIHDRL 181

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           LPLGD+++ + GHGP ST+G ERR NP+L+
Sbjct: 182 LPLGDDVTIIPGHGPLSTLGEERRTNPYLE 211


>gi|292487845|ref|YP_003530720.1| hypothetical protein EAMY_1362 [Erwinia amylovora CFBP1430]
 gi|292899072|ref|YP_003538441.1| metallo-beta-lactamase superfamily protein [Erwinia amylovora ATCC
           49946]
 gi|291198920|emb|CBJ46030.1| metallo-beta-lactamase superfamily protein [Erwinia amylovora ATCC
           49946]
 gi|291553267|emb|CBA20312.1| Uncharacterized protein M6_Spy0554 [Erwinia amylovora CFBP1430]
          Length = 209

 Score =  202 bits (515), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 94/210 (44%), Positives = 138/210 (65%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++HI+ VT F QNC+ ++  E+ EA +VDPGGD   IK  I +    VKQI +THGH+D
Sbjct: 1   MNYHIIPVTAFAQNCSVIWCPETGEAALVDPGGDAQKIKHEIAALGLTVKQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L E   + I+GPHK D   +  + +Q+++      A   + DRWLQ+G+ +L+
Sbjct: 61  HVGAAAELAEHYDVPIVGPHKADKFWLDGLPQQSQMFGFDECA-PLTPDRWLQEGEVVLV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G  + +V  CPGH+PGH+++   +      GD +F   +GR+D   G +Q LI SI NK+
Sbjct: 120 GNTVLEVLLCPGHTPGHIVFFERKARLLVSGDVIFSGGVGRSDFPQGSHQDLIASILNKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           LPLGD+++F+ GHGP ST+GRER  NPFL+
Sbjct: 180 LPLGDDVTFIAGHGPMSTLGRERISNPFLQ 209


>gi|149191674|ref|ZP_01869917.1| glyoxylase II family protein [Vibrio shilonii AK1]
 gi|148834515|gb|EDL51509.1| glyoxylase II family protein [Vibrio shilonii AK1]
          Length = 218

 Score =  202 bits (515), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 94/216 (43%), Positives = 135/216 (62%), Gaps = 1/216 (0%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M  L + +V VT F QNC+ ++ +E+++ VVVDPGGD+  ++ +I+     V+Q+ +THG
Sbjct: 1   MMSLQYQVVPVTSFAQNCSIVWCDETMKGVVVDPGGDVKQLEMLIKELGVQVEQLVLTHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DHVGG   L E L   I+GPHK D   +  ++ Q+++    +  +    ++WL DGDT
Sbjct: 61  HLDHVGGTEPLAEALDANIVGPHKADNFWLQGLENQSQMFGFPL-TKAFEPNQWLDDGDT 119

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           +  G     V H PGH+PGHV+  N E+  A +GD LF   IGRTD   GDY  LINSI 
Sbjct: 120 VEFGNQTLNVIHTPGHTPGHVVLFNDESKVAFVGDVLFNGGIGRTDFPQGDYATLINSIK 179

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            K+ PLG++++FV GHGP ST G ER  NPF+   +
Sbjct: 180 TKLWPLGNDVTFVPGHGPQSTFGHERASNPFVADEM 215


>gi|94501877|ref|ZP_01308388.1| Zn-dependent Hydrolase, including glyoxylases [Oceanobacter sp.
           RED65]
 gi|94426010|gb|EAT11007.1| Zn-dependent Hydrolase, including glyoxylases [Oceanobacter sp.
           RED65]
          Length = 214

 Score =  202 bits (513), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 93/210 (44%), Positives = 133/210 (63%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L + IV VTPF+QNC+ ++  E+ EA VVDPGGDL +I+  +      VKQ+ +TH H+D
Sbjct: 3   LEYRIVPVTPFQQNCSIIWCSETKEAAVVDPGGDLHLIEQAVDDLGVQVKQVLLTHCHID 62

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H G    + E   + I+GP K++   +  + +QA + +    A++ S DRWL++GD + +
Sbjct: 63  HAGMTQDVSEKHQVPIVGPQKEEQFWIDMLPQQAAMFNFP-QAKSFSPDRWLEEGDEVKV 121

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGH+PGHV++ N  +  A +GD LF   IGRTD   GD+Q LIN+I  K+
Sbjct: 122 GNETLSVLHCPGHTPGHVVFYNANSQLAIVGDVLFMGGIGRTDFPMGDHQTLINAIQQKL 181

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
             L +E  F+ GHGP STIG E+R NPF+K
Sbjct: 182 FALPEETQFIPGHGPMSTIGHEKRSNPFVK 211


>gi|254282948|ref|ZP_04957916.1| beta-lactamase domain protein [gamma proteobacterium NOR51-B]
 gi|219679151|gb|EED35500.1| beta-lactamase domain protein [gamma proteobacterium NOR51-B]
          Length = 216

 Score =  202 bits (513), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 95/210 (45%), Positives = 140/210 (66%), Gaps = 1/210 (0%)

Query: 3   KLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHV 62
            L+  IV VTPF+QNC+ +    S +  +VDPGGD++ ++  I+     V++I +THGH+
Sbjct: 2   SLAVTIVPVTPFQQNCSVVKCRSSGKLALVDPGGDIERLQSAIEQLGGEVEKILLTHGHL 61

Query: 63  DHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLL 122
           DHVG A  L+E L + I GPH+DD   + ++ E  R + + + A     DRWL+ GD + 
Sbjct: 62  DHVGAAGLLREQLGVPIEGPHRDDLFWLDQLPENCRAMGLPV-ADAFVPDRWLEGGDRVT 120

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
           +G    +V HCPGH+PGHV++V+ ++  A +GD LF  SIGR+D   G++ QL+ SI  +
Sbjct: 121 VGDAEMQVLHCPGHTPGHVVFVHEDDKIAFVGDVLFAGSIGRSDFPRGNHDQLVASIRER 180

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           + PLGD+I+FV GHGPNST G+ERR NPF+
Sbjct: 181 LFPLGDDITFVPGHGPNSTFGQERRTNPFV 210


>gi|312797501|ref|YP_004030423.1| Hydroxyacylglutathione hydrolase [Burkholderia rhizoxinica HKI 454]
 gi|312169276|emb|CBW76279.1| Hydroxyacylglutathione hydrolase (EC 3.1.2.6) [Burkholderia
           rhizoxinica HKI 454]
          Length = 234

 Score =  202 bits (513), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 93/215 (43%), Positives = 135/215 (62%), Gaps = 1/215 (0%)

Query: 2   SKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGH 61
           + +   ++ VT F QNC+ L  E++  A +VDPGGDL++I+  +Q R   V+++ +THGH
Sbjct: 18  NPMQVKLIPVTAFMQNCSLLVCEQTQRAAIVDPGGDLELIQAQVQKRGASVEKVLLTHGH 77

Query: 62  VDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
           VDH  GA  L     + I GPH D+   +  + +Q+    +   A+    DRWL DGDT+
Sbjct: 78  VDHCAGARALANHYGVPIEGPHPDEQFWLALLPQQSTRFGLPA-AQAFEPDRWLHDGDTV 136

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
             G  I +V HCPGH+PGHV++ + E+  A +GD LF  SIGRTD   G++  LI+SI  
Sbjct: 137 RFGNEILEVLHCPGHTPGHVVFFSREHRLALVGDVLFAGSIGRTDFPRGNHADLISSIRK 196

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           K+ PLGD++ FV GHGP ST G ERR NP++  ++
Sbjct: 197 KLWPLGDDVRFVPGHGPMSTFGEERRTNPYVADHV 231


>gi|90020043|ref|YP_525870.1| putative metallo-beta-lactamase family protein [Saccharophagus
           degradans 2-40]
 gi|89949643|gb|ABD79658.1| beta-lactamase-like protein [Saccharophagus degradans 2-40]
          Length = 215

 Score =  201 bits (512), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 92/205 (44%), Positives = 136/205 (66%), Gaps = 1/205 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           I+ VT ++QNC+ ++ E + +A  +DPGGD++ +   +Q     + +I +THGH+DHVGG
Sbjct: 5   ILPVTHYQQNCSLIWCENTNQAAFIDPGGDVERLLAAVQEEGVELSKIILTHGHLDHVGG 64

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
            A+L   L L + GPHKDD+  +  +  QA+++     A + + +RWL DGDT+ LG   
Sbjct: 65  TAELVAKLGLPVEGPHKDDSFWLDMLSTQAQMMGFAPVA-SFTPNRWLNDGDTVTLGDQT 123

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
             V+HCPGH+PGHV+  +     A +GD LF+ SIGRTD   GDY+QL+ +I +K+ PLG
Sbjct: 124 LAVYHCPGHTPGHVVLHHKATKKAFVGDVLFKGSIGRTDFPRGDYEQLVTAIRSKLWPLG 183

Query: 188 DEISFVCGHGPNSTIGRERRLNPFL 212
           D+++FV GHGP ST G ER  NPF+
Sbjct: 184 DDVTFVPGHGPTSTFGEERASNPFV 208


>gi|53723970|ref|YP_104416.1| metallo-beta-lactamase family protein [Burkholderia mallei ATCC
           23344]
 gi|67643050|ref|ZP_00441799.1| metallo-beta-lactamase family protein [Burkholderia mallei GB8
           horse 4]
 gi|121601063|ref|YP_994679.1| metallo-beta-lactamase family protein [Burkholderia mallei SAVP1]
 gi|124385527|ref|YP_001027612.1| metallo-beta-lactamase family protein [Burkholderia mallei NCTC
           10229]
 gi|126449497|ref|YP_001082489.1| metallo-beta-lactamase family protein [Burkholderia mallei NCTC
           10247]
 gi|126452838|ref|YP_001068123.1| metallo-beta-lactamase family protein [Burkholderia pseudomallei
           1106a]
 gi|167001305|ref|ZP_02267104.1| metallo-beta-lactamase family protein [Burkholderia mallei PRL-20]
 gi|167744646|ref|ZP_02417420.1| metallo-beta-lactamase family protein [Burkholderia pseudomallei
           14]
 gi|167851625|ref|ZP_02477133.1| metallo-beta-lactamase family protein [Burkholderia pseudomallei
           B7210]
 gi|217423912|ref|ZP_03455412.1| metallo-beta-lactamase family protein [Burkholderia pseudomallei
           576]
 gi|242316833|ref|ZP_04815849.1| metallo-beta-lactamase family protein [Burkholderia pseudomallei
           1106b]
 gi|254175066|ref|ZP_04881727.1| metallo-beta-lactamase family protein [Burkholderia mallei ATCC
           10399]
 gi|254194751|ref|ZP_04901182.1| metallo-beta-lactamase family protein [Burkholderia pseudomallei
           S13]
 gi|254201491|ref|ZP_04907855.1| metallo-beta-lactamase family protein [Burkholderia mallei FMH]
 gi|254206831|ref|ZP_04913182.1| metallo-beta-lactamase family protein [Burkholderia mallei JHU]
 gi|254357141|ref|ZP_04973415.1| metallo-beta-lactamase family protein [Burkholderia mallei
           2002721280]
 gi|52427393|gb|AAU47986.1| metallo-beta-lactamase family protein [Burkholderia mallei ATCC
           23344]
 gi|121229873|gb|ABM52391.1| metallo-beta-lactamase family protein [Burkholderia mallei SAVP1]
 gi|124293547|gb|ABN02816.1| metallo-beta-lactamase family protein [Burkholderia mallei NCTC
           10229]
 gi|126226480|gb|ABN90020.1| metallo-beta-lactamase family protein [Burkholderia pseudomallei
           1106a]
 gi|126242367|gb|ABO05460.1| metallo-beta-lactamase family protein [Burkholderia mallei NCTC
           10247]
 gi|147747385|gb|EDK54461.1| metallo-beta-lactamase family protein [Burkholderia mallei FMH]
 gi|147752373|gb|EDK59439.1| metallo-beta-lactamase family protein [Burkholderia mallei JHU]
 gi|148026205|gb|EDK84290.1| metallo-beta-lactamase family protein [Burkholderia mallei
           2002721280]
 gi|160696111|gb|EDP86081.1| metallo-beta-lactamase family protein [Burkholderia mallei ATCC
           10399]
 gi|169651501|gb|EDS84194.1| metallo-beta-lactamase family protein [Burkholderia pseudomallei
           S13]
 gi|217392975|gb|EEC32997.1| metallo-beta-lactamase family protein [Burkholderia pseudomallei
           576]
 gi|238524294|gb|EEP87727.1| metallo-beta-lactamase family protein [Burkholderia mallei GB8
           horse 4]
 gi|242140072|gb|EES26474.1| metallo-beta-lactamase family protein [Burkholderia pseudomallei
           1106b]
 gi|243062920|gb|EES45106.1| metallo-beta-lactamase family protein [Burkholderia mallei PRL-20]
          Length = 214

 Score =  201 bits (512), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 94/209 (44%), Positives = 133/209 (63%), Gaps = 1/209 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           ++ VTPF+QNC+ L  E++  A VVDPGGDL++I+  +  ++  V+++ +THGHVDH  G
Sbjct: 5   LIPVTPFQQNCSLLVCEKTGRAAVVDPGGDLELIEQEVARQHVQVEKVLLTHGHVDHCAG 64

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           A +L     + I GPH+D+   + K+  Q+        A     DRWL DGDTL  G   
Sbjct: 65  AKRLAAHYGVPIEGPHEDERFWIEKLPMQSERFGFPA-AEAFEPDRWLADGDTLAFGEET 123

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
            +V+HCPGH+PGHV++ +  +  A +GD LF  SIGRTD   G++  LI SI  K+ PLG
Sbjct: 124 LEVYHCPGHTPGHVVFFSRAHRLAVVGDVLFAGSIGRTDFPRGNHADLIRSIREKLWPLG 183

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           D+++FV GHGP ST G ERR NPF+   +
Sbjct: 184 DDVTFVPGHGPVSTFGDERRTNPFVADGV 212


>gi|307825064|ref|ZP_07655285.1| beta-lactamase domain protein [Methylobacter tundripaludum SV96]
 gi|307733812|gb|EFO04668.1| beta-lactamase domain protein [Methylobacter tundripaludum SV96]
          Length = 210

 Score =  201 bits (512), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 96/211 (45%), Positives = 135/211 (63%), Gaps = 3/211 (1%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + F I  VT ++QNC+ L  E + +A +VDPGGD+D I   I   N   + I ITHGH+D
Sbjct: 1   MRFCITPVTAYQQNCSLLICEHTNKAAIVDPGGDIDTILKAIDRENATPESILITHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNA-SSDRWLQDGDTLL 122
           H+G  A+L   LS+ +IGPH+DD   +  + EQ R  + R  A ++ +  RWL  GD + 
Sbjct: 61  HIGATAELAALLSIPVIGPHQDDQFWIDAIPEQCR--TFRFPACDSFTPSRWLSQGDIVK 118

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
           +G  +  VFHCPGH+PGHV++V+     A +GD LF+ SIGRTD+  GD+  LI+SI N 
Sbjct: 119 VGEEVLDVFHCPGHTPGHVVFVHRNTKLAIVGDVLFKGSIGRTDLPKGDFNTLIHSIKNN 178

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           + PLG++ +F+ GHGP ST G E R NPF+ 
Sbjct: 179 LWPLGEQFTFIPGHGPMSTFGEEMRNNPFVS 209


>gi|123441870|ref|YP_001005853.1| metallo-beta-lactamase superfamily protein [Yersinia enterocolitica
           subsp. enterocolitica 8081]
 gi|122088831|emb|CAL11637.1| metallo-beta-lactamase superfamily protein [Yersinia enterocolitica
           subsp. enterocolitica 8081]
          Length = 215

 Score =  201 bits (512), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 88/212 (41%), Positives = 136/212 (64%), Gaps = 1/212 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + I+ VT F QNCT ++ EE+ +A +VDPGG+   I   +   N  + QI +THGH+D
Sbjct: 1   MKYQIIPVTAFSQNCTLIWCEETGQAALVDPGGEAAKIIAEVARHNIQINQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L     + I GP K+D   +  +  Q+R+  +       +  RWL++GD + +
Sbjct: 61  HVGAAAELAAHFQVPIYGPEKEDTFWLEGLPAQSRMFGLS-ECEAFTPTRWLEEGDKITV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGH+PGH+++++ ++  A +GD +F   +GR+D   GD+QQLINSI  K+
Sbjct: 120 GAIELSVLHCPGHTPGHIVFIDQKDRLALVGDVIFSGGVGRSDFPRGDHQQLINSIRTKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSN 215
           LPLGD+++F+ GHGP ST+G ER+ NPF++  
Sbjct: 180 LPLGDDMTFIPGHGPMSTLGHERQTNPFIREE 211


>gi|134281456|ref|ZP_01768164.1| metallo-beta-lactamase family protein [Burkholderia pseudomallei
           305]
 gi|134247123|gb|EBA47209.1| metallo-beta-lactamase family protein [Burkholderia pseudomallei
           305]
          Length = 214

 Score =  201 bits (511), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 94/209 (44%), Positives = 134/209 (64%), Gaps = 1/209 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           ++ VTPF+QNC+ L  E++  A VVDPGGDL++I+  +  ++  V+++ +THGHVDH  G
Sbjct: 5   LIPVTPFQQNCSLLVCEKTGRAAVVDPGGDLELIEQEVARQHVQVEKVLLTHGHVDHCAG 64

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           A +L     + I GPH+D+   + K+  Q+        A     DRWL DGDTL  G   
Sbjct: 65  AKRLAAHYGVPIEGPHEDERFWIEKLPMQSERFGFPA-AEAFEPDRWLADGDTLAFGEET 123

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
            +V+HCPGH+PGHV++ +  +  A +GD LF  SIGRTD   G++  LI+SI  K+ PLG
Sbjct: 124 LEVYHCPGHTPGHVVFFSRAHRLAIVGDVLFAGSIGRTDFPRGNHADLIHSIREKLWPLG 183

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           D+++FV GHGP ST G ERR NPF+   +
Sbjct: 184 DDVTFVPGHGPVSTFGDERRTNPFVADGV 212


>gi|260597327|ref|YP_003209898.1| hypothetical protein CTU_15350 [Cronobacter turicensis z3032]
 gi|260216504|emb|CBA29678.1| Uncharacterized protein ycbL [Cronobacter turicensis z3032]
          Length = 228

 Score =  201 bits (511), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 90/215 (41%), Positives = 141/215 (65%), Gaps = 1/215 (0%)

Query: 2   SKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGH 61
           S +++HI+ VT F QNC+ ++ EE+ +A +VDPGGD   IK+ +      ++QI +THGH
Sbjct: 12  SGMNYHIIPVTAFAQNCSLIWCEETRQAALVDPGGDAQRIKEEVARMGVTLQQILLTHGH 71

Query: 62  VDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
           +DHVG AA+L     + IIGP K+D   +  +  Q+R+  +    +  + DRWL +GDT+
Sbjct: 72  LDHVGAAAELAAHYGIPIIGPEKEDEFWLQGLPAQSRMFGLD-ECQPLTPDRWLNEGDTV 130

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
            +G     V HCPGH+PGH+++ + ++     GD +F+  +GR+D   GD+ QLI++I  
Sbjct: 131 NVGNISLAVLHCPGHTPGHIVFFDAQSRLLVSGDVIFKGGVGRSDFPRGDHSQLIDAIKR 190

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           K+LPLGD+++F+ GHGP ST+G ER  NPFL+  +
Sbjct: 191 KLLPLGDDVTFIPGHGPMSTLGHERLHNPFLQDEM 225


>gi|126439461|ref|YP_001060816.1| metallo-beta-lactamase family protein [Burkholderia pseudomallei
           668]
 gi|167721647|ref|ZP_02404883.1| metallo-beta-lactamase family protein [Burkholderia pseudomallei
           DM98]
 gi|167904687|ref|ZP_02491892.1| metallo-beta-lactamase family protein [Burkholderia pseudomallei
           NCTC 13177]
 gi|237814213|ref|YP_002898664.1| hydrolase [Burkholderia pseudomallei MSHR346]
 gi|254183854|ref|ZP_04890445.1| metallo-beta-lactamase family protein [Burkholderia pseudomallei
           1655]
 gi|126218954|gb|ABN82460.1| metallo-beta-lactamase family protein [Burkholderia pseudomallei
           668]
 gi|184214386|gb|EDU11429.1| metallo-beta-lactamase family protein [Burkholderia pseudomallei
           1655]
 gi|237506833|gb|ACQ99151.1| hydrolase [Burkholderia pseudomallei MSHR346]
          Length = 214

 Score =  201 bits (511), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 94/209 (44%), Positives = 133/209 (63%), Gaps = 1/209 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           ++ VTPF+QNC+ L  E++  A VVDPGGDL++I+  +  ++  V+++ +THGHVDH  G
Sbjct: 5   LIPVTPFQQNCSLLVCEKTGRAAVVDPGGDLELIEQEVARQHVQVEKVLLTHGHVDHCAG 64

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           A +L     + I GPH+D+   + K+  Q+        A     DRWL DGDTL  G   
Sbjct: 65  AKRLAAHYGVPIEGPHEDERFWIEKLPMQSERFGFPA-AEAFEPDRWLADGDTLAFGEET 123

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
            +V+HCPGH+PGHV++ +  +  A +GD LF  SIGRTD   G++  LI SI  K+ PLG
Sbjct: 124 LEVYHCPGHTPGHVVFFSRAHRLAIVGDVLFAGSIGRTDFPRGNHADLIRSIREKLWPLG 183

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           D+++FV GHGP ST G ERR NPF+   +
Sbjct: 184 DDVTFVPGHGPVSTFGDERRTNPFVADGV 212


>gi|288961941|ref|YP_003452251.1| beta-lactamase-like protein [Azospirillum sp. B510]
 gi|288914221|dbj|BAI75707.1| beta-lactamase-like protein [Azospirillum sp. B510]
          Length = 210

 Score =  201 bits (511), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 91/209 (43%), Positives = 138/209 (66%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + IV VTPF+QNCT L+  E+++   +DPGG+LD I    +++   +++I +THGH+D
Sbjct: 1   MQYAIVPVTPFQQNCTVLWCPETMKGAAIDPGGELDRILAAAKAKGVTLEKILVTHGHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GG A L + LSL I GPH++D   +  +  Q+++       R+ + DRWL++GDT+ +
Sbjct: 61  HAGGVADLADKLSLPIEGPHREDQFWIDGMPHQSQMFGFP-PVRSFTPDRWLEEGDTVTV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGHV++V+  +  A +GD LF+ SIGRTD   G++  LI SI  ++
Sbjct: 120 GNQSLEVRHCPGHTPGHVVFVHRPSKLAIVGDVLFQGSIGRTDFPKGNHGDLIASIRERL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
            P GD+ +F+ GHGP S+ G ER  NPFL
Sbjct: 180 FPYGDDFAFIPGHGPMSSFGEERLYNPFL 208


>gi|85709157|ref|ZP_01040223.1| glyoxalase II family protein [Erythrobacter sp. NAP1]
 gi|85690691|gb|EAQ30694.1| glyoxalase II family protein [Erythrobacter sp. NAP1]
          Length = 221

 Score =  201 bits (511), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 93/212 (43%), Positives = 139/212 (65%), Gaps = 2/212 (0%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           +  +   I+ VTP +QNC+ ++  ++ +A ++DPGGDLD +KD I      +++I ITHG
Sbjct: 6   IPPMKAAIIPVTPLQQNCSLIWCTKTNKAALIDPGGDLDKLKDGIAKAGVEMEKILITHG 65

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DH G A  L E+L L I GPHKDD   + ++D         M A++ + DRWL++ DT
Sbjct: 66  HLDHCGQAGMLAEELGLPIEGPHKDDLFWIEQLDSDGARYG--MTAQSFTPDRWLENNDT 123

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           + +G     V HCPGH+PGHV++ +  + FA +GD LF+ SIGRTD   G++Q LI+SI 
Sbjct: 124 VTVGELTLDVIHCPGHTPGHVVFFHAPSRFAIVGDVLFQGSIGRTDFPRGNHQDLIDSIT 183

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
            ++ PLG+++ F+ GHGP ST GRER+ N F+
Sbjct: 184 QRLWPLGEDVMFIPGHGPTSTFGRERKTNAFV 215


>gi|53720887|ref|YP_109873.1| metallo-beta-lactamase superfamily protein [Burkholderia
           pseudomallei K96243]
 gi|76810998|ref|YP_331461.1| metallo-beta-lactamase superfamily protein [Burkholderia
           pseudomallei 1710b]
 gi|167817838|ref|ZP_02449518.1| metallo-beta-lactamase superfamily protein [Burkholderia
           pseudomallei 91]
 gi|167826216|ref|ZP_02457687.1| metallo-beta-lactamase superfamily protein [Burkholderia
           pseudomallei 9]
 gi|167896313|ref|ZP_02483715.1| metallo-beta-lactamase superfamily protein [Burkholderia
           pseudomallei 7894]
 gi|167912968|ref|ZP_02500059.1| metallo-beta-lactamase superfamily protein [Burkholderia
           pseudomallei 112]
 gi|167924647|ref|ZP_02511738.1| metallo-beta-lactamase superfamily protein [Burkholderia
           pseudomallei BCC215]
 gi|226193263|ref|ZP_03788873.1| metallo-beta-lactamase family protein [Burkholderia pseudomallei
           Pakistan 9]
 gi|254186333|ref|ZP_04892850.1| metallo-beta-lactamase family protein [Burkholderia pseudomallei
           Pasteur 52237]
 gi|254261750|ref|ZP_04952804.1| metallo-beta-lactamase family protein [Burkholderia pseudomallei
           1710a]
 gi|254298822|ref|ZP_04966273.1| metallo-beta-lactamase family protein [Burkholderia pseudomallei
           406e]
 gi|52211301|emb|CAH37290.1| metallo-beta-lactamase superfamily protein [Burkholderia
           pseudomallei K96243]
 gi|76580451|gb|ABA49926.1| metallo-beta-lactamase superfamily protein [Burkholderia
           pseudomallei 1710b]
 gi|157808682|gb|EDO85852.1| metallo-beta-lactamase family protein [Burkholderia pseudomallei
           406e]
 gi|157934018|gb|EDO89688.1| metallo-beta-lactamase family protein [Burkholderia pseudomallei
           Pasteur 52237]
 gi|225934863|gb|EEH30840.1| metallo-beta-lactamase family protein [Burkholderia pseudomallei
           Pakistan 9]
 gi|254220439|gb|EET09823.1| metallo-beta-lactamase family protein [Burkholderia pseudomallei
           1710a]
          Length = 214

 Score =  201 bits (511), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 94/209 (44%), Positives = 133/209 (63%), Gaps = 1/209 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           ++ VTPF+QNC+ L  E++  A VVDPGGDL++I+  +  ++  V+++ +THGHVDH  G
Sbjct: 5   LIPVTPFQQNCSLLVCEKTGRAAVVDPGGDLELIEQEVARQHVQVEKVLLTHGHVDHCAG 64

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           A +L     + I GPH+D+   + K+  Q+        A     DRWL DGDTL  G   
Sbjct: 65  AKRLAAHYGVPIEGPHEDERFWIEKLPMQSERFGFPA-AEAFEPDRWLADGDTLAFGEET 123

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
            +V+HCPGH+PGHV++ +  +  A +GD LF  SIGRTD   G++  LI SI  K+ PLG
Sbjct: 124 LEVYHCPGHTPGHVVFFSRAHRLAIVGDVLFAGSIGRTDFPRGNHADLIRSIREKLWPLG 183

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           D+++FV GHGP ST G ERR NPF+   +
Sbjct: 184 DDVTFVPGHGPVSTFGDERRTNPFVADEV 212


>gi|320540485|ref|ZP_08040135.1| putative predicted metal-binding enzyme [Serratia symbiotica str.
           Tucson]
 gi|320029416|gb|EFW11445.1| putative predicted metal-binding enzyme [Serratia symbiotica str.
           Tucson]
          Length = 215

 Score =  201 bits (511), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 90/211 (42%), Positives = 137/211 (64%), Gaps = 1/211 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + +HI+ VT F QNC+ ++ E + +A +VDPGGD + IK  +  R   + QI +THGH+D
Sbjct: 1   MKYHIIPVTAFSQNCSLIWCEHTQQAALVDPGGDAEKIKAEVARRGVTLSQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L E   + I+GP K+DA  +G +  Q+++  +   A    + +WL +GD + +
Sbjct: 61  HVGAAAELAEHYQVPILGPDKEDAFWLGGLPAQSQMFGLEECAPLIPT-QWLAEGDEVKV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    KV HCPGH+PGH++++N +   A +GD LF   +GR+D   GD+Q LIN+I  K+
Sbjct: 120 GEMTLKVLHCPGHTPGHIVFINQQARLALVGDVLFNGGVGRSDFPRGDHQALINAIRTKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           LP GD++ F+ GHG  S+ G ER+ NPFL+ 
Sbjct: 180 LPQGDDMGFIPGHGSMSSFGHERQTNPFLRE 210


>gi|83648380|ref|YP_436815.1| Zn-dependent hydrolase [Hahella chejuensis KCTC 2396]
 gi|83636423|gb|ABC32390.1| Zn-dependent Hydrolase, including glyoxylases [Hahella chejuensis
           KCTC 2396]
          Length = 210

 Score =  201 bits (511), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 94/210 (44%), Positives = 133/210 (63%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + IV VTPF QNCT L+ E++ +A VVDPGGDL  I+ V+      ++++ +TH H+D
Sbjct: 1   MKYEIVPVTPFVQNCTVLWCEKTRQAAVVDPGGDLAKIEAVLSRNGLTLEKVLLTHAHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GG A+L E   + I GP  +D   +  + +Q+ +      A+  + DRWL +GD + +
Sbjct: 61  HAGGTAELAEAHEIPIEGPEYEDKFWIDALPQQSMMFGFP-TAKQFTPDRWLNEGDEVSV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGHVI+ +     A +GD LF  SIGRTD   GD+  LI SI  K+
Sbjct: 120 GEETLQVLHCPGHTPGHVIFFHQGARLALVGDVLFNGSIGRTDFPKGDHATLIQSIKTKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
            PLGD++SF+ GHGP ST G ER+ NPF+K
Sbjct: 180 WPLGDDVSFIPGHGPMSTFGAERKTNPFVK 209


>gi|300722555|ref|YP_003711845.1| hypothetical protein XNC1_1584 [Xenorhabdus nematophila ATCC 19061]
 gi|297629062|emb|CBJ89647.1| putative enzyme with metallo-hydrolase/oxidoreductase domain
           [Xenorhabdus nematophila ATCC 19061]
          Length = 210

 Score =  201 bits (511), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 93/211 (44%), Positives = 133/211 (63%), Gaps = 1/211 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + +HI+ VT   QNCT ++ EE+ EA +VDPGG+ + +   I+ R   V QI +THGH D
Sbjct: 1   MKYHIIPVTMAMQNCTLIWCEETQEAAIVDPGGNAEQLIAEIERRGLKVTQILLTHGHYD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG   ++ +   + + GPHK DA  +  ++ Q ++  +     + + DRWL +GDTL +
Sbjct: 61  HVGATVEVSKHFDVPVYGPHKGDAFWIEGLEIQCQMFGVE-PCPSFTPDRWLDEGDTLHV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGH+PGH+I  N       +GD LF+ SIGRTD   G+Y +LI SI  K+
Sbjct: 120 GNVELSVLHCPGHTPGHIILANHTEKLISMGDVLFKGSIGRTDFPGGNYDELIQSIKQKV 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           LPLGD+  F+ GHGP ST+G ER+ NPFL++
Sbjct: 180 LPLGDDYQFIPGHGPMSTLGHERKTNPFLQN 210


>gi|238785820|ref|ZP_04629790.1| Beta-lactamase domain protein [Yersinia bercovieri ATCC 43970]
 gi|238713273|gb|EEQ05315.1| Beta-lactamase domain protein [Yersinia bercovieri ATCC 43970]
          Length = 215

 Score =  201 bits (511), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 90/212 (42%), Positives = 136/212 (64%), Gaps = 1/212 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + I+ VT F QNCT ++ E + +A +VDPGGD D I   +  +  +V QI +THGH+D
Sbjct: 1   MKYQIIPVTAFSQNCTLIWCEATGQAALVDPGGDADKIIAEVARQGVNVNQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L     + I GP K+D   +  +  Q+R+  +       +  RWL++GD + +
Sbjct: 61  HVGAAAELAAHFDIPIYGPEKEDIFWLEGLPAQSRMFGLD-ECETFTPTRWLEEGDKVTV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGH+PGH+++++ +   A +GD +F   +GR+D   GD+QQLINSI  K+
Sbjct: 120 GEIELSVLHCPGHTPGHIVFIDQQGRLALVGDVIFNGGVGRSDFPRGDHQQLINSIRTKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSN 215
           LPLGD+I+F+ GHGP ST+G ER+ NPF++  
Sbjct: 180 LPLGDDITFIPGHGPMSTLGHERQTNPFIREE 211


>gi|261344274|ref|ZP_05971918.1| metallo-beta-lactamase family protein [Providencia rustigianii DSM
           4541]
 gi|282567877|gb|EFB73412.1| metallo-beta-lactamase family protein [Providencia rustigianii DSM
           4541]
          Length = 215

 Score =  201 bits (510), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 91/213 (42%), Positives = 141/213 (66%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + I+ VTPF QNC  ++D+ S+EAV+VDPGG+ + + + I+S    + +I +THGH D
Sbjct: 1   MKYTIIPVTPFMQNCHIIWDDNSMEAVIVDPGGETEKLINAIESLGLTLTKILLTHGHSD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G +A L +   + I GP K+DA  +  + +Q  + +I  +  + + D WL++GD++  
Sbjct: 61  HIGASAPLAKHFGVPIYGPQKEDAFWIENLAQQNAMFNIG-DCPDFTPDHWLEEGDSVSC 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   F V HCPGH+PGH+++VN  +    +GD LF+  +GR+D   G++Q LI+SI NK+
Sbjct: 120 GNIKFDVLHCPGHTPGHIVFVNHGDKLISMGDVLFKGGVGRSDFPRGNHQDLISSIKNKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           LPLGDE  F+ GHGP ST+G ER  NPFL+  +
Sbjct: 180 LPLGDEYQFIPGHGPMSTLGHERISNPFLQDEL 212


>gi|259908905|ref|YP_002649261.1| Putative metallo-beta-lactamase [Erwinia pyrifoliae Ep1/96]
 gi|224964527|emb|CAX56037.1| Putative metallo-beta-lactamase [Erwinia pyrifoliae Ep1/96]
 gi|283478900|emb|CAY74816.1| Uncharacterized protein M6_Spy0554 [Erwinia pyrifoliae DSM 12163]
          Length = 209

 Score =  201 bits (510), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 93/210 (44%), Positives = 138/210 (65%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++HI+ VT F QNC+ ++  E+ EA +VDPGGD   I+  I      VKQI +THGH+D
Sbjct: 1   MNYHIIPVTAFAQNCSVIWCPETGEAALVDPGGDAHKIRHEIAGLGITVKQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L E   + ++GPH+ D   +  + +Q+++      A  A  DRWLQ+G+ + +
Sbjct: 61  HVGAAAELAEHYGVPVVGPHRADKFWLDGLPQQSQMFGFDECAPLAP-DRWLQEGEVVHV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G  + +V  CPGH+PGH+++ + E      GD +F   +GR+D   G +QQLI SI NK+
Sbjct: 120 GNTVLEVLLCPGHTPGHIVFFDREGRLLVSGDVIFSGGVGRSDFPQGSHQQLIASILNKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           LPLGD+++F+ GHGP ST+GRER  NPFL+
Sbjct: 180 LPLGDDVTFIAGHGPMSTLGRERISNPFLQ 209


>gi|119900112|ref|YP_935325.1| hypothetical protein azo3823 [Azoarcus sp. BH72]
 gi|119672525|emb|CAL96439.1| conserved hypothetical protein [Azoarcus sp. BH72]
          Length = 252

 Score =  201 bits (510), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 93/211 (44%), Positives = 136/211 (64%), Gaps = 1/211 (0%)

Query: 2   SKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGH 61
           + L   IV VT F+QNC+ L+ + S++A VVDPGGDL+ I   ++     V++I ITHGH
Sbjct: 39  AMLQIQIVPVTAFEQNCSILWCDRSMKAAVVDPGGDLERIHAAVKKLGVSVEKILITHGH 98

Query: 62  VDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
           +DH GG A+L  DL + + GP ++D   +  + +Q+++     +      DRWL DGDT+
Sbjct: 99  IDHAGGTARLARDLGVPVEGPQQEDRFWIVAMPQQSKMFGFP-DVEAFEPDRWLGDGDTV 157

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
            +G    +V H PGH+PGHV++   E   A +GD LF  SIGRTD   G++ +LI+SI N
Sbjct: 158 SVGEETLQVIHAPGHTPGHVVFFQPEARLAVVGDVLFAGSIGRTDFPRGNHAELISSIRN 217

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           K+ PLGD+++F+ GHGP ST G ER  NP++
Sbjct: 218 KLFPLGDDVTFIPGHGPASTFGDERDSNPYV 248


>gi|304397087|ref|ZP_07378966.1| conserved hypothetical protein [Pantoea sp. aB]
 gi|304355236|gb|EFM19604.1| conserved hypothetical protein [Pantoea sp. aB]
          Length = 209

 Score =  201 bits (510), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 91/210 (43%), Positives = 138/210 (65%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++HI+ VT F QNC+ ++ + + EA +VDPGGD +++K  ++       QI +THGH+D
Sbjct: 1   MNYHIIPVTAFAQNCSVIWCDSTREAALVDPGGDAELVKQTLEQLGLKPAQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG A +L     + IIGP K DA  +  +  Q+R+  +   A   + DRWL++G+++ +
Sbjct: 61  HVGAAVELAAFWQIPIIGPQKRDAFWLEALPTQSRMFGLDECA-PFTPDRWLEEGESVQV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGHSPGHV++ + +      GD +F   +GRTD   GD+QQLIN+I  K+
Sbjct: 120 GLITLEVLHCPGHSPGHVVFFDRQGRLLISGDVIFNGGVGRTDFPQGDHQQLINAIRTKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           LPLGD+++F+ GHGP ST+G ER  NPFL+
Sbjct: 180 LPLGDDVTFLPGHGPISTLGHERVSNPFLQ 209


>gi|167838272|ref|ZP_02465131.1| metallo-beta-lactamase family protein [Burkholderia thailandensis
           MSMB43]
          Length = 214

 Score =  201 bits (510), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 93/209 (44%), Positives = 133/209 (63%), Gaps = 1/209 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           ++ VTPF+QNC+ L  E++  A VVDPGGDL++I+  +  ++  V+++ +THGHVDH  G
Sbjct: 5   LIPVTPFQQNCSLLVCEKTGRAAVVDPGGDLELIEQEVARQSVQVEKVLLTHGHVDHCAG 64

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           A +L     + I GPH+D+   + K+  Q+        A     DRWL DGDT+  G   
Sbjct: 65  AKRLAAHYGVPIEGPHEDERFWIEKLPMQSERFGFPA-AEAFEPDRWLDDGDTVTFGEET 123

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
            +V+HCPGH+PGHV++ +  +  A +GD LF  SIGRTD   G++  LI SI  K+ PLG
Sbjct: 124 LEVYHCPGHAPGHVVFFSRAHRLAIVGDVLFAGSIGRTDFPRGNHADLIRSIREKLWPLG 183

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           D+++FV GHGP ST G ERR NPF+   +
Sbjct: 184 DDVTFVPGHGPVSTFGNERRTNPFVADGV 212


>gi|330993049|ref|ZP_08316987.1| hypothetical protein SXCC_02949 [Gluconacetobacter sp. SXCC-1]
 gi|329759819|gb|EGG76325.1| hypothetical protein SXCC_02949 [Gluconacetobacter sp. SXCC-1]
          Length = 219

 Score =  201 bits (510), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 97/217 (44%), Positives = 141/217 (64%), Gaps = 7/217 (3%)

Query: 2   SKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGH 61
           + LS  IV VT F QNC+ L++  +L AVVVDPGGD+  I   I +++  V  IW+THGH
Sbjct: 3   APLSLEIVPVTAFGQNCSILWNPATLHAVVVDPGGDVPRIMAFIAAKDLVVDSIWLTHGH 62

Query: 62  VDHVGGAAQLKEDL------SLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWL 115
           +DH GGA  L+ +L      ++ +IGP + D  ++  + +QA L  +     +   DR++
Sbjct: 63  LDHAGGADALRRELTARQGKAVPVIGPDRADEPLLSAIPQQAALFGV-TGLESVRPDRFV 121

Query: 116 QDGDTLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQL 175
             G+TL    H F+V H PGH+PGHVI+ +  + FA +GDTLFR  +GRTD  +GD+ QL
Sbjct: 122 SHGETLEALGHSFEVRHVPGHTPGHVIFYDPASRFAFVGDTLFRGGVGRTDFPYGDHDQL 181

Query: 176 INSINNKILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           I +I +++LPLGD+++ + GHGP +TIG ER  NPFL
Sbjct: 182 IAAIRDQLLPLGDDVTILPGHGPATTIGAERAGNPFL 218


>gi|71906480|ref|YP_284067.1| Beta-lactamase-like [Dechloromonas aromatica RCB]
 gi|71846101|gb|AAZ45597.1| Beta-lactamase-like protein [Dechloromonas aromatica RCB]
          Length = 213

 Score =  201 bits (510), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 91/213 (42%), Positives = 131/213 (61%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + IV VTPF+QNCT  + E + +A V+DPGGD++ I  +++     + +I +THGH+D
Sbjct: 1   MRYAIVPVTPFEQNCTVFWCENTRQAAVIDPGGDVERILRLLEDEKLTLAKILVTHGHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GG A L E   + I GPH++D   +  + +Q+++     N R+    RWL  GD +  
Sbjct: 61  HAGGVAVLAEQTGVPIEGPHEEDRFWIEGMPQQSKMFGFP-NVRSFEPTRWLNAGDKVTF 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGH+PGHV++ +  +  A +GD LF+ SIGRTD   GDY  LI SI  ++
Sbjct: 120 GEVELDVLHCPGHTPGHVVFFHAPSRLAQVGDVLFQGSIGRTDFPRGDYDTLIRSITEQL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            PLGD++ F+ GHGP ST G ER+ NPFL    
Sbjct: 180 FPLGDDVDFIPGHGPMSTFGEERKYNPFLSGRF 212


>gi|238749751|ref|ZP_04611256.1| hypothetical protein yrohd0001_30710 [Yersinia rohdei ATCC 43380]
 gi|238712406|gb|EEQ04619.1| hypothetical protein yrohd0001_30710 [Yersinia rohdei ATCC 43380]
          Length = 215

 Score =  201 bits (510), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 89/212 (41%), Positives = 136/212 (64%), Gaps = 1/212 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + I+ VT F QNCT ++ E + +A +VDPGGD   I   +  ++  V QI +THGH+D
Sbjct: 1   MKYKIIPVTAFSQNCTLIWCEVTGQAALVDPGGDAAKIIAEVARQDVKVSQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L E   + I GP K+D   +  +  Q+++  +       +  RWL++GD + +
Sbjct: 61  HVGAAAELAEHFQVPIYGPEKEDLFWLEGLPAQSKMFGLS-ECEAFTPTRWLEEGDKITV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGH+PGH+++++ +   A +GD +F   +GR+D   GD+QQLINSI  K+
Sbjct: 120 GATELSVLHCPGHTPGHIVFIDKQGQLALVGDVIFNGGVGRSDFPRGDHQQLINSIRTKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSN 215
           LPLGD+I+F+ GHGP ST+G ER+ NPF++  
Sbjct: 180 LPLGDDITFIPGHGPMSTLGHERQTNPFIREE 211


>gi|330829589|ref|YP_004392541.1| metallo-beta-lactamase family protein [Aeromonas veronii B565]
 gi|328804725|gb|AEB49924.1| Metallo-beta-lactamase family protein [Aeromonas veronii B565]
          Length = 214

 Score =  201 bits (510), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 93/213 (43%), Positives = 134/213 (62%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L F ++ VT F QNC+ ++ +E+ +A ++DPGG+ D +   I  R   +  I +THGH+D
Sbjct: 2   LKFEVIPVTQFAQNCSLIWCDETHQAALIDPGGEADKLLTAIAKRGLTLTHILLTHGHLD 61

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L+E   + I GPHK+D   +  + +Q+++     +    + DRWL+ GD + L
Sbjct: 62  HVGAAAELREKTGVAITGPHKEDTFWLDMLPQQSQMFGF-AHTPAFTPDRWLEQGDKVQL 120

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V+ CPGH+PGH++ +N     A +GD LF  SIGRTD   GD+  LI SIN  +
Sbjct: 121 GQCELDVYFCPGHTPGHIVLLNQAEKLAWVGDVLFAGSIGRTDFPRGDHGTLIKSINETL 180

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           LPLGDEI F+ GHGP+ST GRE+  NP+L   I
Sbjct: 181 LPLGDEIVFIPGHGPSSTFGREKVSNPYLTQPI 213


>gi|328542848|ref|YP_004302957.1| enzyme with metallo-hydrolase/oxidoreductase domain (YcbL-like)
           [polymorphum gilvum SL003B-26A1]
 gi|326412594|gb|ADZ69657.1| Putative enzyme with metallo-hydrolase/oxidoreductase domain
           (YcbL-like) [Polymorphum gilvum SL003B-26A1]
          Length = 224

 Score =  201 bits (510), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 98/213 (46%), Positives = 144/213 (67%), Gaps = 1/213 (0%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           +  +   ++ VT F+QNC+ ++D  +L+  VVDPGGD+  I + ++  +  V++I +THG
Sbjct: 13  LPPIQVAVIPVTAFQQNCSLIWDPRTLKGAVVDPGGDVARILEAVKKYDVTVERIVLTHG 72

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DH+GGAA+L E L++ + GPH+ D  ++ +V+EQAR   +    R+   DRWL++GD+
Sbjct: 73  HIDHIGGAAELAEALAVPVEGPHEADRPLIARVEEQARQFGV-AGVRSVEPDRWLEEGDS 131

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           + +    F V HCPGH+PGHV+  + E  FA  GD LF  SIGRTD+  GD+  LI SI 
Sbjct: 132 VEIAGRSFAVLHCPGHAPGHVVLFDAELRFAISGDVLFAGSIGRTDLPGGDHATLIRSIV 191

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
            K+LPLGD++SF+ GHGP ST G ER  NPFL+
Sbjct: 192 TKLLPLGDDVSFLPGHGPASTFGHERETNPFLR 224


>gi|156934581|ref|YP_001438497.1| hypothetical protein ESA_02415 [Cronobacter sakazakii ATCC BAA-894]
 gi|156532835|gb|ABU77661.1| hypothetical protein ESA_02415 [Cronobacter sakazakii ATCC BAA-894]
          Length = 215

 Score =  201 bits (510), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 89/213 (41%), Positives = 140/213 (65%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++HI+ VT F QNC+ ++ EE+ +A +VDPGGD   IK+ +      ++QI +THGH+D
Sbjct: 1   MNYHIIPVTAFAQNCSLIWCEETRQAALVDPGGDAQRIKEEVARIGVTLQQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L     + IIGP K+D   +  +  Q+R+  +    +  + DRWL +GDT+ +
Sbjct: 61  HVGAAAELAAHYGIPIIGPEKEDEFWLQGLPAQSRMFGLD-ECQPLTPDRWLNEGDTVSV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGH+PGH+++ + ++     GD +F+  +GR+D   GD+ QLI++I  K+
Sbjct: 120 GNITLAVLHCPGHTPGHIVFFDAQSRLLVSGDVIFKGGVGRSDFPRGDHSQLIDAIKRKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           LPLGD+++F+ GHGP ST+G ER  NPFL+  +
Sbjct: 180 LPLGDDVTFIPGHGPMSTLGHERLHNPFLQDEM 212


>gi|56476961|ref|YP_158550.1| putative metallo-beta-lactamase family protein [Aromatoleum
           aromaticum EbN1]
 gi|56313004|emb|CAI07649.1| putative metallo-beta-lactamase family protein [Aromatoleum
           aromaticum EbN1]
          Length = 213

 Score =  201 bits (510), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 96/209 (45%), Positives = 132/209 (63%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +   IV VTPF+QNC+ ++ +++ +A VVDPGGDL+ I    +     +++I ITHGH+D
Sbjct: 2   IDLRIVPVTPFEQNCSIVWCDKTRKAAVVDPGGDLERILAKAKELGVTIEKILITHGHID 61

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GG AQL  +L + + GP K D   +  + +QAR       A +   DRWL DGDT+ +
Sbjct: 62  HAGGTAQLARELGVPVEGPEKADLFWITGIPQQARTFGF-PGAESFEPDRWLHDGDTVTV 120

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V H PGH+PGHV + + +   A +GD LF  SIGRTD   GD+  LI SI  K+
Sbjct: 121 GDETLRVIHVPGHTPGHVAFFHADARLAIVGDVLFAGSIGRTDFPQGDHATLIRSIRQKL 180

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
            PLGD+I+FV GHGP ST G ERR NP++
Sbjct: 181 FPLGDDITFVPGHGPTSTFGEERRSNPYV 209


>gi|238763357|ref|ZP_04624321.1| hypothetical protein ykris0001_3130 [Yersinia kristensenii ATCC
           33638]
 gi|238698456|gb|EEP91209.1| hypothetical protein ykris0001_3130 [Yersinia kristensenii ATCC
           33638]
          Length = 215

 Score =  201 bits (510), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 89/212 (41%), Positives = 138/212 (65%), Gaps = 1/212 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + I+ VT F QNCT ++ EE+ +A +VDPGG+ D I   +  +   V QI +THGH+D
Sbjct: 1   MKYQIIPVTAFSQNCTLIWCEETGQAALVDPGGEADKIIAEVTRQGVKVSQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L     + I GP K+DA  +  +  Q+R+  +          RWL++GD + +
Sbjct: 61  HVGAAAELAAHFQVPIYGPEKEDAFWLEGLPAQSRMFGLS-ECEAFLPTRWLEEGDKITV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGH+PGH+++++ +++ A +GD +F   +GR+D   GD+QQLI+SI  K+
Sbjct: 120 GAIELSVLHCPGHTPGHIVFIDQKDHLALVGDVIFNGGVGRSDFPRGDHQQLIHSIRTKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSN 215
           LPLGD+++F+ GHGP ST+G ER+ NPF++  
Sbjct: 180 LPLGDDMTFIPGHGPMSTLGHERQTNPFIREE 211


>gi|89898986|ref|YP_521457.1| beta-lactamase-like protein [Rhodoferax ferrireducens T118]
 gi|89343723|gb|ABD67926.1| beta-lactamase-like [Rhodoferax ferrireducens T118]
          Length = 212

 Score =  200 bits (509), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 92/210 (43%), Positives = 135/210 (64%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L +  V VTP++QNC+ L+ +++++  V+DPGGDL+ +   +      + QIW+THGH+D
Sbjct: 2   LRYLTVPVTPYQQNCSLLWCDQTMKTAVLDPGGDLERVLAQVARAGLVLDQIWLTHGHID 61

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GGAA+L     L IIGPH+ D  ++  +  Q ++     + +  +  RWL DGDT+ L
Sbjct: 62  HAGGAAELALRFGLPIIGPHQADQFLIDGLALQGKMFGF-AHVQTFTPTRWLNDGDTVKL 120

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGH+PGHV++ + E N A +GD LF  SIGRTD+  GD+  LI SI  ++
Sbjct: 121 GHSTLTVRHCPGHTPGHVVFYSSEANRAFVGDVLFAGSIGRTDLPQGDHDTLIASITQRL 180

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
            P+G++  FV GHGP ST G ERR NP+++
Sbjct: 181 WPMGNDTVFVPGHGPESTFGIERRSNPYVR 210


>gi|167582679|ref|ZP_02375553.1| metallo-beta-lactamase family protein [Burkholderia thailandensis
           TXDOH]
          Length = 214

 Score =  200 bits (509), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 93/209 (44%), Positives = 133/209 (63%), Gaps = 1/209 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           ++ VTPF+QNC+ L  E++  A VVDPGGDL++I+  +  +N  V+++ +THGHVDH  G
Sbjct: 5   LIPVTPFQQNCSLLVCEKTGRAAVVDPGGDLELIEQEVARQNVRVEKVLLTHGHVDHCAG 64

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           A +L     + I GPH+D+   + K+  Q+        A     DRWL DG+T+  G   
Sbjct: 65  AKRLAAHYGVPIEGPHEDERFWIEKLPMQSERFGFPA-AEAFEPDRWLDDGETVTFGEET 123

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
            +V+HCPGH+PGHV++ +  +  A +GD LF  SIGRTD   G++  LI SI  K+ PLG
Sbjct: 124 LEVYHCPGHTPGHVVFFSRAHRLAIVGDVLFAGSIGRTDFPRGNHADLIRSIREKLWPLG 183

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           D+++FV GHGP ST G ERR NPF+   +
Sbjct: 184 DDVTFVPGHGPVSTFGDERRTNPFVADGV 212


>gi|167564472|ref|ZP_02357388.1| metallo-beta-lactamase family protein [Burkholderia oklahomensis
           EO147]
 gi|167571622|ref|ZP_02364496.1| metallo-beta-lactamase family protein [Burkholderia oklahomensis
           C6786]
          Length = 214

 Score =  200 bits (509), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 93/209 (44%), Positives = 133/209 (63%), Gaps = 1/209 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           ++ VTPF+QNC+ L  E++  A +VDPGGDLD+I+  I  +N  V+++ +THGHVDH  G
Sbjct: 5   LIPVTPFQQNCSLLVCEKTGRAAIVDPGGDLDLIEQEIARQNVEVEKVLLTHGHVDHCAG 64

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           A +L     ++I GP +++   + K+  Q+        A     DRWL DGDT+  G   
Sbjct: 65  AKRLAAHYGVSIEGPQEEERFWIEKLPMQSERFGFPA-AETFEPDRWLDDGDTVTFGGET 123

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
            +V+HCPGH+PGHV++ +  +  A +GD LF  SIGRTD   G++  LI SI  K+ PLG
Sbjct: 124 LEVYHCPGHTPGHVVFFSRAHRLAIVGDVLFAGSIGRTDFPRGNHADLIRSIREKLWPLG 183

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           D+++FV GHGP ST G ERR NPF+   +
Sbjct: 184 DDVTFVPGHGPVSTFGDERRTNPFVADGV 212


>gi|77165190|ref|YP_343715.1| metallo-beta-lactamase family protein [Nitrosococcus oceani ATCC
           19707]
 gi|254433141|ref|ZP_05046649.1| metallo-beta-lactamase superfamily, putative [Nitrosococcus oceani
           AFC27]
 gi|76883504|gb|ABA58185.1| metallo-beta-lactamase family protein [Nitrosococcus oceani ATCC
           19707]
 gi|207089474|gb|EDZ66745.1| metallo-beta-lactamase superfamily, putative [Nitrosococcus oceani
           AFC27]
          Length = 212

 Score =  199 bits (507), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 96/213 (45%), Positives = 133/213 (62%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + F I+ VT F QNCT L  EES +A VVDPGGD++ I    ++    +++I +THGH+D
Sbjct: 1   MKFEILPVTRFMQNCTLLGCEESGKAAVVDPGGDVEQILARAEAGCLKIEKILLTHGHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GGA +L   L + I GP  +D   +  +  Q+ +       R    DRWL+ GD +  
Sbjct: 61  HAGGAGELARRLEVPIEGPQIEDEFWIDSLPAQSEMFGFP-PVRAFVPDRWLEQGDRVSF 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G  +  V+HCPGH+PGHVI+ + E++ A +GD LF+ SIGRTD   GDY  LI+SI  ++
Sbjct: 120 GKVVLNVYHCPGHTPGHVIFFHPESHLALVGDVLFKGSIGRTDFPRGDYDALIHSIRKRL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            PLGDE+ F+ GHGP ST G ER+ NPF+   I
Sbjct: 180 FPLGDEVRFIPGHGPMSTFGEERQSNPFVGEKI 212


>gi|312171967|emb|CBX80224.1| Uncharacterized protein M6_Spy0554 [Erwinia amylovora ATCC
           BAA-2158]
          Length = 209

 Score =  199 bits (507), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 93/210 (44%), Positives = 137/210 (65%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++HI+ VT F QNC+ ++  E+ EA +VDPGGD   IK  I +    VKQI +THGH+D
Sbjct: 1   MNYHIIPVTAFAQNCSVIWCPETGEAALVDPGGDAQKIKHEIAALGLTVKQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L E   + I+GPHK D   +  + +Q+++      A   + DRWLQ+G+ + +
Sbjct: 61  HVGAAAELAEHYDVPIVGPHKADKFWLDGLPQQSQMFGFDECA-PLTPDRWLQEGEVVHV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G  + +V  CPGH+PGH+++   +      GD +F   +GR+D   G +Q LI SI NK+
Sbjct: 120 GNTVLEVLLCPGHTPGHIVFFERKARLLVSGDVIFSGGVGRSDFPQGSHQDLIASILNKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           LPLGD+++F+ GHGP ST+GRER  NPFL+
Sbjct: 180 LPLGDDVTFIAGHGPMSTLGRERISNPFLQ 209


>gi|221069500|ref|ZP_03545605.1| beta-lactamase domain protein [Comamonas testosteroni KF-1]
 gi|220714523|gb|EED69891.1| beta-lactamase domain protein [Comamonas testosteroni KF-1]
          Length = 232

 Score =  199 bits (507), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 89/212 (41%), Positives = 138/212 (65%), Gaps = 1/212 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L +H V VT F+QNC+ ++ +++++A V+DPGGD++ I+   +    ++K IWITH H+D
Sbjct: 22  LQYHTVPVTAFQQNCSLVWCDQTMDAAVIDPGGDIEQIEWEAERLGLNLKAIWITHAHID 81

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GG ++L    +L IIGPH+ D   +  + +Q  +     +     + RWL DGDT+ +
Sbjct: 82  HAGGTSELAAKHALPIIGPHEGDQFWIDGLPQQGAMFGFPHSGPFVPT-RWLHDGDTVTI 140

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGH+PGHV++ + + + A +GD LF  SIGRTD   G++QQLI+SI  ++
Sbjct: 141 GQETLNVRHCPGHTPGHVVFHSPQIDRAFVGDVLFAGSIGRTDFPQGNHQQLIDSIVQRL 200

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSN 215
            P+GD+  F+ GHGP S+ GRER+LNP++   
Sbjct: 201 WPMGDQTIFIPGHGPESSFGRERKLNPYVSGT 232


>gi|91781529|ref|YP_556735.1| putative metallo-beta-lactamase family protein [Burkholderia
           xenovorans LB400]
 gi|91685483|gb|ABE28683.1| Putative metallo-beta-lactamase family protein [Burkholderia
           xenovorans LB400]
          Length = 214

 Score =  199 bits (506), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 92/209 (44%), Positives = 133/209 (63%), Gaps = 1/209 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           ++ VTPF+QN + L  E +  A VVDPGGDLD+I+  I  +N  V+++++THGH+DH  G
Sbjct: 5   LIPVTPFQQNSSLLVCEATGRAAVVDPGGDLDVIQGEIARQNVSVEKVFLTHGHIDHCAG 64

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           A  L     + I GPH D+   + K+ +Q+        A     DRWLQ+G+T+  G  I
Sbjct: 65  AKTLASRYDVPIEGPHPDERFWLDKLPDQSTRFGFPA-AEAFEPDRWLQNGETVQFGDEI 123

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
            +V+HCPGH+PGHV++ +  +  A +GD LF  SIGRTD   G++  L+ SI  K+ PLG
Sbjct: 124 LEVYHCPGHTPGHVVFFSRAHRLALVGDVLFAGSIGRTDFPRGNHADLVRSIREKLWPLG 183

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           D+++FV GHGP ST G ERR NP++   +
Sbjct: 184 DDVTFVPGHGPTSTFGAERRTNPYVCDGV 212


>gi|237747191|ref|ZP_04577671.1| beta-lactamase domain-containing protein [Oxalobacter formigenes
           HOxBLS]
 gi|229378542|gb|EEO28633.1| beta-lactamase domain-containing protein [Oxalobacter formigenes
           HOxBLS]
          Length = 213

 Score =  199 bits (506), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 90/211 (42%), Positives = 141/211 (66%), Gaps = 2/211 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + F I+ VTPF+QNCT ++DE + +A VVDPGGD++ I D +  RN  ++++++THGH+D
Sbjct: 1   MKFQIIPVTPFQQNCTLMWDENTNKAAVVDPGGDIEKISDALNQRNLTLEKVFVTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVD-EQARLLSIRMNARNASSDRWLQDGDTLL 122
           H GGA +L +  ++ I GP+++DA ++ +++ +Q R+  +       + DRWL  GD + 
Sbjct: 61  HCGGARKLADLYNVPIEGPNQEDAWLLEQLNSDQTRMWGLPP-GEPFTPDRWLNQGDNVT 119

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
           +G    +VFHCPGHSPGHV++ +     A  GD LF  S+GRTD+  G ++ L  SI   
Sbjct: 120 VGNETLQVFHCPGHSPGHVVFFHAPTKVAISGDVLFAGSVGRTDLPKGSFKALEKSIREN 179

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           +  LGD++ F+ GHGP S+IG+ERR N F++
Sbjct: 180 MYKLGDDVQFIPGHGPVSSIGQERRGNAFVR 210


>gi|51595773|ref|YP_069964.1| metallo-beta-lactamase superfamily protein [Yersinia
           pseudotuberculosis IP 32953]
 gi|153947925|ref|YP_001401526.1| metallo-beta-lactamase family protein [Yersinia pseudotuberculosis
           IP 31758]
 gi|170024877|ref|YP_001721382.1| beta-lactamase domain-containing protein [Yersinia
           pseudotuberculosis YPIII]
 gi|186894852|ref|YP_001871964.1| beta-lactamase domain-containing protein [Yersinia
           pseudotuberculosis PB1/+]
 gi|51589055|emb|CAH20673.1| metallo-beta-lactamase superfamily protein [Yersinia
           pseudotuberculosis IP 32953]
 gi|152959420|gb|ABS46881.1| metallo-beta-lactamase family protein [Yersinia pseudotuberculosis
           IP 31758]
 gi|169751411|gb|ACA68929.1| beta-lactamase domain protein [Yersinia pseudotuberculosis YPIII]
 gi|186697878|gb|ACC88507.1| beta-lactamase domain protein [Yersinia pseudotuberculosis PB1/+]
          Length = 215

 Score =  199 bits (506), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 86/212 (40%), Positives = 136/212 (64%), Gaps = 1/212 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + I+ VT F QNCT ++ E + +A +VDPGG+   I   ++ +   V Q+ +THGH+D
Sbjct: 1   MKYQIIPVTAFSQNCTLIWCEATGQAALVDPGGEATKIIAEVERQGVTVSQVLLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA++     + I GP K+D   +  +  Q+R+  +       +  RWL++GD + +
Sbjct: 61  HVGAAAEVAAHFQVPIYGPEKEDTFWLEGLPAQSRMFGLS-ECEAFTPTRWLEEGDKITV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGH+PGH+++++ +   A +GD +F+  +GR+D   GD+QQLINSI  K+
Sbjct: 120 GEIELSVLHCPGHTPGHIVFIDPQGRLALVGDVIFKGGVGRSDFPRGDHQQLINSIRTKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSN 215
           LPLGD+I+F+ GHGP ST+G ER+ NPF++  
Sbjct: 180 LPLGDDITFIPGHGPMSTLGHERQTNPFIREE 211


>gi|170769250|ref|ZP_02903703.1| metallo-beta-lactamase family protein [Escherichia albertii
           TW07627]
 gi|170121902|gb|EDS90833.1| metallo-beta-lactamase family protein [Escherichia albertii
           TW07627]
          Length = 215

 Score =  199 bits (506), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 88/213 (41%), Positives = 142/213 (66%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++ I+ VT F QNC+ ++ E++  A +VDPGGD + IK  + +    + QI +THGH+D
Sbjct: 1   MNYRIIPVTAFSQNCSLIWCEQTRLAALVDPGGDAEKIKQEVDASGLTLMQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L +   + ++GP K+D   +  +  Q+R+  +    +  + DRWL +GDT+ +
Sbjct: 61  HVGAAAELAQHYGVPVLGPEKEDEFWLQGLPAQSRMFGLD-ECQPLTPDRWLSEGDTISI 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGHV++ + ++     GD LF+  +GR+D   GD++QLI+SI +K+
Sbjct: 120 GNVTLQVLHCPGHTPGHVVFFDNQSKLLISGDVLFKGGVGRSDFPRGDHKQLISSIKDKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           LPLGD+++F+ GHGP ST+G ER  NPFL+  +
Sbjct: 180 LPLGDDVTFIPGHGPLSTLGYERLHNPFLQDEM 212


>gi|326315156|ref|YP_004232828.1| beta-lactamase domain-containing protein [Acidovorax avenae subsp.
           avenae ATCC 19860]
 gi|323371992|gb|ADX44261.1| beta-lactamase domain protein [Acidovorax avenae subsp. avenae ATCC
           19860]
          Length = 212

 Score =  199 bits (506), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 93/209 (44%), Positives = 131/209 (62%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L +H   VT F+QNC+ ++ + +  A V+DPGGDLD +   ++ R   ++QIW+TH H+D
Sbjct: 2   LHYHTHPVTAFQQNCSLVWCDGAQAAAVIDPGGDLDQVLAEVERRGLRLEQIWLTHAHID 61

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GGA +L E LSL I GPH  D   +  + +Q+ +      AR  +   WL DGDT+ +
Sbjct: 62  HAGGAGELSERLSLPITGPHPGDQFWIDGLPQQSAMFGFP-PARPFTPTHWLHDGDTVQI 120

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGH+PGHV++   +     +GD LF  SIGRTD   G++Q LI+SI  ++
Sbjct: 121 GNETLHVRHCPGHTPGHVVFHAPQIQRCFVGDVLFAGSIGRTDFPQGNHQDLIDSIVQRL 180

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
            P+GDE  F+ GHGP ST GRERR NP++
Sbjct: 181 WPMGDETVFIPGHGPESTFGRERRSNPYV 209


>gi|332162188|ref|YP_004298765.1| metallo-beta-lactamase superfamily protein [Yersinia enterocolitica
           subsp. palearctica 105.5R(r)]
 gi|325666418|gb|ADZ43062.1| metallo-beta-lactamase superfamily protein [Yersinia enterocolitica
           subsp. palearctica 105.5R(r)]
 gi|330860170|emb|CBX70491.1| uncharacterized protein ycbL [Yersinia enterocolitica W22703]
          Length = 244

 Score =  199 bits (506), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 88/214 (41%), Positives = 137/214 (64%), Gaps = 1/214 (0%)

Query: 2   SKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGH 61
           S + + I+ VT F QNCT ++ EE+ +A +VDPGG+   I   +   +  + QI +THGH
Sbjct: 28  SFMKYQIIPVTAFSQNCTLIWCEETGQAALVDPGGEAAKIIAEVARHHIQINQILLTHGH 87

Query: 62  VDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
           +DHVG AA+L     + I GP K+D   +  +  Q+R+  +       +  RWL++GD +
Sbjct: 88  LDHVGAAAELAAHFQVPIYGPEKEDTFWLEGLPAQSRMFGLS-ECEAFTPTRWLEEGDKI 146

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
            +G     V HCPGH+PGH+++++ ++  A +GD +F   +GR+D   GD+QQLINSI  
Sbjct: 147 TVGAIELSVLHCPGHTPGHIVFIDQKDRLALVGDVIFNGGVGRSDFPRGDHQQLINSIRT 206

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFLKSN 215
           K+LPLGD+++F+ GHGP ST+G ER+ NPF++  
Sbjct: 207 KLLPLGDDMTFIPGHGPMSTLGHERQTNPFIREE 240


>gi|238795869|ref|ZP_04639382.1| Beta-lactamase domain protein [Yersinia mollaretii ATCC 43969]
 gi|238720332|gb|EEQ12135.1| Beta-lactamase domain protein [Yersinia mollaretii ATCC 43969]
          Length = 215

 Score =  199 bits (506), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 88/212 (41%), Positives = 137/212 (64%), Gaps = 1/212 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + I+ VT F QNCT ++ E + +A +VDPGGD + I   +  +  +V+QI +THGH+D
Sbjct: 1   MKYQIIPVTAFSQNCTLIWCEATGQAALVDPGGDAEKIIAEVARQGVNVRQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L     + I GP K+D   +  +  Q+R+  +       +  RWL++GD + +
Sbjct: 61  HVGAAAELASHFDIPIYGPEKEDTFWLEGLPAQSRMFGLD-ECEAFTPTRWLEEGDKVTV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGH+PGH+++++ +   A +GD +F   +GR+D   GD+QQLINSI  K+
Sbjct: 120 GEIELSVLHCPGHTPGHIVFIDQQGRLALVGDVIFNGGVGRSDFPRGDHQQLINSIRTKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSN 215
           LPLGD+++F+ GHGP ST+G ER+ NPF++  
Sbjct: 180 LPLGDDMTFIPGHGPMSTLGHERQNNPFIREE 211


>gi|318606242|emb|CBY27740.1| hypothetical metal-binding enzyme, YcbL homolog [Yersinia
           enterocolitica subsp. palearctica Y11]
          Length = 244

 Score =  199 bits (505), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 88/214 (41%), Positives = 137/214 (64%), Gaps = 1/214 (0%)

Query: 2   SKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGH 61
           S + + I+ VT F QNCT ++ EE+ +A +VDPGG+   I   +   +  + QI +THGH
Sbjct: 28  SFMKYQIIPVTAFSQNCTLIWCEETGQAALVDPGGEAAKIIAEVARHHIQINQILLTHGH 87

Query: 62  VDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
           +DHVG AA+L     + I GP K+D   +  +  Q+R+  +       +  RWL++GD +
Sbjct: 88  LDHVGAAAELAAHFQVPIYGPEKEDTFWLEGLPAQSRMFGLN-ECEAFTPTRWLEEGDKI 146

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
            +G     V HCPGH+PGH+++++ ++  A +GD +F   +GR+D   GD+QQLINSI  
Sbjct: 147 TVGAIELSVLHCPGHTPGHIVFIDQKDRLALVGDVIFNGGVGRSDFPRGDHQQLINSIRT 206

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFLKSN 215
           K+LPLGD+++F+ GHGP ST+G ER+ NPF++  
Sbjct: 207 KLLPLGDDMTFIPGHGPMSTLGHERQTNPFIREE 240


>gi|330815176|ref|YP_004358881.1| Beta-lactamase-like protein [Burkholderia gladioli BSR3]
 gi|327367569|gb|AEA58925.1| Beta-lactamase-like protein [Burkholderia gladioli BSR3]
          Length = 215

 Score =  199 bits (505), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 89/205 (43%), Positives = 134/205 (65%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           ++ VTPF+QNC+ +  E++  A VVDPGGDL++I+  ++ +   V+++ ITHGH+DH  G
Sbjct: 5   LIPVTPFQQNCSLIVCEQTGRAAVVDPGGDLELIRGEVERQQAKVEKVLITHGHLDHCAG 64

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           A  L E   + I GPH+++   + ++  Q++       A      RWL DGDT+ +G   
Sbjct: 65  AKALAEHYGVPIEGPHEEERFWIDQLPAQSQRFGFGGAAEAFEPARWLGDGDTVTVGAET 124

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
            +V+HCPGH+PGHV++ + E+  A +GD LF  SIGRTD   G+++ L+ SI  K+ PLG
Sbjct: 125 LEVYHCPGHTPGHVVFFSREHRLAIVGDVLFAGSIGRTDFPRGNHEDLLRSIREKLWPLG 184

Query: 188 DEISFVCGHGPNSTIGRERRLNPFL 212
           D+++FV GHGP ST G ER  NPF+
Sbjct: 185 DDVTFVPGHGPVSTFGDERESNPFV 209


>gi|22126639|ref|NP_670062.1| metallo-beta-lactamase superfamily protein [Yersinia pestis KIM 10]
 gi|45441011|ref|NP_992550.1| metallo-beta-lactamase superfamily protein [Yersinia pestis biovar
           Microtus str. 91001]
 gi|108806700|ref|YP_650616.1| metallo-beta-lactamase superfamily protein [Yersinia pestis
           Antiqua]
 gi|108812729|ref|YP_648496.1| metallo-beta-lactamase superfamily protein [Yersinia pestis
           Nepal516]
 gi|145599558|ref|YP_001163634.1| metallo-beta-lactamase superfamily protein [Yersinia pestis
           Pestoides F]
 gi|149366666|ref|ZP_01888700.1| metallo-beta-lactamase superfamily protein [Yersinia pestis
           CA88-4125]
 gi|162420777|ref|YP_001606448.1| metallo-beta-lactamase superfamily protein [Yersinia pestis Angola]
 gi|165924796|ref|ZP_02220628.1| metallo-beta-lactamase family protein [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165938910|ref|ZP_02227463.1| metallo-beta-lactamase family protein [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|166009820|ref|ZP_02230718.1| metallo-beta-lactamase family protein [Yersinia pestis biovar
           Antiqua str. E1979001]
 gi|166211362|ref|ZP_02237397.1| metallo-beta-lactamase family protein [Yersinia pestis biovar
           Antiqua str. B42003004]
 gi|167399873|ref|ZP_02305391.1| metallo-beta-lactamase family protein [Yersinia pestis biovar
           Antiqua str. UG05-0454]
 gi|167419476|ref|ZP_02311229.1| metallo-beta-lactamase family protein [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167424028|ref|ZP_02315781.1| metallo-beta-lactamase family protein [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|167470986|ref|ZP_02335690.1| metallo-beta-lactamase family protein [Yersinia pestis FV-1]
 gi|218928557|ref|YP_002346432.1| metallo-beta-lactamase superfamily protein [Yersinia pestis CO92]
 gi|229841381|ref|ZP_04461540.1| predicted metal-binding enzyme [Yersinia pestis biovar Orientalis
           str. PEXU2]
 gi|229843486|ref|ZP_04463632.1| predicted metal-binding enzyme [Yersinia pestis biovar Orientalis
           str. India 195]
 gi|229895860|ref|ZP_04511030.1| predicted metal-binding enzyme [Yersinia pestis Pestoides A]
 gi|229903134|ref|ZP_04518247.1| predicted metal-binding enzyme [Yersinia pestis Nepal516]
 gi|270486927|ref|ZP_06204001.1| metallo-beta-lactamase domain protein [Yersinia pestis KIM D27]
 gi|294503396|ref|YP_003567458.1| metallo-beta-lactamase superfamily protein [Yersinia pestis
           Z176003]
 gi|21959651|gb|AAM86313.1|AE013879_3 hypothetical protein y2761 [Yersinia pestis KIM 10]
 gi|45435870|gb|AAS61427.1| metallo-beta-lactamase superfamily protein [Yersinia pestis biovar
           Microtus str. 91001]
 gi|108776377|gb|ABG18896.1| metallo-beta-lactamase superfamily protein [Yersinia pestis
           Nepal516]
 gi|108778613|gb|ABG12671.1| metallo-beta-lactamase superfamily protein [Yersinia pestis
           Antiqua]
 gi|115347168|emb|CAL20061.1| metallo-beta-lactamase superfamily protein [Yersinia pestis CO92]
 gi|145211254|gb|ABP40661.1| metallo-beta-lactamase superfamily protein [Yersinia pestis
           Pestoides F]
 gi|149291040|gb|EDM41115.1| metallo-beta-lactamase superfamily protein [Yersinia pestis
           CA88-4125]
 gi|162353592|gb|ABX87540.1| metallo-beta-lactamase family protein [Yersinia pestis Angola]
 gi|165913057|gb|EDR31681.1| metallo-beta-lactamase family protein [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|165923856|gb|EDR40988.1| metallo-beta-lactamase family protein [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165991216|gb|EDR43517.1| metallo-beta-lactamase family protein [Yersinia pestis biovar
           Antiqua str. E1979001]
 gi|166207133|gb|EDR51613.1| metallo-beta-lactamase family protein [Yersinia pestis biovar
           Antiqua str. B42003004]
 gi|166962217|gb|EDR58238.1| metallo-beta-lactamase family protein [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167050581|gb|EDR61989.1| metallo-beta-lactamase family protein [Yersinia pestis biovar
           Antiqua str. UG05-0454]
 gi|167056877|gb|EDR66640.1| metallo-beta-lactamase family protein [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|229678904|gb|EEO75007.1| predicted metal-binding enzyme [Yersinia pestis Nepal516]
 gi|229689833|gb|EEO81894.1| predicted metal-binding enzyme [Yersinia pestis biovar Orientalis
           str. India 195]
 gi|229697747|gb|EEO87794.1| predicted metal-binding enzyme [Yersinia pestis biovar Orientalis
           str. PEXU2]
 gi|229700783|gb|EEO88812.1| predicted metal-binding enzyme [Yersinia pestis Pestoides A]
 gi|262365027|gb|ACY61584.1| metallo-beta-lactamase superfamily protein [Yersinia pestis
           D182038]
 gi|270335431|gb|EFA46208.1| metallo-beta-lactamase domain protein [Yersinia pestis KIM D27]
 gi|294353855|gb|ADE64196.1| metallo-beta-lactamase superfamily protein [Yersinia pestis
           Z176003]
 gi|320015729|gb|ADV99300.1| putative metal-binding enzyme [Yersinia pestis biovar Medievalis
           str. Harbin 35]
          Length = 215

 Score =  198 bits (504), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 85/212 (40%), Positives = 136/212 (64%), Gaps = 1/212 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + I+ VT F QNCT ++ E + +A +VDPGG+   I   ++ +   + Q+ +THGH+D
Sbjct: 1   MKYQIIPVTAFSQNCTLIWCEATGQAALVDPGGEATKIIAEVERQGVTISQVLLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA++     + I GP K+D   +  +  Q+R+  +       +  RWL++GD + +
Sbjct: 61  HVGAAAEVAAHFQVPIYGPEKEDTFWLEGLPAQSRMFGLS-ECEAFTPTRWLEEGDKITV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGH+PGH+++++ +   A +GD +F+  +GR+D   GD+QQLINSI  K+
Sbjct: 120 GEIELSVLHCPGHTPGHIVFIDPQGRLALVGDVIFKGGVGRSDFPRGDHQQLINSIRTKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSN 215
           LPLGD+I+F+ GHGP ST+G ER+ NPF++  
Sbjct: 180 LPLGDDITFIPGHGPMSTLGHERQTNPFIREE 211


>gi|290473858|ref|YP_003466732.1| metallo-hydrolase/oxidoreductase domain-containing protein
           [Xenorhabdus bovienii SS-2004]
 gi|289173165|emb|CBJ79938.1| putative enzyme with metallo-hydrolase/oxidoreductase domain
           [Xenorhabdus bovienii SS-2004]
          Length = 210

 Score =  198 bits (504), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 90/210 (42%), Positives = 135/210 (64%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++HI+ VT   QNCT ++ EE+LEA +VDPGG+ + +   I+ R   + QI +THGH D
Sbjct: 1   MNYHIIPVTTVMQNCTLIWCEETLEAAIVDPGGEAEKLISEIEQRGLKLTQILLTHGHYD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG    +    ++ + GPHK DA  +  ++ Q ++  +     + + +RWL +GDTL +
Sbjct: 61  HVGATVDVATHFNVPVHGPHKADAFWIEALEVQCQMFGVEA-CPSFTPERWLDEGDTLQI 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   F V HCPGH+PGH+I+V+  +    +GD LF+ SIGRTD   G+Y  LI SI  K+
Sbjct: 120 GNIEFSVLHCPGHTPGHIIFVSHTDKLISMGDVLFKGSIGRTDFPGGNYDDLIQSIKEKV 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           +P+GD+  F+ GHG  ST+G ER+ NPFL+
Sbjct: 180 IPIGDDFHFIPGHGSMSTLGHERKTNPFLQ 209


>gi|238789298|ref|ZP_04633085.1| hypothetical protein yfred0001_41070 [Yersinia frederiksenii ATCC
           33641]
 gi|238722630|gb|EEQ14283.1| hypothetical protein yfred0001_41070 [Yersinia frederiksenii ATCC
           33641]
          Length = 229

 Score =  198 bits (504), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 88/214 (41%), Positives = 138/214 (64%), Gaps = 1/214 (0%)

Query: 2   SKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGH 61
           S + + I+ VT F QNCT ++ E + +A +VDPGG+   I   +  +   V QI +THGH
Sbjct: 13  SFMKYQIIPVTAFSQNCTLIWCEATGQAALVDPGGEAAKIIAEVARQGVKVSQILLTHGH 72

Query: 62  VDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
           +DHVG AA+L     + I GP K+DA  +  +  Q+++  +       +  RWL++GD +
Sbjct: 73  LDHVGAAAELAAHFQVPIYGPEKEDAFWLEGLPAQSKMFGLS-ECEAFTPTRWLEEGDKV 131

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
            +G     V HCPGH+PGH+++++ +++ A +GD +F   +GR+D   GD+QQLINSI  
Sbjct: 132 TVGEVELAVLHCPGHTPGHIVFIDQQDHLALVGDVIFNGGVGRSDFPRGDHQQLINSIRT 191

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFLKSN 215
           K+LPLGD+++F+ GHGP ST+G ER+ NPF++  
Sbjct: 192 KLLPLGDDMTFIPGHGPMSTLGHERQTNPFIREE 225


>gi|323524502|ref|YP_004226655.1| beta-lactamase domain-containing protein [Burkholderia sp.
           CCGE1001]
 gi|323381504|gb|ADX53595.1| beta-lactamase domain protein [Burkholderia sp. CCGE1001]
          Length = 214

 Score =  198 bits (504), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 93/205 (45%), Positives = 129/205 (62%), Gaps = 1/205 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           ++ VTPF+QNC+ L  E +  A VVDPGGDLDII+  I  +   V+++++THGH+DH  G
Sbjct: 5   LIPVTPFQQNCSLLVCEATGRAAVVDPGGDLDIIQGEIARQKVSVEKVFLTHGHIDHCAG 64

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           A  L     + I GPH D+   + K+ +Q+        A     DRWL DGDT+  G   
Sbjct: 65  AKTLAAHYGVPIEGPHPDERFWLDKLADQSTRFGFPA-AEAFEPDRWLHDGDTVQFGDET 123

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
            +V+HCPGH+PGHV++ +  +  A +GD LF  SIGRTD   G++  LI SI   + PLG
Sbjct: 124 LEVYHCPGHTPGHVVFFSRAHRLALVGDVLFAGSIGRTDFPRGNHADLIRSIRENLWPLG 183

Query: 188 DEISFVCGHGPNSTIGRERRLNPFL 212
           D+++FV GHGP ST G ERR NP++
Sbjct: 184 DDVTFVPGHGPTSTFGAERRSNPYV 208


>gi|331646192|ref|ZP_08347295.1| putative Metallo-beta-lactamase [Escherichia coli M605]
 gi|281178058|dbj|BAI54388.1| conserved hypothetical protein [Escherichia coli SE15]
 gi|330910707|gb|EGH39217.1| hypothetical metal-binding enzyme [Escherichia coli AA86]
 gi|331044944|gb|EGI17071.1| putative Metallo-beta-lactamase [Escherichia coli M605]
          Length = 215

 Score =  198 bits (503), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 88/213 (41%), Positives = 139/213 (65%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++ I+ VT F QNC+ ++ E++  A +VDPGGD + IK  + +    + QI +THGH+D
Sbjct: 1   MNYRIIPVTAFSQNCSLIWCEQTRLAALVDPGGDAEKIKQEVDASGLTLMQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L +   + + GP K+D   +  +  Q+R+  +    +  + DRWL +GDT+ +
Sbjct: 61  HVGAAAELAQHYGVPVFGPEKEDEFWLQGLPAQSRMFGLE-ECQPLTPDRWLNEGDTISI 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGHV++ N +      GD +F+  +GR+D   GD+ QLI+SI +K+
Sbjct: 120 GNVTLQVLHCPGHTPGHVVFFNEQARLLISGDVIFKGGVGRSDFPRGDHNQLISSIKDKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           LPLGD+++F+ GHGP ST+G ER  NPFL+  +
Sbjct: 180 LPLGDDVTFIPGHGPLSTLGYERLHNPFLQDEM 212


>gi|308186273|ref|YP_003930404.1| Zn-dependent hydrolase [Pantoea vagans C9-1]
 gi|308056783|gb|ADO08955.1| Putative Zn-dependent hydrolase [Pantoea vagans C9-1]
          Length = 209

 Score =  198 bits (503), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 90/210 (42%), Positives = 136/210 (64%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++HI+ VT F QNC+ ++ + + EA +VDPGGD ++IK  ++       QI +THGH+D
Sbjct: 1   MNYHIIPVTAFAQNCSVIWCDTTREAALVDPGGDAELIKQTLEQLKLKPAQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG A +L     + I+GP K DA  +  +  Q+R+  +   A   + DRWL++G+++ +
Sbjct: 61  HVGAAVELAAFYQIPIVGPQKRDAFWLEALPTQSRMFGLDECA-PFTPDRWLEEGESVQV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGHSPGHV++ +        GD +F   +GRTD   GD+QQLI++I  K+
Sbjct: 120 GLTTLDVLHCPGHSPGHVVFFDRPGRLLISGDVIFNGGVGRTDFPQGDHQQLIDAIRTKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           LPLGD+++F+ GHGP ST+G ER  NPFL+
Sbjct: 180 LPLGDDVTFLPGHGPISTLGHERISNPFLQ 209


>gi|158422364|ref|YP_001523656.1| putative Zn-dependent hydrolase [Azorhizobium caulinodans ORS 571]
 gi|158329253|dbj|BAF86738.1| putative Zn-dependent hydrolase [Azorhizobium caulinodans ORS 571]
          Length = 215

 Score =  197 bits (502), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 98/213 (46%), Positives = 138/213 (64%), Gaps = 3/213 (1%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M  +   +V VTPF QNC+ L+   + +  V+DPGGDL  I+  ++     V++I +THG
Sbjct: 1   MQPIQIAVVPVTPFDQNCSILWCTATKKGAVIDPGGDLPRIEAALKETGITVEKILLTHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMM-GKVDEQARLLSIRMNARNASSDRWLQDGD 119
           HVDH  GAA+L E L + I GP++ D  +M G VD  AR       ARN +  R+L++GD
Sbjct: 61  HVDHAAGAAELSETLGVPIEGPNEKDQFLMDGLVDSAARFG--MEGARNVTPTRYLKEGD 118

Query: 120 TLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSI 179
           T+ +G    +V   PGH+PGHV++V+   N A +GDTLFR S+GRTD  +GD + LI+ I
Sbjct: 119 TVTIGEVTLEVLDVPGHTPGHVVFVHKGTNVAIVGDTLFRGSVGRTDFPYGDPELLISGI 178

Query: 180 NNKILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
            +K+LPLGD +  + GHGP ++IG ERR NPFL
Sbjct: 179 VSKLLPLGDAVVCLPGHGPVTSIGDERRSNPFL 211


>gi|83720137|ref|YP_443645.1| metallo-beta-lactamase family protein [Burkholderia thailandensis
           E264]
 gi|167620794|ref|ZP_02389425.1| metallo-beta-lactamase family protein [Burkholderia thailandensis
           Bt4]
 gi|83653962|gb|ABC38025.1| metallo-beta-lactamase family protein [Burkholderia thailandensis
           E264]
          Length = 214

 Score =  197 bits (502), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 91/209 (43%), Positives = 132/209 (63%), Gaps = 1/209 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           ++ VTPF+QNC+ L  E++  A VVDPGGD ++I+  +  +N  V+++ +THGHVDH  G
Sbjct: 5   LIPVTPFQQNCSLLVCEKTGRAAVVDPGGDFELIEQEVARQNVRVEKVLLTHGHVDHCAG 64

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           A +L     + I GPH+D+   + K+  Q+        A     DRWL DG+++  G   
Sbjct: 65  AKRLAAHYGVPIEGPHEDERFWIEKLPMQSERFGFPA-AEAFEPDRWLDDGESVTFGEET 123

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
            +V+HCPGH+PGHV++ +  +  A +GD LF  SIGRTD   G++  LI SI  K+ PLG
Sbjct: 124 LEVYHCPGHTPGHVVFFSRAHRLAIVGDVLFAGSIGRTDFPRGNHADLIRSIREKLWPLG 183

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           D+++FV GHGP ST G ERR NPF+   +
Sbjct: 184 DDVTFVPGHGPVSTFGDERRTNPFVADGV 212


>gi|310767194|gb|ADP12144.1| Putative metallo-beta-lactamase [Erwinia sp. Ejp617]
          Length = 209

 Score =  197 bits (502), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 92/210 (43%), Positives = 138/210 (65%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++HI+ VT F QNC+ ++  E+ EA +VDPGGD   I+  I      VKQI +THGH+D
Sbjct: 1   MNYHIIPVTAFAQNCSVIWCPETGEAALVDPGGDAHKIRHEIAGLGITVKQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L E   + ++GPHK D   +  + +Q+++      A  A  DRWL++G+ + +
Sbjct: 61  HVGAAAELAEHYGVPVVGPHKADKFWLDGLPQQSQMFGFDECAPLAP-DRWLREGEVVHV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G  + +V  CPGH+PGH+++ + E+     GD +F   +GR+D     +QQLI SI NK+
Sbjct: 120 GNTVLEVLWCPGHTPGHIVFFDRESRLLVSGDVIFSGGVGRSDFPQCSHQQLIASILNKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           LPLGD+++F+ GHGP ST+GRER  NPFL+
Sbjct: 180 LPLGDDVTFIAGHGPMSTLGRERISNPFLQ 209


>gi|332527474|ref|ZP_08403528.1| beta-lactamase domain-containing protein [Rubrivivax
           benzoatilyticus JA2]
 gi|332111883|gb|EGJ11861.1| beta-lactamase domain-containing protein [Rubrivivax
           benzoatilyticus JA2]
          Length = 212

 Score =  197 bits (502), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 95/212 (44%), Positives = 133/212 (62%), Gaps = 1/212 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L +  V VTPF+QNC+ L+ +E+ EA V+DPGGD+  I   +Q  +   + I +TH H+D
Sbjct: 2   LQYRTVPVTPFQQNCSILWCDETREAAVLDPGGDVPAILAALQRLDVVPRLILLTHAHID 61

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GGA +L  +LSL I+GPH+ D   +  + +QA +      A      RWL+DGDT+ +
Sbjct: 62  HAGGAGRLARELSLPIVGPHEGDRFWIDGLAQQAAMFGFPA-AEPFVPARWLKDGDTVAV 120

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGH+PGHV++ + E   A +GD LF  SIGRTD   GD+  LI+SI  ++
Sbjct: 121 GRSALAVRHCPGHTPGHVVFHSAEAKRAFVGDVLFAGSIGRTDFPGGDHATLIDSIVQRL 180

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSN 215
            P+GD+  FV GHGP ST G ERR NP+++  
Sbjct: 181 WPMGDDTVFVPGHGPESTFGDERRHNPYVRGT 212


>gi|260776043|ref|ZP_05884938.1| hydroxyacylglutathione hydrolase [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260607266|gb|EEX33531.1| hydroxyacylglutathione hydrolase [Vibrio coralliilyticus ATCC
           BAA-450]
          Length = 218

 Score =  197 bits (501), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 93/215 (43%), Positives = 132/215 (61%), Gaps = 2/215 (0%)

Query: 3   KLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHV 62
            L + +V VT F QNC+ ++ +E++E VVVDPGGD+  +  +I+     V  + +THGH+
Sbjct: 2   SLKYQVVPVTSFSQNCSIVWCDETMEGVVVDPGGDVKQLAALIKELGVKVVNLVLTHGHL 61

Query: 63  DHVGGAAQLKEDLS-LTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
           DHVGG   L  +L  + I+GPHKDD   +  +  Q+++    +        +WL DGDT+
Sbjct: 62  DHVGGTESLSAELGGIEIVGPHKDDNFWLQGLAGQSQMFGFPL-TEAFEPQKWLNDGDTV 120

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
             G  I  V+H PGH+PGHV+  + E   A +GD LF  S+GRTD   GD+  LINSI  
Sbjct: 121 AFGNQILNVYHTPGHTPGHVVLFSEEAKLAFVGDVLFNGSVGRTDFPKGDFDTLINSIKT 180

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           K+ PLG+++ FV GHGP ST GRER  NPF+   +
Sbjct: 181 KLWPLGNDVRFVPGHGPESTFGRERASNPFVADEM 215


>gi|296134547|ref|YP_003641789.1| beta-lactamase domain-containing protein [Thiomonas intermedia K12]
 gi|295794669|gb|ADG29459.1| beta-lactamase domain-containing protein [Thiomonas intermedia K12]
          Length = 212

 Score =  197 bits (501), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 90/212 (42%), Positives = 131/212 (61%), Gaps = 1/212 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L + I+ VT F QN   ++D+ + EAV  DPGG++D +   +      ++ +W+TH H+D
Sbjct: 2   LRYRILPVTAFAQNTCLVWDDAAQEAVFTDPGGEVDRLLQAVVEAGVTLRAVWLTHAHID 61

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H G AA++ +   + IIGPH  D   +  + +QA+       A+  + DRWL DGDTL L
Sbjct: 62  HAGAAAEVAQRAGVPIIGPHPGDQFWIDALPQQAQRFGF-PPAKTFTPDRWLADGDTLQL 120

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G+  F V HCPGH+PGHV++   E     +GD LF  SIGRTD   G++QQL++SI  K+
Sbjct: 121 GSLPFTVRHCPGHTPGHVVFHQPEARRCWVGDVLFAGSIGRTDFPGGNHQQLLDSITGKL 180

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSN 215
            P+GD+  F+ GHGP ST G ERR NP+++  
Sbjct: 181 WPMGDDTVFIPGHGPESTFGEERRSNPYVRGT 212


>gi|167587814|ref|ZP_02380202.1| beta-lactamase domain protein [Burkholderia ubonensis Bu]
          Length = 214

 Score =  197 bits (501), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 92/209 (44%), Positives = 130/209 (62%), Gaps = 1/209 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           ++ VTPF+QNC+ L  E +  A VVDPGGDL+ I+  +  +N  V+++ +THGH+DH  G
Sbjct: 5   LIPVTPFQQNCSLLVCEATGRAAVVDPGGDLERIEQEVARQNAQVEKVLLTHGHIDHCAG 64

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           A  L     + I GPH+D+   + K+  Q+        A     DRWL DGDT+  G   
Sbjct: 65  AKALATRYGVPIEGPHEDERFWIDKLPTQSERFGFPA-ADAFEPDRWLNDGDTVQFGDET 123

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
            +V+HCPGH+PGHV++ +  +  A +GD LF  SIGRTD   G++  L+ SI  K+ PLG
Sbjct: 124 LEVYHCPGHTPGHVVFFSRPHRLAIVGDVLFAGSIGRTDFPRGNHADLVRSIKEKLWPLG 183

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           D+++FV GHGP ST G ERR NPF+   +
Sbjct: 184 DDVTFVPGHGPVSTFGDERRTNPFVSDKV 212


>gi|71892197|ref|YP_277930.1| metallo-hydrolase/oxidoreductase domain-containing protein
           [Candidatus Blochmannia pennsylvanicus str. BPEN]
 gi|71796303|gb|AAZ41054.1| putative enzyme with metallo-hydrolase/oxidoreductase domain
           [Candidatus Blochmannia pennsylvanicus str. BPEN]
          Length = 217

 Score =  197 bits (500), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 95/216 (43%), Positives = 141/216 (65%), Gaps = 3/216 (1%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + ++I+ VTPF QNC+ ++ E + EAV+VDPGG+ D ++  I      V +I +THGH D
Sbjct: 1   MQYNIIPVTPFHQNCSIIWCEVTHEAVLVDPGGESDKLRSEIDKLGVKVNKILLTHGHFD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASS---DRWLQDGDT 120
           HVG A +L+E   + IIGP+K D +++  +  Q R+L I +   + ++   D WL+DGDT
Sbjct: 61  HVGSAMELREYYKIPIIGPNKADQSLLDNLSVQCRILDIDLPNNSTTAVIPDVWLEDGDT 120

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           + +G  +F + HCPGHSPGH+++ N    F  +GD LF+ SIGRTD+  G+   LINSI 
Sbjct: 121 VQVGREVFDILHCPGHSPGHIVFWNKIRKFMVMGDVLFKRSIGRTDLPGGNIAVLINSIK 180

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            K+ PLGD+I F+ GHG +ST+G ER  N ++   I
Sbjct: 181 TKLFPLGDDILFLPGHGSSSTLGYERLNNIYITHAI 216


>gi|226939805|ref|YP_002794878.1| metallo-beta-lactamase family protein [Laribacter hongkongensis
           HLHK9]
 gi|226714731|gb|ACO73869.1| putative metallo-beta-lactamase family protein [Laribacter
           hongkongensis HLHK9]
          Length = 246

 Score =  197 bits (500), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 91/209 (43%), Positives = 133/209 (63%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + +V VT F QNC+ ++ + + EA V+DPGGD+D I  +I      V+Q+ +THGH+D
Sbjct: 33  MGYRVVPVTAFAQNCSIVWCDATREAAVIDPGGDVDHILSIIDELGVSVRQVLLTHGHLD 92

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVGGAA L   L + + GPH+ D   +  + +Q+++      A     DRWL+ GD L +
Sbjct: 93  HVGGAASLAARLGVPVAGPHQADDYWLKGLPQQSQMFGF-PPAEVLVPDRWLKAGDCLSV 151

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGHV++V+ +   A +GD LF  SIGRTD   G++ +LI SI   +
Sbjct: 152 GECELEVLHCPGHTPGHVVFVDRQAGLAWVGDVLFAGSIGRTDFPGGNHAELIRSIRETL 211

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
             LGD++ F+ GHGP ST+G ERR NPF+
Sbjct: 212 FALGDDVRFIPGHGPESTLGEERRYNPFV 240


>gi|170693936|ref|ZP_02885092.1| beta-lactamase domain protein [Burkholderia graminis C4D1M]
 gi|170141008|gb|EDT09180.1| beta-lactamase domain protein [Burkholderia graminis C4D1M]
          Length = 214

 Score =  197 bits (500), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 93/209 (44%), Positives = 130/209 (62%), Gaps = 1/209 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           ++ VTPF+QN + L  E +  A VVDPGGDLDII+  I  +   V+++ +THGH+DH  G
Sbjct: 5   LIPVTPFQQNSSLLVCEATGRAAVVDPGGDLDIIQGEIARQKVSVEKVLLTHGHIDHCAG 64

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           A  L     + I GPH D+   + K+ +Q+        A+    DRWL DGDT+  G   
Sbjct: 65  AKTLATHYGVPIEGPHPDERFWLDKLPDQSTRFGFPA-AQAFEPDRWLDDGDTVQFGDET 123

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
            +V+HCPGH+PGHV++ +  +  A +GD LF  SIGRTD   G++  LI SI  K+ PLG
Sbjct: 124 LEVYHCPGHTPGHVVFFSRAHRLALVGDVLFAGSIGRTDFPRGNHADLIRSIREKLWPLG 183

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           D+++FV GHGP ST G ERR NP++   +
Sbjct: 184 DDVTFVPGHGPTSTFGAERRSNPYVADGV 212


>gi|149186067|ref|ZP_01864381.1| glyoxalase II family protein [Erythrobacter sp. SD-21]
 gi|148830098|gb|EDL48535.1| glyoxalase II family protein [Erythrobacter sp. SD-21]
          Length = 213

 Score =  197 bits (500), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 90/205 (43%), Positives = 135/205 (65%), Gaps = 2/205 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           IV VTP +QNC+ ++   + +  ++DPGGDLD +K  +      +++I ITHGH+DH G 
Sbjct: 5   IVPVTPLQQNCSLVWCTATNKGALIDPGGDLDKLKAAVAQTGVELEKILITHGHIDHCGE 64

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           A  L ++L L I GPH+ D   + ++DE      +  N +    DRWL+DGDT+ +G   
Sbjct: 65  AGILAKELGLKIEGPHEADRFWISRLDEDGARYGV--NGQVFEPDRWLEDGDTVTVGELT 122

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
            +V HCPGH+PGHV++ +  + FA +GD LF+ SIGRTD   G++Q LI++I  K+ PLG
Sbjct: 123 LEVIHCPGHTPGHVVFFHRPSKFAVVGDVLFQGSIGRTDFPMGNHQDLIDAITQKLWPLG 182

Query: 188 DEISFVCGHGPNSTIGRERRLNPFL 212
           D+++F+ GHGP ST G+ER+ N F+
Sbjct: 183 DDVTFIPGHGPTSTFGQERKTNAFV 207


>gi|212635874|ref|YP_002312399.1| beta-lactamase-like protein [Shewanella piezotolerans WP3]
 gi|212557358|gb|ACJ29812.1| Beta-lactamase-like protein [Shewanella piezotolerans WP3]
          Length = 214

 Score =  197 bits (500), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 89/213 (41%), Positives = 137/213 (64%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + ++ VTPF+QNC+ ++ E+SL+  VVDPGG+L+ I +     +  ++Q+ +THGH+D
Sbjct: 1   MKYQLIPVTPFQQNCSLIWCEQSLKGAVVDPGGNLERILEEAAKNHVQIEQVLLTHGHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG A  L E L++ I+GPH  D+  +  + +Q++     ++    +  R+LQ+GD + +
Sbjct: 61  HVGAAQTLAEQLNVPIVGPHLADSFWLESLPKQSQHFGF-VHCDPFTPSRFLQEGDEVTV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G  +  V HCPGH+PGHV++   E   A +GD LFR SIGRTD    ++Q LI+SI  K+
Sbjct: 120 GEQVLSVLHCPGHTPGHVVFFAKEAAIAWVGDVLFRGSIGRTDFPQSNHQDLIDSITKKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            PLG E+ F+ GHGP ST G ER  NPF+   +
Sbjct: 180 WPLGKEVQFIPGHGPLSTFGEERAQNPFVADQL 212


>gi|160895783|ref|YP_001561365.1| beta-lactamase domain-containing protein [Delftia acidovorans
           SPH-1]
 gi|160361367|gb|ABX32980.1| beta-lactamase domain protein [Delftia acidovorans SPH-1]
          Length = 212

 Score =  197 bits (500), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 89/209 (42%), Positives = 135/209 (64%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L +H + VT F+QNC+ ++ ++++EA V+DPGGDL+ I   I+     +K IW+TH H+D
Sbjct: 2   LQYHTIPVTAFQQNCSLVWCDQTMEAAVIDPGGDLEQIGWEIERLGLALKAIWLTHAHID 61

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GG  +L +   L IIGPH  D   +  + +Q  +     ++   +  RWL DGDT+ +
Sbjct: 62  HAGGTRELADAQQLPIIGPHPGDQFWIDALPQQGAMFGFP-HSDPFTPTRWLHDGDTVSI 120

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGHV++   + + A +GD LF  SIGRTD   G++QQLI+SI  ++
Sbjct: 121 GQETLQVRHCPGHTPGHVVFHAPQIDRAFVGDVLFAGSIGRTDFPQGNHQQLIDSIVQRL 180

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
            P+GD+  F+ GHGP S+ GRER+ NP++
Sbjct: 181 WPMGDQTVFIPGHGPESSFGRERKSNPYV 209


>gi|257093969|ref|YP_003167610.1| beta-lactamase domain-containing protein [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
 gi|257046493|gb|ACV35681.1| beta-lactamase domain protein [Candidatus Accumulibacter phosphatis
           clade IIA str. UW-1]
          Length = 210

 Score =  197 bits (500), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 89/208 (42%), Positives = 133/208 (63%), Gaps = 1/208 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + I+ VTPF+QNC+ L+ E++    VVDPGGD+  I   +++    +++I +THGH+D
Sbjct: 1   MKYQIIPVTPFEQNCSLLWCEQTKRGAVVDPGGDVSRILRAVEANGVQLEKILVTHGHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H G  A+L   LSL I GP  +D   +  +  Q+++     N R  + DRWL+ GD++  
Sbjct: 61  HAGAVAELAARLSLPIEGPQCEDKFWIDGMPAQSKMFGFP-NVRAFTPDRWLEQGDSVSF 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGH+PGHV++ +     A +GD LF+ SIGRTD   GD+  LI+SI +++
Sbjct: 120 GNVEMDVLHCPGHTPGHVVFFDKRGRLAVVGDVLFQGSIGRTDFPKGDFDTLISSIRHRL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPF 211
            PLG++++F+ GHGP ST G ERR NPF
Sbjct: 180 WPLGNDVAFIPGHGPMSTFGAERRSNPF 207


>gi|74316086|ref|YP_313826.1| metallo-beta-lactamase superfamily protein [Thiobacillus
           denitrificans ATCC 25259]
 gi|74055581|gb|AAZ96021.1| metallo-beta-lactamase superfamily protein [Thiobacillus
           denitrificans ATCC 25259]
          Length = 212

 Score =  197 bits (500), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 89/209 (42%), Positives = 138/209 (66%), Gaps = 2/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + F I+ VTP++QNC+ ++D + + A ++DPGG+ + + D +  R   +  + +THGH+D
Sbjct: 1   MEFTILPVTPYQQNCSLVWDADGV-AALIDPGGETERLLDEVSRRKLVLASVLLTHGHLD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG A +L+E L + IIGP +D+A  +  + +QA L      A+  + DRWL+DGDT+ +
Sbjct: 60  HVGAALELRERLGIPIIGPQRDEAFWLDSLPQQAELFGF-PPAKAFTPDRWLEDGDTVDV 118

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   F V HCPGH+PGHV++ +     A +GD LF+ SIGR+D   G+++ L+ +I  K+
Sbjct: 119 GAIRFDVLHCPGHTPGHVVFYDASARLAFVGDVLFKGSIGRSDFPRGNHRALVAAIREKL 178

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
            PLGD++ FV GHG  S+ G ERR NPF+
Sbjct: 179 FPLGDDVRFVPGHGAMSSFGHERRDNPFV 207


>gi|88704531|ref|ZP_01102245.1| metallo-beta-lactamase superfamily protein [Congregibacter
           litoralis KT71]
 gi|88701582|gb|EAQ98687.1| metallo-beta-lactamase superfamily protein [Congregibacter
           litoralis KT71]
          Length = 216

 Score =  197 bits (500), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 92/205 (44%), Positives = 136/205 (66%), Gaps = 1/205 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           IV VTP++QNC+ L  E S +A +VDPGGD D I   ++     V++I +THGH+DH   
Sbjct: 7   IVPVTPYQQNCSILKCESSGKAAIVDPGGDTDRILAAVEQLGASVEKIILTHGHMDHCAA 66

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           +  L++ LS+ I GPH+DD   + K+ E  ++ +  + A     DRWL  GDT+ +G   
Sbjct: 67  SDLLRQQLSVPIEGPHEDDRFWIDKLPEWCKMANFPV-AEAFEPDRWLAAGDTVTVGEQT 125

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
            +VFHCPGH+PGHV++++     A +GD +F+ SIGRTD   G++ +LI SI + + PLG
Sbjct: 126 LRVFHCPGHTPGHVVFLHDGQRLAWVGDVIFQGSIGRTDFPRGNHDELIASIRSTLFPLG 185

Query: 188 DEISFVCGHGPNSTIGRERRLNPFL 212
           D+I+F+ GHGP ST G+ER+ NPF+
Sbjct: 186 DDITFIPGHGPTSTFGQERQSNPFV 210


>gi|187922409|ref|YP_001894051.1| beta-lactamase [Burkholderia phytofirmans PsJN]
 gi|187713603|gb|ACD14827.1| beta-lactamase domain protein [Burkholderia phytofirmans PsJN]
          Length = 214

 Score =  196 bits (499), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 92/209 (44%), Positives = 132/209 (63%), Gaps = 1/209 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           ++ VTPF+QN + L  E +  A VV PGGDLDII+  I  +N  V+++++THGH+DH  G
Sbjct: 5   LIPVTPFQQNSSLLVCEATGRAAVVHPGGDLDIIQGEIARQNVTVEKVFLTHGHIDHCAG 64

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           A  L     + I GPH D+   + K+ +Q+        A     DRWLQ+G+++  G   
Sbjct: 65  AKTLATHYGVPIEGPHSDERFWLDKLPDQSTRFGFPA-AEAFEPDRWLQNGESVRFGDET 123

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
            +V+HCPGH+PGHV++ +  +  A +GDTLF  SIGRTD   G++  L+ SI  K+ PLG
Sbjct: 124 LEVYHCPGHTPGHVVFFSRAHRLALVGDTLFAGSIGRTDFPRGNHADLVRSIREKLWPLG 183

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           D+I+FV GHGP ST G ERR NP++   +
Sbjct: 184 DDITFVPGHGPTSTFGAERRTNPYVADGV 212


>gi|56551673|ref|YP_162512.1| beta-lactamase domain-containing protein [Zymomonas mobilis subsp.
           mobilis ZM4]
 gi|241761206|ref|ZP_04759294.1| beta-lactamase domain protein [Zymomonas mobilis subsp. mobilis
           ATCC 10988]
 gi|56543247|gb|AAV89401.1| beta-lactamase domain protein [Zymomonas mobilis subsp. mobilis
           ZM4]
 gi|241374113|gb|EER63610.1| beta-lactamase domain protein [Zymomonas mobilis subsp. mobilis
           ATCC 10988]
          Length = 227

 Score =  196 bits (499), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 94/213 (44%), Positives = 133/213 (62%), Gaps = 2/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L   ++ VTP +QNC+ L+  E+++  +VDPGGD+ +I D I  +   V++I ITHGH D
Sbjct: 12  LEATVIPVTPLRQNCSLLYCVETMKGAIVDPGGDIPLILDSITKKQVTVEKILITHGHFD 71

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GGAA L + L   IIGPH DD   + ++ E A+         + + D+WL+D D + L
Sbjct: 72  HCGGAAALSQILGCPIIGPHPDDQFWIDQIPENAQQYG--FEGESFTPDQWLKDKDEITL 129

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGH+PGHV++ N  ++ A +GD LFR+SIGR+D   GD+Q LI SI  K+
Sbjct: 130 GEERLLVRHCPGHTPGHVVFYNAASHLAIVGDVLFRNSIGRSDFAGGDHQALIQSITEKL 189

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            P+G E  F+ GHG  ST G ER  NPF+  ++
Sbjct: 190 WPMGRETVFIPGHGRPSTFGAERDHNPFVADSV 222


>gi|238792381|ref|ZP_04636015.1| hypothetical protein yinte0001_13090 [Yersinia intermedia ATCC
           29909]
 gi|238728307|gb|EEQ19827.1| hypothetical protein yinte0001_13090 [Yersinia intermedia ATCC
           29909]
          Length = 215

 Score =  196 bits (499), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 88/212 (41%), Positives = 132/212 (62%), Gaps = 1/212 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + I+ VT F QNCT ++ E + +A +VDPGGD   I   +  +   V QI +THGH+D
Sbjct: 1   MKYQIIPVTAFSQNCTLIWCEATKQAALVDPGGDAAKIIAEVTRQGVTVSQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG A +L     + I GP K+D   +  +  Q+R+  +       +  RWL++GD + +
Sbjct: 61  HVGAATELAAHFDIPIYGPEKEDTFWLEGLPAQSRMFGLS-ECDAFTPTRWLEEGDKITV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGH+PGH+++++     A +GD +F   +GR+D   GD+QQLINSI  K+
Sbjct: 120 GEVELSVLHCPGHTPGHIVFIDQSGRLALVGDVIFNGGVGRSDFPRGDHQQLINSIRTKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSN 215
           LPLGD+I+F+ GHGP ST+G ER+ NPF++  
Sbjct: 180 LPLGDDITFIPGHGPMSTLGHERQTNPFIREE 211


>gi|206581011|ref|YP_002239425.1| metallo-beta-lactamase domain protein [Klebsiella pneumoniae 342]
 gi|288936275|ref|YP_003440334.1| beta-lactamase [Klebsiella variicola At-22]
 gi|290510669|ref|ZP_06550039.1| ycbL [Klebsiella sp. 1_1_55]
 gi|206570069|gb|ACI11845.1| metallo-beta-lactamase domain protein [Klebsiella pneumoniae 342]
 gi|288890984|gb|ADC59302.1| beta-lactamase domain protein [Klebsiella variicola At-22]
 gi|289777385|gb|EFD85383.1| ycbL [Klebsiella sp. 1_1_55]
          Length = 215

 Score =  196 bits (499), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 88/213 (41%), Positives = 139/213 (65%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++ I+ VT F QNC+ ++ E++  A +VDPGGD + IK V+      + QI +THGH+D
Sbjct: 1   MNYRIIPVTAFAQNCSLIWCEQTRLAALVDPGGDAERIKAVVAEAGVTLMQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L +   + +IGP K+D   +  +  Q+R+  +  + +    DRWL +GD + +
Sbjct: 61  HVGAAAELAQHYGVPVIGPEKEDEFWLEGLPAQSRMFGLE-DCQPLRPDRWLNEGDVVNV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGHV++ +  +     GD +F+  +GR+D   GD+ QLI +I +K+
Sbjct: 120 GNVALQVLHCPGHTPGHVVFFDDASRLLISGDVIFKGGVGRSDFPRGDHGQLIAAIKDKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           LPLGD+++F+ GHGP ST+G ERR NPFL+  +
Sbjct: 180 LPLGDDVTFIPGHGPLSTLGEERRNNPFLQDEM 212


>gi|238025885|ref|YP_002910116.1| beta-lactamase-like protein [Burkholderia glumae BGR1]
 gi|237875079|gb|ACR27412.1| Beta-lactamase-like protein [Burkholderia glumae BGR1]
          Length = 215

 Score =  196 bits (498), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 87/205 (42%), Positives = 130/205 (63%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           ++ VTPF+QNC+ +  E++  A VVDPGGDL+ I++ ++ +   V+++ +THGH+DH  G
Sbjct: 5   LIPVTPFQQNCSLIVCEQTGRAAVVDPGGDLERIREQVEQQGVQVEKVLVTHGHLDHCAG 64

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           A  L     + I GPH+D+   + ++  Q+        A     DRWL DGD + +G   
Sbjct: 65  AKALAAHYGVPIEGPHEDERFWIEQLPSQSERFGFGAKAEVFEPDRWLTDGDAVTVGDET 124

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
            +V+HCPGH+PGHV++ +  +  A +GD LF  SIGRTD   G+++ L+ SI  K+ PLG
Sbjct: 125 LEVYHCPGHTPGHVVFFSRAHRLAIVGDVLFAGSIGRTDFPRGNHEDLVRSIREKLWPLG 184

Query: 188 DEISFVCGHGPNSTIGRERRLNPFL 212
           D++ FV GHGP ST G ER  NPF+
Sbjct: 185 DDVRFVPGHGPVSTFGNERATNPFV 209


>gi|218548443|ref|YP_002382234.1| metal-binding hydrolase [Escherichia fergusonii ATCC 35469]
 gi|218355984|emb|CAQ88600.1| putative metal-binding hydrolase [Escherichia fergusonii ATCC
           35469]
          Length = 215

 Score =  196 bits (498), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 87/213 (40%), Positives = 139/213 (65%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++ I+ VT F QNC+ ++ E++  A +VDPGGD + IK  + +    + QI +THGH+D
Sbjct: 1   MNYRIIPVTAFSQNCSLIWCEQTRLAALVDPGGDAEKIKQEVDASGLTLMQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L +   + ++GP K+D   +  +  Q+R+  +    +  + DRWL DGDT+ +
Sbjct: 61  HVGAAAELAQHYGVPVLGPEKEDEFWLQGLPAQSRMFGLD-ECQPLTPDRWLNDGDTISI 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGHV++ + +      GD +F+  +GR+D   GD+ QLI +I +K+
Sbjct: 120 GNVTLQVLHCPGHTPGHVVFFDDQAKLLISGDVIFKGGVGRSDFPRGDHNQLIAAIKDKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           LPLGD+++F+ GHGP ST+G ER  NPFL+  +
Sbjct: 180 LPLGDDVTFIPGHGPLSTLGYERLHNPFLQDEM 212


>gi|331672463|ref|ZP_08373253.1| putative Metallo-beta-lactamase [Escherichia coli TA280]
 gi|331070369|gb|EGI41734.1| putative Metallo-beta-lactamase [Escherichia coli TA280]
          Length = 215

 Score =  196 bits (498), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 87/213 (40%), Positives = 139/213 (65%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++ I+ VT F QNC+ ++ E++  A +VDPGGD + IK  + +    + QI +THGH+D
Sbjct: 1   MNYRIIPVTAFSQNCSLIWCEQTRLAALVDPGGDAEKIKQEVDASGLTLMQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L +   +++ GP K+D   +  +  Q+R+  +    +  + DRWL +GDT+ +
Sbjct: 61  HVGAAAELAQHYGVSVFGPEKEDEFWLQGLPAQSRMFGLE-ECQPLTPDRWLNEGDTISI 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGHV++ +        GD +F+  +GR+D   GD+ QLI+SI +K+
Sbjct: 120 GNVALQVLHCPGHTPGHVVFFDDRAKLLISGDVIFKGGVGRSDFPRGDHNQLISSIKDKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           LPLGD+++F+ GHGP ST+G ER  NPFL+  +
Sbjct: 180 LPLGDDVTFIPGHGPLSTLGYERLHNPFLQDEM 212


>gi|194434389|ref|ZP_03066652.1| metallo-beta-lactamase family protein [Shigella dysenteriae 1012]
 gi|194417373|gb|EDX33479.1| metallo-beta-lactamase family protein [Shigella dysenteriae 1012]
 gi|332095877|gb|EGJ00884.1| metallo-beta-lactamase superfamily protein [Shigella dysenteriae
           155-74]
          Length = 215

 Score =  196 bits (498), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 87/213 (40%), Positives = 139/213 (65%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++ I+ VT F QNC+ ++ E++  A +VDPGGD + IK  +      + QI +THGH+D
Sbjct: 1   MNYRIIPVTAFSQNCSLIWCEQTRLAALVDPGGDAEKIKQEVDDSGLTLMQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L +   + + GP K+D   +  +  Q+R+  +    ++ + DRWL++GDT+ +
Sbjct: 61  HVGAAAELAQHYGVPVFGPEKEDEFWLQGLPAQSRMFGLE-ECQSLTPDRWLKEGDTISI 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGHV++ +        GD +F+  +GR+D   GD+ QLI+SI +K+
Sbjct: 120 GNVTLQVLHCPGHTPGHVVFFDDRAKLLISGDVIFKGGVGRSDFPRGDHNQLISSIKDKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           LPLGD+++F+ GHGP ST+G ER  NPFL+  +
Sbjct: 180 LPLGDDVTFIPGHGPLSTLGYERLHNPFLQDEM 212


>gi|82777549|ref|YP_403898.1| hypothetical protein SDY_2330 [Shigella dysenteriae Sd197]
 gi|309787800|ref|ZP_07682410.1| metallo-beta-lactamase superfamily protein [Shigella dysenteriae
           1617]
 gi|81241697|gb|ABB62407.1| conserved hypothetical protein [Shigella dysenteriae Sd197]
 gi|308924199|gb|EFP69696.1| metallo-beta-lactamase superfamily protein [Shigella dysenteriae
           1617]
          Length = 215

 Score =  196 bits (498), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 87/213 (40%), Positives = 138/213 (64%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++ I+ VT F QNC+ ++ E++  A +VDPGGD + IK  + +    + QI +THGH+D
Sbjct: 1   MNYRIIPVTAFSQNCSLIWCEQTRLAALVDPGGDAEKIKQEVDASGLTLMQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L +   + + GP K+D   +  +  Q+R+  +    +  + DRWL +GDT+ +
Sbjct: 61  HVGAAAELAQHYGMPVFGPEKEDEFWLQGLPAQSRMFGLE-ECQPLTPDRWLNEGDTISI 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGHV++ +        GD +F+  +GR+D   GD+ QLI+SI +K+
Sbjct: 120 GNVALQVLHCPGHTPGHVVFFDDRAKLLISGDVIFKGGVGRSDFPRGDHNQLISSIKDKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           LPLGD+++F+ GHGP ST+G ER  NPFL+  +
Sbjct: 180 LPLGDDVTFIPGHGPLSTLGYERLHNPFLQDEM 212


>gi|283833782|ref|ZP_06353523.1| metallo-beta-lactamase family protein [Citrobacter youngae ATCC
           29220]
 gi|291070447|gb|EFE08556.1| metallo-beta-lactamase family protein [Citrobacter youngae ATCC
           29220]
          Length = 215

 Score =  196 bits (498), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 87/213 (40%), Positives = 140/213 (65%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++ I+ VT F QNC+ ++ E++  A +VDPGGD + IK  +++    + QI +THGH+D
Sbjct: 1   MNYRIIPVTAFAQNCSLIWCEQTRLAALVDPGGDAEKIKQEVEASGLTLMQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L +   + +IGP K+D   +  +  Q+R+  +  +    + DRWL DGD + +
Sbjct: 61  HVGAAAELAQHYGVPVIGPEKEDEFWLQGLPAQSRMFGLG-DCEPLTPDRWLNDGDRVSV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGHV++ + ++     GD +F+  +GR+D   GD+ QLI++I  K+
Sbjct: 120 GNVSLQVLHCPGHTPGHVVFFDEQSKLLISGDVIFKGGVGRSDFPRGDHSQLIDAIKRKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           LPLGD+++F+ GHGP ST+G ER  NPFL+  +
Sbjct: 180 LPLGDDVTFIPGHGPLSTLGNERLHNPFLQDEM 212


>gi|296160812|ref|ZP_06843625.1| beta-lactamase domain protein [Burkholderia sp. Ch1-1]
 gi|295888904|gb|EFG68709.1| beta-lactamase domain protein [Burkholderia sp. Ch1-1]
          Length = 214

 Score =  196 bits (498), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 91/209 (43%), Positives = 131/209 (62%), Gaps = 1/209 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           ++ VTPF+QN + L  E +  A VVDPGGDLDII+  I  +N  V+++++THGH+DH  G
Sbjct: 5   LIPVTPFQQNSSLLVCEATGRAAVVDPGGDLDIIQGEISRQNVSVEKVFLTHGHIDHCAG 64

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           A  L     + I GPH D+   + K+ +Q+        A     DRWLQ+G+ +  G  I
Sbjct: 65  AKTLASHYGVPIEGPHPDERFWLDKLPDQSTRFGFPA-AEAFEPDRWLQNGEAVHFGDEI 123

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
            +V+HCPGH+PGHV++ +  +  A +GD LF  SIGRTD   G++  L+ SI  K+ PLG
Sbjct: 124 LEVYHCPGHTPGHVVFFSRAHRLALVGDVLFAGSIGRTDFPRGNHADLVRSIREKLWPLG 183

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           D+++FV GHGP ST   ERR NP++   +
Sbjct: 184 DDVTFVPGHGPTSTFSAERRTNPYVADGV 212


>gi|254250881|ref|ZP_04944199.1| Beta-lactamase-like [Burkholderia dolosa AUO158]
 gi|124893490|gb|EAY67370.1| Beta-lactamase-like [Burkholderia dolosa AUO158]
          Length = 278

 Score =  196 bits (498), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 93/213 (43%), Positives = 130/213 (61%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +   ++ VTPF+QNC+ L  E +  A VVDPGGDL+ I+  I  +N  V ++ +THGHVD
Sbjct: 65  MKVTLIPVTPFQQNCSLLVCENTGRAAVVDPGGDLERIEQEIARQNVQVDKVLLTHGHVD 124

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H  GA  L     + I GPH+D+   + ++  Q++       A     DRWL DGDT+  
Sbjct: 125 HCAGAKALATRYGVPIEGPHEDERFWIEQLPMQSQRFGF-PAAEAFEPDRWLNDGDTVRF 183

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V+HCPGH+PGHV++ +  +  A +GD LF  SIGRTD   G++  L+ SI  K+
Sbjct: 184 GDETLDVYHCPGHTPGHVVFFSRPHRVAIVGDVLFAGSIGRTDFPRGNHADLVRSIKEKL 243

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            PLGD+++FV GHGP ST G ERR NPF+   +
Sbjct: 244 WPLGDDVTFVPGHGPVSTFGDERRTNPFVSDKV 276


>gi|325520984|gb|EGC99940.1| hydroxyacylglutathione hydrolase [Burkholderia sp. TJI49]
          Length = 214

 Score =  196 bits (497), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 92/209 (44%), Positives = 130/209 (62%), Gaps = 1/209 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           ++ VTPF+QNC+ L  E++  A VVDPGGDL+ I+  I  +N  V+++ +THGH+DH  G
Sbjct: 5   LIPVTPFQQNCSLLVCEQTGRAAVVDPGGDLERIEQEIARQNVQVEKVLLTHGHIDHCAG 64

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           A  L     + I GP +D+   + K+  Q+        A     DRWL DGDT+  G   
Sbjct: 65  AKTLATHYGVPIEGPQEDERFWIEKLPMQSERFGFPA-AEAFEPDRWLNDGDTVQFGDET 123

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
            +V+HCPGH+PGHV++ +  +  A +GD LF  SIGRTD   G++  L+ SI  K+ PLG
Sbjct: 124 LEVYHCPGHTPGHVVFFSRAHRVAIVGDVLFAGSIGRTDFPRGNHADLVRSIKEKLWPLG 183

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           D+++FV GHGP ST G ERR NPF+   +
Sbjct: 184 DDVTFVPGHGPVSTFGDERRTNPFVSDKV 212


>gi|294338482|emb|CAZ86808.1| putative Hydroxyacylglutathione hydrolase [Thiomonas sp. 3As]
          Length = 212

 Score =  196 bits (497), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 89/212 (41%), Positives = 131/212 (61%), Gaps = 1/212 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L + I+ VT F QN   ++D+ + EAV  DPGG++D +   +      ++ +W+TH H+D
Sbjct: 2   LRYRILPVTAFAQNTCLVWDDATQEAVFTDPGGEVDRLLQAVVEAGVTLRAVWLTHAHID 61

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H G AA++ +   + IIGPH  D   +  + +QA+       A+  + DRWL DGDTL L
Sbjct: 62  HAGAAAEVAQRAGVPIIGPHPGDQFWIDALPQQAQRFGF-PPAKTFTPDRWLADGDTLQL 120

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G+  F V HCPGH+PGHV++   E     +GD LF  SIGRTD   G++QQL++SI  K+
Sbjct: 121 GSLPFTVRHCPGHTPGHVVFHQPEARRCWVGDVLFAGSIGRTDFPGGNHQQLLDSITGKL 180

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSN 215
            P+GD+  F+ GHGP ST G +RR NP+++  
Sbjct: 181 WPMGDDTVFIPGHGPESTFGEQRRSNPYVRGT 212


>gi|170701640|ref|ZP_02892584.1| beta-lactamase domain protein [Burkholderia ambifaria IOP40-10]
 gi|170133461|gb|EDT01845.1| beta-lactamase domain protein [Burkholderia ambifaria IOP40-10]
          Length = 214

 Score =  196 bits (497), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 90/209 (43%), Positives = 133/209 (63%), Gaps = 1/209 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           ++ VTPF+QNC+ +  E++  A VVDPGGDL+ I+  I  +N  V+++ +THGH+DH GG
Sbjct: 5   LIPVTPFQQNCSLVVCEKTGRAAVVDPGGDLERIEQEIARQNVQVEKVLLTHGHIDHCGG 64

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           A  L     + I+GP +D+   + ++  Q++       A     D WL DGDT+ +G   
Sbjct: 65  AKALATHYGVPIVGPQEDERFWIEQLPMQSQRFGFPA-AETFEPDHWLNDGDTVQIGDET 123

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
            +V+HCPGH+PGHV++ +  +  A +GD LF  SIGRTD   G++  L+ SI  K+ PLG
Sbjct: 124 LEVYHCPGHTPGHVVFFSRAHRVAIVGDVLFAGSIGRTDFPRGNHADLVRSIKEKLWPLG 183

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           D+++FV GHGP ST G ERR NPF+   +
Sbjct: 184 DDVTFVPGHGPVSTFGDERRTNPFVSDKV 212


>gi|170680350|ref|YP_001744243.1| metallo-beta-lactamase family protein [Escherichia coli SMS-3-5]
 gi|218700554|ref|YP_002408183.1| putative metal-binding hydrolase [Escherichia coli IAI39]
 gi|300937728|ref|ZP_07152529.1| metallo-beta-lactamase domain protein [Escherichia coli MS 21-1]
 gi|170518068|gb|ACB16246.1| metallo-beta-lactamase family protein [Escherichia coli SMS-3-5]
 gi|218370540|emb|CAR18347.1| putative metal-binding hydrolase [Escherichia coli IAI39]
 gi|300457235|gb|EFK20728.1| metallo-beta-lactamase domain protein [Escherichia coli MS 21-1]
 gi|315296216|gb|EFU55523.1| metallo-beta-lactamase domain protein [Escherichia coli MS 16-3]
 gi|323967174|gb|EGB62598.1| metallo-beta-lactamase superfamily protein [Escherichia coli M863]
          Length = 215

 Score =  196 bits (497), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 87/213 (40%), Positives = 138/213 (64%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++ I+ VT F QNC+ ++ E++  A +VDPGGD + IK  + +    + QI +THGH+D
Sbjct: 1   MNYRIIPVTAFSQNCSLIWCEQTRLAALVDPGGDAEKIKQEVDASGLTLMQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L +   + + GP K+D   +  +  Q+R+  +    +  + DRWL +GDT+ +
Sbjct: 61  HVGAAAELAQHYGVPVFGPEKEDEFWLQGLPAQSRMFGLE-ECQPLTPDRWLNEGDTISI 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGHV++ +        GD +F+  +GR+D   GD+ QLI+SI +K+
Sbjct: 120 GNVTLQVLHCPGHTPGHVVFFDERARLLISGDVIFKGGVGRSDFPRGDHNQLISSIKDKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           LPLGD+++F+ GHGP ST+G ER  NPFL+  +
Sbjct: 180 LPLGDDVTFIPGHGPLSTLGYERLHNPFLQDEM 212


>gi|307728226|ref|YP_003905450.1| beta-lactamase domain-containing protein [Burkholderia sp.
           CCGE1003]
 gi|307582761|gb|ADN56159.1| beta-lactamase domain protein [Burkholderia sp. CCGE1003]
          Length = 214

 Score =  196 bits (497), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 90/209 (43%), Positives = 130/209 (62%), Gaps = 1/209 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           ++ VTPF+QNC+ L  E +  A VVDPGGDL++I+  I  +   V+++++THGH+DH  G
Sbjct: 5   LIPVTPFQQNCSLLVCEATGRAAVVDPGGDLEVIQGEIARQKVSVEKVFLTHGHIDHCAG 64

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           A  L     + I GPH D+   + K+ +Q+        A     DRWL  GDT+  G   
Sbjct: 65  AKTLALHYGVPIEGPHADERFWLDKLPDQSTRFGFPA-AEAFEPDRWLDTGDTVQFGEET 123

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
            +V+HCPGH+PGHV++ +  +  A +GD LF  SIGRTD   G++  L+ SI  K+ PLG
Sbjct: 124 LEVYHCPGHTPGHVVFFSRAHRLALVGDVLFAGSIGRTDFPRGNHADLVRSIREKLWPLG 183

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           D+++FV GHGP ST G ERR NP++   +
Sbjct: 184 DDVTFVPGHGPTSTFGAERRSNPYVGDGV 212


>gi|119713428|gb|ABL97490.1| beta-lactamase family protein [uncultured marine bacterium
           HF130_81H07]
          Length = 208

 Score =  196 bits (497), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 90/201 (44%), Positives = 137/201 (68%), Gaps = 1/201 (0%)

Query: 16  QNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLKEDL 75
           QN   +++E++  A V DPGGDL+ I+  ++  +  + +I+ITHGH+DH GGA  L +  
Sbjct: 2   QNSCIIWNEDTKNAAVTDPGGDLEKIESYLKENDLQLIKIFITHGHLDHAGGAFNLSKKF 61

Query: 76  SLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFKVFHCPG 135
           ++ I GPHK+D  ++  ++E  ++  +  +++N   DRWL DGD L L    F V+HCPG
Sbjct: 62  NVPIEGPHKEDEFLISALEEHGKMYGLS-DSKNFLPDRWLDDGDQLELDGIHFDVYHCPG 120

Query: 136 HSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEISFVCG 195
           H+PGHVI+ N E+ FA +GD LF+ SIGRTD   G++++LIN+I  K+ PLGD+++FV G
Sbjct: 121 HTPGHVIFHNKESKFAIVGDVLFQGSIGRTDFPRGNHEELINAIRTKLWPLGDDVTFVPG 180

Query: 196 HGPNSTIGRERRLNPFLKSNI 216
           HGP ST G+ER  NP++   +
Sbjct: 181 HGPVSTFGQERMTNPYVADQL 201


>gi|115350255|ref|YP_772094.1| beta-lactamase domain-containing protein [Burkholderia ambifaria
           AMMD]
 gi|115280243|gb|ABI85760.1| beta-lactamase domain protein [Burkholderia ambifaria AMMD]
          Length = 214

 Score =  196 bits (497), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 89/209 (42%), Positives = 135/209 (64%), Gaps = 1/209 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           ++ VTPF+QNC+ +  E++  A VVDPGGDL+ I++ I  +N  ++++ +THGH+DH GG
Sbjct: 5   LIPVTPFQQNCSLVVCEKTGRAAVVDPGGDLERIEEEIARQNVQLEKVLLTHGHIDHCGG 64

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           A  L     + I+GP +D+   + ++  Q++       A     D WL DGDT+ +G   
Sbjct: 65  AKALATHYGVPIVGPQEDERFWIEQLPTQSQRFGFPA-AETFEPDHWLNDGDTVQVGDET 123

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
            +V+HCPGH+PGHV++ +  ++ A +GD LF  SIGRTD   G++  L+ SI  K+ PLG
Sbjct: 124 LEVYHCPGHTPGHVVFFSRAHHVAIVGDVLFAGSIGRTDFPRGNHADLVRSIKEKLWPLG 183

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           D+++FV GHGP ST G ERR NPF+   +
Sbjct: 184 DDVTFVPGHGPVSTFGDERRTNPFVSDKV 212


>gi|237730890|ref|ZP_04561371.1| conserved hypothetical protein [Citrobacter sp. 30_2]
 gi|226906429|gb|EEH92347.1| conserved hypothetical protein [Citrobacter sp. 30_2]
          Length = 215

 Score =  195 bits (496), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 87/213 (40%), Positives = 139/213 (65%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++ I+ VT F QNC+ ++ E++  A +VDPGGD + IK  + +    + QI +THGH+D
Sbjct: 1   MNYRIIPVTAFAQNCSLIWCEQTRLAALVDPGGDAEKIKQEVDASGLTLMQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L +   + +IGP K+D   +  +  Q+R+  +  +    + DRWL +GD + +
Sbjct: 61  HVGAAAELAQHYGVPVIGPEKEDEFWLQGLPAQSRMFGLG-DCEPLTPDRWLNEGDRISV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGHV++ + ++     GD +F+  +GR+D   GD+ QLI+SI  K+
Sbjct: 120 GNVTLQVLHCPGHTPGHVVFFDEQSKLLISGDVIFKGGVGRSDFPRGDHSQLIDSIKRKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           LPLGD+++F+ GHGP ST+G ER  NPFL+  +
Sbjct: 180 LPLGDDVTFIPGHGPLSTLGNERLHNPFLQDEM 212


>gi|324113742|gb|EGC07717.1| metallo-beta-lactamase superfamily protein [Escherichia fergusonii
           B253]
          Length = 215

 Score =  195 bits (496), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 86/213 (40%), Positives = 140/213 (65%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++ I+ VT F QNC+ ++ E++  A +VDPGGD + IK  + +    + QI +THGH+D
Sbjct: 1   MNYRIIPVTAFSQNCSLIWCEQTRLAALVDPGGDAEKIKQEVDASGLTLMQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L +   + ++GP K+D   +  +  Q+R+  +    +  + DRWL +GDT+ +
Sbjct: 61  HVGAAAELAQHYGVPVLGPEKEDEFWLQGLPAQSRMFGLD-ECQPLTPDRWLNEGDTISI 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGHV++ + +      GD +F+  +GR+D   GD+ QLI++I +K+
Sbjct: 120 GNVTLQVLHCPGHTPGHVVFFDDQAKLLISGDVIFKGGVGRSDFPRGDHNQLISAIKDKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           LPLGD+++F+ GHGP ST+G ER  NPFL+  +
Sbjct: 180 LPLGDDVTFIPGHGPLSTLGYERLHNPFLQDEM 212


>gi|15800788|ref|NP_286802.1| hypothetical protein Z1274 [Escherichia coli O157:H7 EDL933]
 gi|15830264|ref|NP_309037.1| hypothetical protein ECs1010 [Escherichia coli O157:H7 str. Sakai]
 gi|26246954|ref|NP_752994.1| hypothetical protein c1069 [Escherichia coli CFT073]
 gi|91210029|ref|YP_540015.1| hypothetical protein UTI89_C0999 [Escherichia coli UTI89]
 gi|110641124|ref|YP_668854.1| hypothetical protein ECP_0938 [Escherichia coli 536]
 gi|117623145|ref|YP_852058.1| YcbL [Escherichia coli APEC O1]
 gi|168751191|ref|ZP_02776213.1| metallo-beta-lactamase family protein [Escherichia coli O157:H7
           str. EC4113]
 gi|168757020|ref|ZP_02782027.1| metallo-beta-lactamase family protein [Escherichia coli O157:H7
           str. EC4401]
 gi|168762935|ref|ZP_02787942.1| metallo-beta-lactamase family protein [Escherichia coli O157:H7
           str. EC4501]
 gi|168769923|ref|ZP_02794930.1| metallo-beta-lactamase family protein [Escherichia coli O157:H7
           str. EC4486]
 gi|168776219|ref|ZP_02801226.1| metallo-beta-lactamase family protein [Escherichia coli O157:H7
           str. EC4196]
 gi|168783981|ref|ZP_02808988.1| metallo-beta-lactamase family protein [Escherichia coli O157:H7
           str. EC4076]
 gi|168787357|ref|ZP_02812364.1| metallo-beta-lactamase family protein [Escherichia coli O157:H7
           str. EC869]
 gi|168802923|ref|ZP_02827930.1| metallo-beta-lactamase family protein [Escherichia coli O157:H7
           str. EC508]
 gi|191172140|ref|ZP_03033684.1| metallo-beta-lactamase family protein [Escherichia coli F11]
 gi|195939658|ref|ZP_03085040.1| YcbL [Escherichia coli O157:H7 str. EC4024]
 gi|208806417|ref|ZP_03248754.1| metallo-beta-lactamase family protein [Escherichia coli O157:H7
           str. EC4206]
 gi|208814804|ref|ZP_03255983.1| metallo-beta-lactamase family protein [Escherichia coli O157:H7
           str. EC4045]
 gi|208822583|ref|ZP_03262902.1| metallo-beta-lactamase family protein [Escherichia coli O157:H7
           str. EC4042]
 gi|209395793|ref|YP_002269599.1| metallo-beta-lactamase family protein [Escherichia coli O157:H7
           str. EC4115]
 gi|217325208|ref|ZP_03441292.1| metallo-beta-lactamase family protein [Escherichia coli O157:H7
           str. TW14588]
 gi|218557832|ref|YP_002390745.1| metal-binding hydrolase [Escherichia coli S88]
 gi|218688770|ref|YP_002396982.1| putative metal-binding hydrolase [Escherichia coli ED1a]
 gi|227884108|ref|ZP_04001913.1| zinc (Zn2+)-dependent hydrolase [Escherichia coli 83972]
 gi|237707085|ref|ZP_04537566.1| YcbL [Escherichia sp. 3_2_53FAA]
 gi|254792126|ref|YP_003076963.1| putative metal-binding enzyme [Escherichia coli O157:H7 str.
           TW14359]
 gi|261227430|ref|ZP_05941711.1| predicted metal-binding enzyme [Escherichia coli O157:H7 str.
           FRIK2000]
 gi|261256147|ref|ZP_05948680.1| predicted metal-binding enzyme [Escherichia coli O157:H7 str.
           FRIK966]
 gi|291281928|ref|YP_003498746.1| Metallo-beta-lactamase family protein [Escherichia coli O55:H7 str.
           CB9615]
 gi|293409304|ref|ZP_06652880.1| conserved hypothetical protein [Escherichia coli B354]
 gi|300978414|ref|ZP_07174262.1| metallo-beta-lactamase domain protein [Escherichia coli MS 45-1]
 gi|300983086|ref|ZP_07176430.1| metallo-beta-lactamase domain protein [Escherichia coli MS 200-1]
 gi|301047812|ref|ZP_07194864.1| metallo-beta-lactamase domain protein [Escherichia coli MS 185-1]
 gi|306812620|ref|ZP_07446813.1| Metallo-beta-lactamase family protein [Escherichia coli NC101]
 gi|331656998|ref|ZP_08357960.1| putative Metallo-beta-lactamase [Escherichia coli TA206]
 gi|12514099|gb|AAG55412.1|AE005282_7 orf, hypothetical protein [Escherichia coli O157:H7 str. EDL933]
 gi|26107354|gb|AAN79537.1|AE016758_141 Hypothetical protein ycbL [Escherichia coli CFT073]
 gi|13360469|dbj|BAB34433.1| hypothetical protein [Escherichia coli O157:H7 str. Sakai]
 gi|91071603|gb|ABE06484.1| hypothetical protein UTI89_C0999 [Escherichia coli UTI89]
 gi|110342716|gb|ABG68953.1| hypothetical protein YcbL [Escherichia coli 536]
 gi|115512269|gb|ABJ00344.1| YcbL [Escherichia coli APEC O1]
 gi|187768360|gb|EDU32204.1| metallo-beta-lactamase family protein [Escherichia coli O157:H7
           str. EC4196]
 gi|188014715|gb|EDU52837.1| metallo-beta-lactamase family protein [Escherichia coli O157:H7
           str. EC4113]
 gi|188998778|gb|EDU67764.1| metallo-beta-lactamase family protein [Escherichia coli O157:H7
           str. EC4076]
 gi|189355912|gb|EDU74331.1| metallo-beta-lactamase family protein [Escherichia coli O157:H7
           str. EC4401]
 gi|189361174|gb|EDU79593.1| metallo-beta-lactamase family protein [Escherichia coli O157:H7
           str. EC4486]
 gi|189366788|gb|EDU85204.1| metallo-beta-lactamase family protein [Escherichia coli O157:H7
           str. EC4501]
 gi|189372736|gb|EDU91152.1| metallo-beta-lactamase family protein [Escherichia coli O157:H7
           str. EC869]
 gi|189375249|gb|EDU93665.1| metallo-beta-lactamase family protein [Escherichia coli O157:H7
           str. EC508]
 gi|190907667|gb|EDV67262.1| metallo-beta-lactamase family protein [Escherichia coli F11]
 gi|208726218|gb|EDZ75819.1| metallo-beta-lactamase family protein [Escherichia coli O157:H7
           str. EC4206]
 gi|208731452|gb|EDZ80140.1| metallo-beta-lactamase family protein [Escherichia coli O157:H7
           str. EC4045]
 gi|208738068|gb|EDZ85751.1| metallo-beta-lactamase family protein [Escherichia coli O157:H7
           str. EC4042]
 gi|209157193|gb|ACI34626.1| metallo-beta-lactamase family protein [Escherichia coli O157:H7
           str. EC4115]
 gi|209774728|gb|ACI85676.1| hypothetical protein ECs1010 [Escherichia coli]
 gi|209774730|gb|ACI85677.1| hypothetical protein ECs1010 [Escherichia coli]
 gi|209774732|gb|ACI85678.1| hypothetical protein ECs1010 [Escherichia coli]
 gi|209774734|gb|ACI85679.1| hypothetical protein ECs1010 [Escherichia coli]
 gi|209774736|gb|ACI85680.1| hypothetical protein ECs1010 [Escherichia coli]
 gi|217321429|gb|EEC29853.1| metallo-beta-lactamase family protein [Escherichia coli O157:H7
           str. TW14588]
 gi|218364601|emb|CAR02287.1| putative metal-binding hydrolase [Escherichia coli S88]
 gi|218426334|emb|CAR07159.1| putative metal-binding hydrolase [Escherichia coli ED1a]
 gi|222032658|emb|CAP75397.1| Uncharacterized protein ycbL [Escherichia coli LF82]
 gi|226898295|gb|EEH84554.1| YcbL [Escherichia sp. 3_2_53FAA]
 gi|227838860|gb|EEJ49326.1| zinc (Zn2+)-dependent hydrolase [Escherichia coli 83972]
 gi|254591526|gb|ACT70887.1| predicted metal-binding enzyme [Escherichia coli O157:H7 str.
           TW14359]
 gi|290761801|gb|ADD55762.1| Metallo-beta-lactamase family protein [Escherichia coli O55:H7 str.
           CB9615]
 gi|291469772|gb|EFF12256.1| conserved hypothetical protein [Escherichia coli B354]
 gi|294492636|gb|ADE91392.1| metallo-beta-lactamase family protein [Escherichia coli IHE3034]
 gi|300300304|gb|EFJ56689.1| metallo-beta-lactamase domain protein [Escherichia coli MS 185-1]
 gi|300306990|gb|EFJ61510.1| metallo-beta-lactamase domain protein [Escherichia coli MS 200-1]
 gi|300409656|gb|EFJ93194.1| metallo-beta-lactamase domain protein [Escherichia coli MS 45-1]
 gi|305853383|gb|EFM53822.1| Metallo-beta-lactamase family protein [Escherichia coli NC101]
 gi|307552766|gb|ADN45541.1| hypothetical protein ECABU_c09660 [Escherichia coli ABU 83972]
 gi|307627646|gb|ADN71950.1| Metallo-beta-lactamase family protein [Escherichia coli UM146]
 gi|312945447|gb|ADR26274.1| predicted metal-binding enzyme [Escherichia coli O83:H1 str. NRG
           857C]
 gi|315287546|gb|EFU46952.1| metallo-beta-lactamase domain protein [Escherichia coli MS 110-3]
 gi|315291225|gb|EFU50585.1| metallo-beta-lactamase domain protein [Escherichia coli MS 153-1]
 gi|320192587|gb|EFW67228.1| hypothetical protein ECoD_00514 [Escherichia coli O157:H7 str.
           EC1212]
 gi|320196578|gb|EFW71201.1| hypothetical protein EcoM_01119 [Escherichia coli WV_060327]
 gi|320637795|gb|EFX07587.1| Metallo-beta-lactamase family protein [Escherichia coli O157:H7
           str. G5101]
 gi|320642920|gb|EFX12121.1| Metallo-beta-lactamase family protein [Escherichia coli O157:H-
           str. 493-89]
 gi|320648377|gb|EFX17032.1| Metallo-beta-lactamase family protein [Escherichia coli O157:H-
           str. H 2687]
 gi|320653693|gb|EFX21767.1| Metallo-beta-lactamase family protein [Escherichia coli O55:H7 str.
           3256-97 TW 07815]
 gi|320659838|gb|EFX27394.1| Metallo-beta-lactamase family protein [Escherichia coli O55:H7 str.
           USDA 5905]
 gi|320664307|gb|EFX31458.1| Metallo-beta-lactamase family protein [Escherichia coli O157:H7
           str. LSU-61]
 gi|323953365|gb|EGB49231.1| metallo-beta-lactamase superfamily protein [Escherichia coli H252]
 gi|323958232|gb|EGB53941.1| metallo-beta-lactamase superfamily protein [Escherichia coli H263]
 gi|324009852|gb|EGB79071.1| metallo-beta-lactamase domain protein [Escherichia coli MS 57-2]
 gi|324012954|gb|EGB82173.1| metallo-beta-lactamase domain protein [Escherichia coli MS 60-1]
 gi|326338178|gb|EGD62007.1| hypothetical protein ECF_05129 [Escherichia coli O157:H7 str. 1125]
 gi|326346155|gb|EGD69893.1| putative metallo-beta-lactamase [Escherichia coli O157:H7 str.
           1044]
 gi|331055246|gb|EGI27255.1| putative Metallo-beta-lactamase [Escherichia coli TA206]
          Length = 215

 Score =  195 bits (496), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 87/213 (40%), Positives = 138/213 (64%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++ I+ VT F QNC+ ++ E++  A +VDPGGD + IK  + +    + QI +THGH+D
Sbjct: 1   MNYRIIPVTAFSQNCSLIWCEQTRLAALVDPGGDAEKIKQEVDASGLTLMQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L +   + + GP K+D   +  +  Q+R+  +    +  + DRWL +GDT+ +
Sbjct: 61  HVGAAAELAQHYGVPVFGPEKEDEFWLQGLPAQSRMFGLE-ECQPLTPDRWLNEGDTISI 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGHV++ +        GD +F+  +GR+D   GD+ QLI+SI +K+
Sbjct: 120 GNVTLQVLHCPGHTPGHVVFFDDRAKLLISGDVIFKGGVGRSDFPRGDHNQLISSIKDKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           LPLGD+++F+ GHGP ST+G ER  NPFL+  +
Sbjct: 180 LPLGDDVTFIPGHGPLSTLGYERLHNPFLQDEM 212


>gi|320182004|gb|EFW56909.1| hypothetical protein SGB_00726 [Shigella boydii ATCC 9905]
 gi|332092541|gb|EGI97614.1| metallo-beta-lactamase superfamily protein [Shigella boydii
           5216-82]
          Length = 215

 Score =  195 bits (496), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 87/213 (40%), Positives = 138/213 (64%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++ I+ VT F QNC+ ++ E++  A +VDPGGD + IK  +      + QI +THGH+D
Sbjct: 1   MNYRIIPVTAFSQNCSLIWCEQTRLAALVDPGGDAEKIKQEVDDSGLTLMQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L +   + + GP K+D   +  +  Q+R+  +    +  + DRWL++GDT+ +
Sbjct: 61  HVGAAAELAQHYGVPVFGPEKEDEFWLQGLPAQSRMFGLE-ECQPLTPDRWLKEGDTISI 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGHV++ +        GD +F+  +GR+D   GD+ QLI+SI +K+
Sbjct: 120 GNVTLQVLHCPGHTPGHVVFFDDRAKLLISGDVIFKGGVGRSDFPRGDHNQLISSIKDKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           LPLGD+++F+ GHGP ST+G ER  NPFL+  +
Sbjct: 180 LPLGDDVTFIPGHGPLSTLGYERLHNPFLQDEM 212


>gi|218704355|ref|YP_002411874.1| putative metal-binding hydrolase [Escherichia coli UMN026]
 gi|293404231|ref|ZP_06648225.1| ycbL protein [Escherichia coli FVEC1412]
 gi|298380012|ref|ZP_06989617.1| ycbL protein [Escherichia coli FVEC1302]
 gi|300901643|ref|ZP_07119703.1| metallo-beta-lactamase domain protein [Escherichia coli MS 198-1]
 gi|301023049|ref|ZP_07186858.1| metallo-beta-lactamase domain protein [Escherichia coli MS 69-1]
 gi|331682436|ref|ZP_08383055.1| putative Metallo-beta-lactamase [Escherichia coli H299]
 gi|218431452|emb|CAR12330.1| putative metal-binding hydrolase [Escherichia coli UMN026]
 gi|284920778|emb|CBG33841.1| conserved hypothetical protein [Escherichia coli 042]
 gi|291428817|gb|EFF01842.1| ycbL protein [Escherichia coli FVEC1412]
 gi|298279710|gb|EFI21218.1| ycbL protein [Escherichia coli FVEC1302]
 gi|300354936|gb|EFJ70806.1| metallo-beta-lactamase domain protein [Escherichia coli MS 198-1]
 gi|300397255|gb|EFJ80793.1| metallo-beta-lactamase domain protein [Escherichia coli MS 69-1]
 gi|323976686|gb|EGB71774.1| metallo-beta-lactamase superfamily protein [Escherichia coli
           TW10509]
 gi|331080067|gb|EGI51246.1| putative Metallo-beta-lactamase [Escherichia coli H299]
          Length = 215

 Score =  195 bits (496), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 87/213 (40%), Positives = 138/213 (64%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++ I+ VT F QNC+ ++ E++  A +VDPGGD + IK  + +    + QI +THGH+D
Sbjct: 1   MNYRIIPVTAFSQNCSLIWCEQTRLAALVDPGGDAEKIKQEVDASGLTLMQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L +   + + GP K+D   +  +  Q+R+  +    +  + DRWL +GDT+ +
Sbjct: 61  HVGAAAELAQHYGVPVFGPEKEDEFWLQGLPAQSRMFGLE-ECQPLTPDRWLNEGDTISI 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGHV++ +        GD +F+  +GR+D   GD+ QLI+SI +K+
Sbjct: 120 GNVALQVLHCPGHTPGHVVFFDDRAKLLISGDVIFKGGVGRSDFPRGDHNQLISSIKDKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           LPLGD+++F+ GHGP ST+G ER  NPFL+  +
Sbjct: 180 LPLGDDVTFIPGHGPLSTLGYERLHNPFLQDEM 212


>gi|260752745|ref|YP_003225638.1| beta-lactamase [Zymomonas mobilis subsp. mobilis NCIMB 11163]
 gi|258552108|gb|ACV75054.1| beta-lactamase domain protein [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
          Length = 227

 Score =  195 bits (496), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 93/213 (43%), Positives = 133/213 (62%), Gaps = 2/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L   ++ VTP +QNC+ L+  E+++  +VDPGGD+ +I D I  +   V++I ITHGH D
Sbjct: 12  LEATVIPVTPLRQNCSLLYCVETMKGAIVDPGGDIPLILDSITKKQVTVEKILITHGHFD 71

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GGAA L + L   IIGPH DD   + ++ E A+         + + D+WL+D D + +
Sbjct: 72  HCGGAAALSQILGCPIIGPHPDDQFWIDQIPENAQQYG--FEGESFTPDQWLKDKDEITV 129

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGH+PGHV++ N  ++ A +GD LFR+SIGR+D   GD+Q LI SI  K+
Sbjct: 130 GEERLLVRHCPGHTPGHVVFYNAASHLAIVGDVLFRNSIGRSDFAGGDHQALIQSITEKL 189

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            P+G E  F+ GHG  ST G ER  NPF+  ++
Sbjct: 190 WPMGRETVFIPGHGRPSTFGAERDHNPFVADSV 222


>gi|161523374|ref|YP_001578386.1| beta-lactamase domain-containing protein [Burkholderia multivorans
           ATCC 17616]
 gi|189351853|ref|YP_001947481.1| hydroxyacylglutathione hydrolase [Burkholderia multivorans ATCC
           17616]
 gi|221214193|ref|ZP_03587165.1| metallo-beta-lactamase family protein [Burkholderia multivorans
           CGD1]
 gi|160340803|gb|ABX13889.1| beta-lactamase domain protein [Burkholderia multivorans ATCC 17616]
 gi|189335875|dbj|BAG44945.1| hydroxyacylglutathione hydrolase [Burkholderia multivorans ATCC
           17616]
 gi|221165848|gb|EED98322.1| metallo-beta-lactamase family protein [Burkholderia multivorans
           CGD1]
          Length = 214

 Score =  195 bits (496), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 92/209 (44%), Positives = 129/209 (61%), Gaps = 1/209 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           ++ VTPF+QNC+ L  E++  A VVDPGGDL+ I+  I  +N  V ++ +THGH+DH  G
Sbjct: 5   LIPVTPFQQNCSLLVCEKTGRAAVVDPGGDLERIEQEIARQNVQVDKVLLTHGHIDHCAG 64

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           A  L     + I GP +D+   + K+  Q+        A     DRWL DGDT+  G   
Sbjct: 65  AKTLATHYGVPIEGPQEDERFWIEKLPTQSERFGFPA-AEAFEPDRWLNDGDTVQFGDET 123

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
            +V+HCPGH+PGHV++ +  +  A +GD LF  SIGRTD   G++  L+ SI  K+ PLG
Sbjct: 124 LEVYHCPGHTPGHVVFFSRAHRVAIVGDVLFAGSIGRTDFPRGNHADLVRSIKEKLWPLG 183

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           D+++FV GHGP ST G ERR NPF+   +
Sbjct: 184 DDVTFVPGHGPVSTFGDERRTNPFVSDKV 212


>gi|333001239|gb|EGK20807.1| metallo-beta-lactamase superfamily protein [Shigella flexneri VA-6]
          Length = 215

 Score =  195 bits (496), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 87/213 (40%), Positives = 138/213 (64%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++ I+ VT F QNC+ ++ E++  A +VDPGGD + IK  +      + QI +THGH+D
Sbjct: 1   MNYRIIPVTAFSQNCSLIWCEQTRLAALVDPGGDAEKIKQEVDDSGLTLMQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L +   + + GP K+D   +  +  Q+R+  +    ++ + DRWL +GDT+ +
Sbjct: 61  HVGAAAELAQHYGVPVFGPEKEDEFWLQGLPAQSRMFGLE-ECQSLTPDRWLNEGDTISI 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGHV++ +        GD +F+  +GR+D   GD+ QLI+SI +K+
Sbjct: 120 GNVTLQVLHCPGHTPGHVVFFDDRAKLLISGDVIFKGGVGRSDFPRGDHNQLISSIKDKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           LPLGD+++F+ GHGP ST+G ER  NPFL+  +
Sbjct: 180 LPLGDDVTFIPGHGPLSTLGYERLHNPFLQDEM 212


>gi|41582327|gb|AAS07941.1| metallo-beta-lactamase family protein [uncultured marine bacterium
           463]
          Length = 216

 Score =  195 bits (496), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 91/208 (43%), Positives = 135/208 (64%), Gaps = 1/208 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           IV VTP++QNC+ +  + S +A +VDPGGD++ I + +   +  V++I +TH H+DH   
Sbjct: 7   IVPVTPYQQNCSIIKCQASGKAAIVDPGGDVERILEAVAKMDATVEKIILTHAHMDHCAA 66

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           A  L++ L +TI GP K D   + K+ E  ++     +A     DRWL+DGDT+ +G   
Sbjct: 67  ADVLRQQLQITIEGPEKADNFWLEKLPEWCKMSGFP-HADAFEPDRWLEDGDTVTVGEQT 125

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
            +V HCPGH+PGHV++++   N A +GD LF+ SIGRTD   G+++ L+ SI  K+ PLG
Sbjct: 126 LQVLHCPGHTPGHVVFLHQAQNVAWVGDVLFQGSIGRTDFPMGNHEDLVASIRGKLFPLG 185

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLKSN 215
           D I+F+ GHGP ST G ERR NPF+  +
Sbjct: 186 DNITFIPGHGPTSTFGEERRSNPFVSDS 213


>gi|326386993|ref|ZP_08208603.1| beta-lactamase-like protein [Novosphingobium nitrogenifigens DSM
           19370]
 gi|326208174|gb|EGD58981.1| beta-lactamase-like protein [Novosphingobium nitrogenifigens DSM
           19370]
          Length = 211

 Score =  195 bits (496), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 89/208 (42%), Positives = 132/208 (63%), Gaps = 2/208 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           I+ VTP +QNCT ++  +++    +D GGDL +++  I      V+++ +THGH+DH GG
Sbjct: 3   IIPVTPLQQNCTLVWCTKTMRGAFIDVGGDLPLLRQAIAKTGVTVEKLLVTHGHIDHCGG 62

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
            A    +L + I GP + D   + K+DE      I         DRWL DGDT+ +G  +
Sbjct: 63  TAAFARELGVPIEGPEEADRFWIAKLDEDGPRYGI--TGEVFEPDRWLHDGDTVTIGECV 120

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
             V HCPGH+PGHV++ +  + FA +GD LF+ SIGRTD   G++QQLI+SI  K+ PLG
Sbjct: 121 LDVLHCPGHTPGHVVFYHAPSRFAIVGDVLFQGSIGRTDFPLGNHQQLIDSITQKLWPLG 180

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLKSN 215
           ++++FV GHGP ST GRER+ NP++  +
Sbjct: 181 NDVTFVPGHGPVSTFGRERQSNPYVADS 208


>gi|172059278|ref|YP_001806930.1| beta-lactamase domain-containing protein [Burkholderia ambifaria
           MC40-6]
 gi|171991795|gb|ACB62714.1| beta-lactamase domain protein [Burkholderia ambifaria MC40-6]
          Length = 214

 Score =  195 bits (495), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 89/209 (42%), Positives = 134/209 (64%), Gaps = 1/209 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           ++ VTPF+QNC+ +  E++  A VVDPGGDL+ I++ I  +N  ++++ +THGH+DH GG
Sbjct: 5   LIPVTPFQQNCSLVVCEKTGRAAVVDPGGDLERIEEEIARQNVQLEKVLLTHGHIDHCGG 64

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           A  L     + I+GP +D+   + ++  Q++       A     D WL DGDT+ +G   
Sbjct: 65  AKALATHYGVPIVGPQEDERFWIEQLPMQSQRFGFPA-AETFEPDHWLNDGDTVQVGDET 123

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
            +V+HCPGH+PGHV++ +  +  A +GD LF  SIGRTD   G++  L+ SI  K+ PLG
Sbjct: 124 LEVYHCPGHTPGHVVFFSRAHRVAIVGDVLFAGSIGRTDFPRGNHADLVRSIKEKLWPLG 183

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           D+++FV GHGP ST G ERR NPF+   +
Sbjct: 184 DDVTFVPGHGPVSTFGDERRTNPFVSDKV 212


>gi|327253717|gb|EGE65346.1| metallo-beta-lactamase superfamily protein [Escherichia coli
           STEC_7v]
          Length = 215

 Score =  195 bits (495), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 87/213 (40%), Positives = 138/213 (64%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++ I+ VT F QNC+ ++ E++  A +VDPGGD + IK  + +    + QI +THGH+D
Sbjct: 1   MNYRIIPVTAFSQNCSLIWCEQTRLAALVDPGGDAEKIKQEVDASGLTLMQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L +   + + GP K+D   +  +  Q+R+  +    +  + DRWL +GDT+ +
Sbjct: 61  HVGAAAELVQHYGVPVFGPEKEDEFWLQGLPAQSRMFGLE-ECQPLTPDRWLNEGDTISI 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGHV++ +        GD +F+  +GR+D   GD+ QLI+SI +K+
Sbjct: 120 GNVTLQVLHCPGHTPGHVVFFDERARLLISGDVIFKGGVGRSDFPRGDHNQLISSIKDKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           LPLGD+++F+ GHGP ST+G ER  NPFL+  +
Sbjct: 180 LPLGDDVTFIPGHGPLSTLGYERLHNPFLQDEM 212


>gi|254516771|ref|ZP_05128829.1| metallo-beta-lactamase superfamily protein [gamma proteobacterium
           NOR5-3]
 gi|219674276|gb|EED30644.1| metallo-beta-lactamase superfamily protein [gamma proteobacterium
           NOR5-3]
          Length = 216

 Score =  195 bits (495), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 92/205 (44%), Positives = 136/205 (66%), Gaps = 1/205 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           IV VT ++QNC+ L  E + +A +VDPGGD+D +   ++     V++I +THGH+DH   
Sbjct: 7   IVPVTAYQQNCSILKCEVTGKAAIVDPGGDIDRVLAAVEQLGASVEKIILTHGHMDHCAA 66

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           +  L++ LS+ I GPH+ D   + K+ E  ++ +  + A     DRWL  GDT+ +G   
Sbjct: 67  SDVLRQQLSVPIEGPHEGDRFWIDKLPEWCKMSNFPI-AEAFEPDRWLVAGDTVTVGAQT 125

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
            +VFHCPGH+PGHV++V+     A +GD +F+ SIGRTD   G++ +LINSI N + PLG
Sbjct: 126 LQVFHCPGHTPGHVVFVHDGQRVAWVGDVIFQGSIGRTDFPKGNHDELINSIRNTLFPLG 185

Query: 188 DEISFVCGHGPNSTIGRERRLNPFL 212
           D+I+F+ GHGP ST GRER+ NPF+
Sbjct: 186 DDITFIPGHGPTSTFGRERQSNPFV 210


>gi|300114071|ref|YP_003760646.1| metallo-beta-lactamase family protein [Nitrosococcus watsonii
           C-113]
 gi|299540008|gb|ADJ28325.1| metallo-beta-lactamase family protein [Nitrosococcus watsonii
           C-113]
          Length = 219

 Score =  195 bits (495), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 91/209 (43%), Positives = 130/209 (62%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + F I+ VT F QNCT L   ES +A VVDPGGD++ I + ++     ++++ +THGH+D
Sbjct: 1   MKFEILPVTRFMQNCTLLSCAESGKAAVVDPGGDVEKILEKVEVNRLKIEKVLLTHGHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GGA +L   L + I GP  +D   +  +  Q+ +       +    DRWL+  DT+  
Sbjct: 61  HAGGAGELAHRLEVPIEGPQIEDEFWINSLPAQSEMFGFP-PVKAFVPDRWLEQRDTVSF 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G  +  V+HCPGH+PGHVI+ + ++  A +GD LF+ SIGRTD   GDY  LI SI  ++
Sbjct: 120 GKVVLNVYHCPGHTPGHVIFFHPDSRLALVGDVLFKGSIGRTDFPRGDYDALIRSIRERL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
            PLGDE+ F+ GHGP ST G ER+ NPF+
Sbjct: 180 FPLGDEVRFIPGHGPMSTFGEERQSNPFV 208


>gi|146311103|ref|YP_001176177.1| beta-lactamase domain-containing protein [Enterobacter sp. 638]
 gi|145317979|gb|ABP60126.1| beta-lactamase domain protein [Enterobacter sp. 638]
          Length = 215

 Score =  195 bits (495), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 86/213 (40%), Positives = 139/213 (65%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++ I+ VT F QNC+ ++ E++  A +VDPGGD + IK  + +    +KQI +THGH+D
Sbjct: 1   MNYRIIPVTAFSQNCSLIWCEQTKLAALVDPGGDAEKIKQEVAASGVTLKQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L +   + +IGP K+D   +  +  Q+R+  +       + DRWL +G+++ +
Sbjct: 61  HVGAAAELAQHYGVPVIGPEKEDEFWLQGLAAQSRMFGLD-ECLPLTPDRWLNEGESVNV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    ++ HCPGH+PGH+++ + ++     GD +F+  +GR+D   GD+ QLI SI  K+
Sbjct: 120 GNVTLQILHCPGHTPGHIVFFDDQSRLLISGDVIFKGGVGRSDFPRGDHGQLIQSIKQKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           LPLGD+++F+ GHGP ST+G ER  NPFL+  I
Sbjct: 180 LPLGDDVTFIAGHGPMSTLGYERLHNPFLQDEI 212


>gi|209695259|ref|YP_002263188.1| Metallo-beta-lactamase [Aliivibrio salmonicida LFI1238]
 gi|208009211|emb|CAQ79467.1| Metallo-beta-lactamase [Aliivibrio salmonicida LFI1238]
          Length = 217

 Score =  195 bits (495), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 91/213 (42%), Positives = 132/213 (61%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L + I+ VT ++QNC+ ++ +E+++ VVVDPGGD+D++K  I + N  V  + +THGH+D
Sbjct: 3   LQYQIIPVTAYEQNCSIVWCDETMKGVVVDPGGDVDLLKQAIDALNIDVVSLVLTHGHLD 62

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVGG   L       IIGPHK+D   +  +  Q++      +      ++WL++GD +  
Sbjct: 63  HVGGTEPLAALTGAPIIGPHKEDEFWLQGLPSQSQRFGFP-HTDAFEPNQWLEEGDIVEF 121

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V H PGH+PGHVI  N E   A +GD LF+ +IGR+D   GDY+ LI SI  K+
Sbjct: 122 GNQALHVLHTPGHTPGHVILFNQEAKMAFVGDVLFKGAIGRSDFPKGDYETLIASIKTKL 181

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            PLG+E+ FV GHGP ST G ER+ NPF+   +
Sbjct: 182 WPLGNEMKFVPGHGPESTFGYERKTNPFVADEL 214


>gi|134294361|ref|YP_001118096.1| beta-lactamase domain-containing protein [Burkholderia
           vietnamiensis G4]
 gi|134137518|gb|ABO53261.1| beta-lactamase domain protein [Burkholderia vietnamiensis G4]
          Length = 214

 Score =  195 bits (495), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 90/209 (43%), Positives = 132/209 (63%), Gaps = 1/209 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           ++ VTPF+QNC+ L  E++  A VVDPGGDL+ I+  I  +N  ++++ +THGHVDH  G
Sbjct: 5   LIPVTPFQQNCSLLVCEKTGRAAVVDPGGDLERIEQEIARQNVQLEKVLLTHGHVDHCAG 64

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           A  L     + I+GP +D+   + ++  Q++       A     D+WL DGDT+  G   
Sbjct: 65  AKALATHYGVPIVGPQEDERFWIEQLPTQSQRFGFPA-AEAFEPDQWLHDGDTVRFGDET 123

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
            +V+HCPGH+PGHV++ +  +  A +GD LF  SIGRTD   G++  L+ SI  K+ PLG
Sbjct: 124 LEVYHCPGHTPGHVVFFSRAHRVAIVGDVLFAGSIGRTDFPRGNHADLVRSIKEKLWPLG 183

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           D+++FV GHGP ST G ERR NPF+   +
Sbjct: 184 DDVTFVPGHGPVSTFGDERRTNPFVSDKV 212


>gi|78064865|ref|YP_367634.1| Beta-lactamase-like [Burkholderia sp. 383]
 gi|77965610|gb|ABB06990.1| Beta-lactamase-like protein [Burkholderia sp. 383]
          Length = 241

 Score =  195 bits (495), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 90/215 (41%), Positives = 132/215 (61%), Gaps = 1/215 (0%)

Query: 2   SKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGH 61
           + +   ++ VTPF+QNC+ L  E++  A VVDPGGDLD I+  +  +N  V+++ +THGH
Sbjct: 26  ASMKVTLIPVTPFQQNCSLLVCEKTGRAAVVDPGGDLDRIEQEVARQNVQVEKVLLTHGH 85

Query: 62  VDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
           +DH  GA  L     + I GP +++   + K+  Q+        A     D WL DGDT+
Sbjct: 86  IDHCAGAKTLATHYGVPIEGPQEEERFWIEKLPMQSERFGFPA-AETFEPDHWLSDGDTV 144

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
             G    +V+HCPGH+PGHV++ +  +  A +GD LF  SIGRTD   G+++ L+ SI  
Sbjct: 145 QFGDETLEVYHCPGHTPGHVVFFSRAHRVAIVGDVLFAGSIGRTDFPRGNHEDLVRSIKE 204

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           K+ PLGD+++FV GHGP ST G ERR NPF+   +
Sbjct: 205 KLWPLGDDVTFVPGHGPVSTFGDERRTNPFVSDKV 239


>gi|157146382|ref|YP_001453701.1| hypothetical protein CKO_02141 [Citrobacter koseri ATCC BAA-895]
 gi|157083587|gb|ABV13265.1| hypothetical protein CKO_02141 [Citrobacter koseri ATCC BAA-895]
          Length = 215

 Score =  195 bits (495), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 86/213 (40%), Positives = 137/213 (64%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++ I+ VT F QNC+ ++ E++  A +VDPGGD   IK  + +    + QI +THGH+D
Sbjct: 1   MNYRIIPVTAFSQNCSLIWCEQTRLAALVDPGGDAQTIKQEVDASGVTLMQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L +   + +IGP K+D   +  +  Q+R+  +    +  + DRWL +GD + +
Sbjct: 61  HVGAAAELAKHYGVPVIGPEKEDEFWLQGLPAQSRMFGLE-ECQPLTPDRWLNEGDRISV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGH+++ +  +     GD +F+  +GR+D   GD+ QLI+SI  K+
Sbjct: 120 GNVTLQVLHCPGHTPGHIVFFDESSRLLISGDVIFKGGVGRSDFPRGDHAQLIDSIKRKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           LPLGD+++F+ GHGP ST+G ER  NPFL+  +
Sbjct: 180 LPLGDDVTFISGHGPMSTLGHERLHNPFLQDEM 212


>gi|261211001|ref|ZP_05925291.1| hydroxyacylglutathione hydrolase [Vibrio sp. RC341]
 gi|260839976|gb|EEX66576.1| hydroxyacylglutathione hydrolase [Vibrio sp. RC341]
          Length = 218

 Score =  195 bits (495), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 92/215 (42%), Positives = 131/215 (60%), Gaps = 2/215 (0%)

Query: 3   KLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHV 62
            L + +V VT F QNC+ ++ +E++E VVVDPGGD+  +  +I      V Q+ +THGH+
Sbjct: 2   SLQYQVVPVTAFAQNCSIVWCDETMEGVVVDPGGDVKQLAMLIAELGVKVTQLVLTHGHL 61

Query: 63  DHVGGAAQLKEDLSLT-IIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
           DHVGG   L E L  T I+GPHK D   +  ++ Q+++    +       D+WL DGD +
Sbjct: 62  DHVGGTEPLAEALGGTRIVGPHKADNFWLQGLEGQSKMFGFPLT-ETFEPDQWLNDGDAV 120

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
             G    +V H PGH+PGHV+  +     A +GD LF  SIGRTD   GD+  LI SI N
Sbjct: 121 TFGKQTLQVIHTPGHTPGHVVLFSESARLAFVGDVLFNGSIGRTDFPQGDFNTLIASIKN 180

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           K+ PLG++++F+ GHGP ST GRER  NP++   +
Sbjct: 181 KLWPLGNDVTFIPGHGPKSTFGRERASNPYVADEM 215


>gi|215486052|ref|YP_002328483.1| predicted metal-binding enzyme [Escherichia coli O127:H6 str.
           E2348/69]
 gi|312969007|ref|ZP_07783214.1| metallo-beta-lactamase superfamily protein [Escherichia coli
           2362-75]
 gi|215264124|emb|CAS08468.1| predicted metal-binding enzyme [Escherichia coli O127:H6 str.
           E2348/69]
 gi|312286409|gb|EFR14322.1| metallo-beta-lactamase superfamily protein [Escherichia coli
           2362-75]
          Length = 215

 Score =  195 bits (495), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 87/213 (40%), Positives = 137/213 (64%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++ I+ VT F QNC+ ++ E++  A +VDPGGD + IK  + +    + QI +THGH+D
Sbjct: 1   MNYRIIPVTAFSQNCSLIWCEQTRLAALVDPGGDAEKIKQEVDASGLTLMQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L +   + + GP K+D   +  +  Q+R+  +    +  + DRWL +GDT+ +
Sbjct: 61  HVGAAAELAQHYGVPVFGPEKEDEFWLQGLPAQSRMFGLE-ECQPLTPDRWLNEGDTISI 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGHV++ +        GD +F+  +GR+D   GD+ QLI SI +K+
Sbjct: 120 GNVTLQVLHCPGHTPGHVVFFDDRAKLLISGDVIFKGGVGRSDFPRGDHNQLIYSIKDKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           LPLGD+++F+ GHGP ST+G ER  NPFL+  +
Sbjct: 180 LPLGDDVTFIPGHGPLSTLGYERLHNPFLQDEM 212


>gi|325496865|gb|EGC94724.1| metal-binding hydrolase [Escherichia fergusonii ECD227]
          Length = 215

 Score =  195 bits (495), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 86/213 (40%), Positives = 139/213 (65%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++ I+ VT F QNC+ ++ E++  A +VDPGGD + IK  + +    + QI +THGH+D
Sbjct: 1   MNYRIIPVTAFSQNCSLIWCEQTRLAALVDPGGDAEKIKQEVDASGLTLMQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L +   + ++GP K+D   +  +  Q+R+  +    +  + DRWL +GDT+ +
Sbjct: 61  HVGAAAELAQHYGVPVLGPEKEDEFWLQGLPAQSRMFGLD-ECQPLTPDRWLNEGDTISI 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGHV++ + +      GD +F+  +GR+D   GD+ QLI +I +K+
Sbjct: 120 GNVTLQVLHCPGHTPGHVVFFDDQAKLLISGDVIFKGGVGRSDFPRGDHNQLIAAIKDKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           LPLGD+++F+ GHGP ST+G ER  NPFL+  +
Sbjct: 180 LPLGDDVTFIPGHGPLSTLGYERLHNPFLQDEM 212


>gi|284007572|emb|CBA73118.1| metallo-beta-lactamase superfamily protein [Arsenophonus nasoniae]
          Length = 210

 Score =  194 bits (494), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 90/210 (42%), Positives = 134/210 (63%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + F I+ VT F+QNCT ++DE SL+AV+VDPGG+   +   I+ R+ ++  I +THGH D
Sbjct: 1   MKFKIIPVTDFRQNCTLIWDENSLDAVIVDPGGEAAKLIAEIEKRSLNLHYILLTHGHFD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG  A++    S+ I GP K+D  ++  +  Q+++  +     + + DR+LQ+GD +  
Sbjct: 61  HVGACAEIAAHFSVPIYGPQKEDEFLIKGLAVQSQMFGV-AQCPDFTPDRYLQEGDEIRF 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
                 V HCPGH+PGH+I+VN  +    +GD LF+ S+GRTD   GD+  LI+SI  KI
Sbjct: 120 ADIKLSVLHCPGHTPGHIIFVNHADKLISMGDVLFQGSVGRTDFPQGDHATLIHSIKTKI 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           LPLGD+  F+ GHG  S +  ER+ NPFL+
Sbjct: 180 LPLGDDYQFIPGHGAMSNLAAERQFNPFLQ 209


>gi|170727296|ref|YP_001761322.1| beta-lactamase domain-containing protein [Shewanella woodyi ATCC
           51908]
 gi|169812643|gb|ACA87227.1| beta-lactamase domain protein [Shewanella woodyi ATCC 51908]
          Length = 214

 Score =  194 bits (494), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 88/213 (41%), Positives = 140/213 (65%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + I+ VTPF+QNC+ ++ +E+++A V+DPGGD+D I   ++     ++++++THGH+D
Sbjct: 1   MKYQIIPVTPFQQNCSLVWCDETMKAAVIDPGGDIDRILSEVKKLGVSLEKVFLTHGHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVGGA QL E L++ IIGPHK D   +  + EQ++   ++      +S ++L+DGD++ +
Sbjct: 61  HVGGAKQLSEQLNIPIIGPHKADIFWLDNLVEQSQHFGLKA-CEPFTSTQYLEDGDSVTI 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGHV++   +   A +GD LF  S+GRTD    ++  LI SI  K+
Sbjct: 120 GNLTLQVLHCPGHTPGHVVFFCEKAKTAWVGDVLFHGSVGRTDFPQSNHDDLILSITKKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            PLG ++ F+ GHGP ST G ER  NPF+   +
Sbjct: 180 WPLGRDVEFIPGHGPISTFGSERDQNPFVADQL 212


>gi|24112336|ref|NP_706846.1| hypothetical protein SF0924 [Shigella flexneri 2a str. 301]
 gi|30062462|ref|NP_836633.1| hypothetical protein S0988 [Shigella flexneri 2a str. 2457T]
 gi|74311485|ref|YP_309904.1| hypothetical protein SSON_0930 [Shigella sonnei Ss046]
 gi|82544669|ref|YP_408616.1| hypothetical protein SBO_2218 [Shigella boydii Sb227]
 gi|110804936|ref|YP_688456.1| hypothetical protein SFV_0929 [Shigella flexneri 5 str. 8401]
 gi|157156504|ref|YP_001462146.1| metallo-beta-lactamase family protein [Escherichia coli E24377A]
 gi|157160448|ref|YP_001457766.1| metallo-beta-lactamase family protein [Escherichia coli HS]
 gi|170020671|ref|YP_001725625.1| beta-lactamase domain-containing protein [Escherichia coli ATCC
           8739]
 gi|191166968|ref|ZP_03028791.1| metallo-beta-lactamase family protein [Escherichia coli B7A]
 gi|193064648|ref|ZP_03045727.1| metallo-beta-lactamase family protein [Escherichia coli E22]
 gi|193070749|ref|ZP_03051684.1| metallo-beta-lactamase family protein [Escherichia coli E110019]
 gi|194428338|ref|ZP_03060879.1| metallo-beta-lactamase family protein [Escherichia coli B171]
 gi|209918177|ref|YP_002292261.1| hypothetical protein ECSE_0986 [Escherichia coli SE11]
 gi|218553514|ref|YP_002386427.1| putative metal-binding hydrolase [Escherichia coli IAI1]
 gi|218694401|ref|YP_002402068.1| putative metal-binding hydrolase [Escherichia coli 55989]
 gi|256020945|ref|ZP_05434810.1| putative metal-binding hydrolase [Shigella sp. D9]
 gi|260843176|ref|YP_003220954.1| putative metal-binding enzyme [Escherichia coli O103:H2 str. 12009]
 gi|260854218|ref|YP_003228109.1| putative metal-binding enzyme [Escherichia coli O26:H11 str. 11368]
 gi|260867099|ref|YP_003233501.1| putative metal-binding enzyme [Escherichia coli O111:H- str. 11128]
 gi|293414207|ref|ZP_06656856.1| ycbL protein [Escherichia coli B185]
 gi|293433224|ref|ZP_06661652.1| ycbL protein [Escherichia coli B088]
 gi|300816968|ref|ZP_07097187.1| metallo-beta-lactamase domain protein [Escherichia coli MS 107-1]
 gi|300823667|ref|ZP_07103794.1| metallo-beta-lactamase domain protein [Escherichia coli MS 119-7]
 gi|300902914|ref|ZP_07120859.1| metallo-beta-lactamase domain protein [Escherichia coli MS 84-1]
 gi|300921035|ref|ZP_07137422.1| metallo-beta-lactamase domain protein [Escherichia coli MS 115-1]
 gi|300925395|ref|ZP_07141280.1| metallo-beta-lactamase domain protein [Escherichia coli MS 182-1]
 gi|301302463|ref|ZP_07208594.1| metallo-beta-lactamase domain protein [Escherichia coli MS 124-1]
 gi|301326641|ref|ZP_07219971.1| metallo-beta-lactamase domain protein [Escherichia coli MS 78-1]
 gi|307311686|ref|ZP_07591326.1| conserved hypothetical protein [Escherichia coli W]
 gi|309795087|ref|ZP_07689507.1| metallo-beta-lactamase domain protein [Escherichia coli MS 145-7]
 gi|331651947|ref|ZP_08352966.1| putative Metallo-beta-lactamase [Escherichia coli M718]
 gi|331667305|ref|ZP_08368170.1| putative Metallo-beta-lactamase [Escherichia coli TA271]
 gi|331676715|ref|ZP_08377411.1| putative Metallo-beta-lactamase [Escherichia coli H591]
 gi|332282168|ref|ZP_08394581.1| metal-binding enzyme [Shigella sp. D9]
 gi|24051200|gb|AAN42553.1| orf, conserved hypothetical protein [Shigella flexneri 2a str. 301]
 gi|30040708|gb|AAP16439.1| hypothetical protein S0988 [Shigella flexneri 2a str. 2457T]
 gi|73854962|gb|AAZ87669.1| conserved hypothetical protein [Shigella sonnei Ss046]
 gi|81246080|gb|ABB66788.1| conserved hypothetical protein [Shigella boydii Sb227]
 gi|110614484|gb|ABF03151.1| conserved hypothetical protein [Shigella flexneri 5 str. 8401]
 gi|157066128|gb|ABV05383.1| metallo-beta-lactamase family protein [Escherichia coli HS]
 gi|157078534|gb|ABV18242.1| metallo-beta-lactamase family protein [Escherichia coli E24377A]
 gi|169755599|gb|ACA78298.1| beta-lactamase domain protein [Escherichia coli ATCC 8739]
 gi|190902962|gb|EDV62688.1| metallo-beta-lactamase family protein [Escherichia coli B7A]
 gi|192927705|gb|EDV82320.1| metallo-beta-lactamase family protein [Escherichia coli E22]
 gi|192955942|gb|EDV86410.1| metallo-beta-lactamase family protein [Escherichia coli E110019]
 gi|194413553|gb|EDX29834.1| metallo-beta-lactamase family protein [Escherichia coli B171]
 gi|209911436|dbj|BAG76510.1| conserved hypothetical protein [Escherichia coli SE11]
 gi|218351133|emb|CAU96837.1| putative metal-binding hydrolase [Escherichia coli 55989]
 gi|218360282|emb|CAQ97832.1| putative metal-binding hydrolase [Escherichia coli IAI1]
 gi|257752867|dbj|BAI24369.1| predicted metal-binding enzyme [Escherichia coli O26:H11 str.
           11368]
 gi|257758323|dbj|BAI29820.1| predicted metal-binding enzyme [Escherichia coli O103:H2 str.
           12009]
 gi|257763455|dbj|BAI34950.1| predicted metal-binding enzyme [Escherichia coli O111:H- str.
           11128]
 gi|281600287|gb|ADA73271.1| Beta-lactamase domain protein [Shigella flexneri 2002017]
 gi|291324043|gb|EFE63465.1| ycbL protein [Escherichia coli B088]
 gi|291434265|gb|EFF07238.1| ycbL protein [Escherichia coli B185]
 gi|300405056|gb|EFJ88594.1| metallo-beta-lactamase domain protein [Escherichia coli MS 84-1]
 gi|300412026|gb|EFJ95336.1| metallo-beta-lactamase domain protein [Escherichia coli MS 115-1]
 gi|300418465|gb|EFK01776.1| metallo-beta-lactamase domain protein [Escherichia coli MS 182-1]
 gi|300523867|gb|EFK44936.1| metallo-beta-lactamase domain protein [Escherichia coli MS 119-7]
 gi|300530320|gb|EFK51382.1| metallo-beta-lactamase domain protein [Escherichia coli MS 107-1]
 gi|300842302|gb|EFK70062.1| metallo-beta-lactamase domain protein [Escherichia coli MS 124-1]
 gi|300846686|gb|EFK74446.1| metallo-beta-lactamase domain protein [Escherichia coli MS 78-1]
 gi|306908241|gb|EFN38740.1| conserved hypothetical protein [Escherichia coli W]
 gi|308121391|gb|EFO58653.1| metallo-beta-lactamase domain protein [Escherichia coli MS 145-7]
 gi|313650831|gb|EFS15232.1| metallo-beta-lactamase superfamily protein [Shigella flexneri 2a
           str. 2457T]
 gi|315060212|gb|ADT74539.1| predicted metal-binding enzyme [Escherichia coli W]
 gi|315257968|gb|EFU37936.1| metallo-beta-lactamase domain protein [Escherichia coli MS 85-1]
 gi|320177118|gb|EFW52133.1| hypothetical protein SDB_00381 [Shigella dysenteriae CDC 74-1112]
 gi|320183826|gb|EFW58659.1| hypothetical protein SGF_03998 [Shigella flexneri CDC 796-83]
 gi|320202323|gb|EFW76894.1| hypothetical protein ECoL_00369 [Escherichia coli EC4100B]
 gi|323157186|gb|EFZ43309.1| metallo-beta-lactamase superfamily protein [Escherichia coli
           EPECa14]
 gi|323159554|gb|EFZ45534.1| metallo-beta-lactamase superfamily protein [Escherichia coli
           E128010]
 gi|323165400|gb|EFZ51187.1| metallo-beta-lactamase superfamily protein [Shigella sonnei 53G]
 gi|323175450|gb|EFZ61045.1| metallo-beta-lactamase superfamily protein [Escherichia coli 1180]
 gi|323185367|gb|EFZ70731.1| metallo-beta-lactamase superfamily protein [Escherichia coli 1357]
 gi|323379228|gb|ADX51496.1| hypothetical protein EKO11_2903 [Escherichia coli KO11]
 gi|323947284|gb|EGB43292.1| metallo-beta-lactamase superfamily protein [Escherichia coli H120]
 gi|324019064|gb|EGB88283.1| metallo-beta-lactamase domain protein [Escherichia coli MS 117-3]
 gi|324117208|gb|EGC11116.1| metallo-beta-lactamase superfamily protein [Escherichia coli E1167]
 gi|331050225|gb|EGI22283.1| putative Metallo-beta-lactamase [Escherichia coli M718]
 gi|331065661|gb|EGI37554.1| putative Metallo-beta-lactamase [Escherichia coli TA271]
 gi|331075404|gb|EGI46702.1| putative Metallo-beta-lactamase [Escherichia coli H591]
 gi|332093371|gb|EGI98429.1| metallo-beta-lactamase superfamily protein [Shigella boydii
           3594-74]
 gi|332104520|gb|EGJ07866.1| metal-binding enzyme [Shigella sp. D9]
 gi|332342369|gb|AEE55703.1| putative metal-binding hydrolase YcbL [Escherichia coli UMNK88]
 gi|332759015|gb|EGJ89325.1| metallo-beta-lactamase superfamily protein [Shigella flexneri
           4343-70]
 gi|332760072|gb|EGJ90370.1| metallo-beta-lactamase superfamily protein [Shigella flexneri
           2747-71]
 gi|332762699|gb|EGJ92962.1| metallo-beta-lactamase superfamily protein [Shigella flexneri
           K-671]
 gi|332767714|gb|EGJ97905.1| metallo-beta-lactamase superfamily protein [Shigella flexneri
           2930-71]
 gi|333006240|gb|EGK25749.1| metallo-beta-lactamase superfamily protein [Shigella flexneri
           K-218]
 gi|333020077|gb|EGK39348.1| metallo-beta-lactamase superfamily protein [Shigella flexneri
           K-304]
          Length = 215

 Score =  194 bits (494), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 87/213 (40%), Positives = 137/213 (64%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++ I+ VT F QNC+ ++ E++  A +VDPGGD + IK  +      + QI +THGH+D
Sbjct: 1   MNYRIIPVTAFSQNCSLIWCEQTRLAALVDPGGDAEKIKQEVDDSGLTLMQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L +   + + GP K+D   +  +  Q+R+  +    +  + DRWL +GDT+ +
Sbjct: 61  HVGAAAELAQHYGVPVFGPEKEDEFWLQGLPAQSRMFGLE-ECQPLTPDRWLNEGDTISI 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGHV++ +        GD +F+  +GR+D   GD+ QLI+SI +K+
Sbjct: 120 GNVTLQVLHCPGHTPGHVVFFDDRAKLLISGDVIFKGGVGRSDFPRGDHNQLISSIKDKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           LPLGD+++F+ GHGP ST+G ER  NPFL+  +
Sbjct: 180 LPLGDDVTFIPGHGPLSTLGYERLHNPFLQDEM 212


>gi|117620793|ref|YP_856746.1| metallo-beta-lactamase family protein [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
 gi|117562200|gb|ABK39148.1| metallo-beta-lactamase family protein [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
          Length = 214

 Score =  194 bits (494), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 90/213 (42%), Positives = 134/213 (62%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L F ++ VT F QNC+ ++ +E+ +A ++DPGG+ D +   I  R   +  I +THGH+D
Sbjct: 2   LKFEVIPVTQFAQNCSLIWCDETHQAALIDPGGEADKLLAAIAKRGLTLTHILLTHGHLD 61

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L+E   + I GPHK+DA  +  + +Q+++     +    + D WL+ GD + +
Sbjct: 62  HVGAAAELREKTGVAITGPHKEDAFWLDMLPQQSQMFGF-AHTPAFTPDHWLEQGDKVKV 120

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V+ CPGH+PGHV+ ++     A +GD LF  SIGRTD   GD+  LI SI   +
Sbjct: 121 GQCELEVYFCPGHTPGHVVLLSQTERLAWVGDVLFAGSIGRTDFPRGDHGTLIKSITETL 180

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           LPLGD+I F+ GHGP+ST GRE+  NP+L   I
Sbjct: 181 LPLGDDIVFIPGHGPSSTFGREQASNPYLTQPI 213


>gi|323190747|gb|EFZ76016.1| metallo-beta-lactamase superfamily protein [Escherichia coli
           RN587/1]
          Length = 215

 Score =  194 bits (494), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 86/213 (40%), Positives = 138/213 (64%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++ I+ VT F QNC+ ++ E++  A +VDPGGD + IK  + +    + QI +THGH+D
Sbjct: 1   MNYRIIPVTAFSQNCSLIWCEQTRLAALVDPGGDAEKIKQEVDASGLTLMQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L +   + + GP K+D   +  +  Q+R+  +    +  + DRWL +GDT+ +
Sbjct: 61  HVGAAAELAQHYGVPVFGPEKEDEFWLQGLPAQSRMFGLE-ECQPLTPDRWLNEGDTISI 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    ++ HCPGH+PGHV++ +        GD +F+  +GR+D   GD+ QLI+SI +K+
Sbjct: 120 GNVTLQMLHCPGHTPGHVVFFDDRAKLLISGDVIFKGGVGRSDFPRGDHNQLISSIKDKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           LPLGD+++F+ GHGP ST+G ER  NPFL+  +
Sbjct: 180 LPLGDDVTFIPGHGPLSTLGYERLHNPFLQDEM 212


>gi|323174972|gb|EFZ60587.1| metallo-beta-lactamase superfamily protein [Escherichia coli LT-68]
          Length = 215

 Score =  194 bits (494), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 87/213 (40%), Positives = 137/213 (64%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++ I+ VT F QNC+ ++ E++  A +VDPGGD + IK  +      + QI +THGH+D
Sbjct: 1   MNYRIIPVTAFSQNCSLIWCEQTRLAALVDPGGDAEKIKQEVDDSGLTLMQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L +   + + GP K+D   +  +  Q+R+  +    +  + DRWL +GDT+ +
Sbjct: 61  HVGAAAELAQHYGVPVFGPEKEDEFWLQGLPAQSRMFDLE-ECQPLTPDRWLNEGDTISI 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGHV++ +        GD +F+  +GR+D   GD+ QLI+SI +K+
Sbjct: 120 GNVTLQVLHCPGHTPGHVVFFDDRAKLLISGDVIFKGGVGRSDFPRGDHNQLISSIKDKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           LPLGD+++F+ GHGP ST+G ER  NPFL+  +
Sbjct: 180 LPLGDDVTFIPGHGPLSTLGYERLHNPFLQDEM 212


>gi|206558563|ref|YP_002229323.1| metallo-beta-lactamase superfamily protein [Burkholderia
           cenocepacia J2315]
 gi|198034600|emb|CAR50466.1| metallo-beta-lactamase superfamily protein [Burkholderia
           cenocepacia J2315]
          Length = 214

 Score =  194 bits (493), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 90/209 (43%), Positives = 132/209 (63%), Gaps = 1/209 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           ++ VTPF+QNC+ L  E++  A VVDPGGDLD I+  +  +N  V+++ +THGH+DH  G
Sbjct: 5   LIPVTPFQQNCSLLVCEKTGRAAVVDPGGDLDRIEQEVARQNVQVEKVLLTHGHIDHCAG 64

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           A  L     + I GP +++   + K+  Q+        A +   D+WL DGDT+  G   
Sbjct: 65  AKTLATHYGVPIEGPQEEERFWIEKLPMQSERFGFPA-ADSFEPDQWLNDGDTVRFGDET 123

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
            +V+HCPGH+PGHV++ +  +  A +GD LF  SIGRTD   G+++ L+ SI  K+ PLG
Sbjct: 124 LEVYHCPGHTPGHVVFFSRAHRIAIVGDVLFAGSIGRTDFPRGNHEDLVRSIKEKLWPLG 183

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           D+++FV GHGP ST G ERR NPF+   +
Sbjct: 184 DDVTFVPGHGPVSTFGDERRTNPFVSDKV 212


>gi|254481006|ref|ZP_05094252.1| metallo-beta-lactamase domain protein, putative [marine gamma
           proteobacterium HTCC2148]
 gi|214038801|gb|EEB79462.1| metallo-beta-lactamase domain protein, putative [marine gamma
           proteobacterium HTCC2148]
          Length = 216

 Score =  194 bits (493), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 91/208 (43%), Positives = 134/208 (64%), Gaps = 1/208 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           IV VTP++QNC+ +  + S +A +VDPGGD++ I + +   +  V++I +TH H+DH   
Sbjct: 7   IVPVTPYQQNCSIIKCQASGKAAIVDPGGDVERILEAVAKMDATVEKIILTHAHMDHCAA 66

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           A  L++ L +TI GP K D   + K+ E  ++     +A     DRWL DGDT+ +G   
Sbjct: 67  ADVLRQQLQITIEGPEKADNFWLEKLPEWCKMSGFP-HADAFEPDRWLADGDTVTVGEQT 125

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
            +V HCPGH+PGHV++++   N A +GD LF+ SIGRTD   G+++ L+ SI  K+ PLG
Sbjct: 126 LQVLHCPGHTPGHVVFLHQAQNVAWVGDVLFQGSIGRTDFPMGNHEDLVASIRGKLFPLG 185

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLKSN 215
           D I+F+ GHGP ST G ERR NPF+  +
Sbjct: 186 DNITFIPGHGPTSTFGEERRSNPFVSDS 213


>gi|171320219|ref|ZP_02909278.1| beta-lactamase domain protein [Burkholderia ambifaria MEX-5]
 gi|171094540|gb|EDT39595.1| beta-lactamase domain protein [Burkholderia ambifaria MEX-5]
          Length = 214

 Score =  194 bits (493), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 90/209 (43%), Positives = 132/209 (63%), Gaps = 1/209 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           ++ VTPF+QNC+ +  E++  A VVDPGGDL+ I+  I  +N  V+++ +THGHVDH  G
Sbjct: 5   LIPVTPFQQNCSLVVCEKTGRAAVVDPGGDLERIEQEIARQNVQVEKVLLTHGHVDHCAG 64

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           A  L     + I+GP +D+   + ++  Q++       A     D WL DGDT+ +G   
Sbjct: 65  AKALATHYGVPIVGPQEDERFWIEQLPMQSQRFGFPA-AETFEPDHWLNDGDTVQVGDET 123

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
            +V+HCPGH+PGHV++ +  +  A +GD LF  SIGRTD   G++  L+ SI  K+ PLG
Sbjct: 124 LEVYHCPGHTPGHVVFFSRAHRVAIVGDVLFAGSIGRTDFPRGNHADLVRSIKEKLWPLG 183

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           D+++FV GHGP ST G ERR NPF+   +
Sbjct: 184 DDVTFVPGHGPVSTFGDERRTNPFVSDKV 212


>gi|261339261|ref|ZP_05967119.1| hypothetical protein ENTCAN_05497 [Enterobacter cancerogenus ATCC
           35316]
 gi|288319118|gb|EFC58056.1| metallo-beta-lactamase family protein [Enterobacter cancerogenus
           ATCC 35316]
          Length = 215

 Score =  194 bits (492), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 86/213 (40%), Positives = 138/213 (64%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++ I+ VT F QNC+ ++ E++  A +VDPGGD + IK  + +    + QI +THGH+D
Sbjct: 1   MNYRIIPVTAFSQNCSLIWCEQTKLAALVDPGGDAEKIKQEVAASGVTLMQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L +   + +IGP K+D   +  +  Q+R+  +    +  + DRWL +GD + +
Sbjct: 61  HVGAAAELAQHYGVPVIGPEKEDEFWLEGLPAQSRMFGLD-ECQPLTPDRWLNEGDRVSV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGH+++ + ++     GD +F+  +GR+D   GD+ QLI SI  K+
Sbjct: 120 GNVTLQVLHCPGHTPGHIVFFDDQSRLLISGDVIFKGGVGRSDFPRGDHGQLIQSIKQKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           LPLGD+++F+ GHGP ST+G ER  NPFL+  +
Sbjct: 180 LPLGDDVTFIPGHGPMSTLGYERLHNPFLQDEM 212


>gi|238757637|ref|ZP_04618821.1| hypothetical protein yaldo0001_19580 [Yersinia aldovae ATCC 35236]
 gi|238704142|gb|EEP96675.1| hypothetical protein yaldo0001_19580 [Yersinia aldovae ATCC 35236]
          Length = 225

 Score =  194 bits (492), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 87/214 (40%), Positives = 135/214 (63%), Gaps = 1/214 (0%)

Query: 2   SKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGH 61
           S + + I+ VT F QNCT ++ E + +A +VDPGG+   I   +  +   V QI +THGH
Sbjct: 9   SFMKYQIIPVTAFSQNCTLIWCEATGQAALVDPGGEAAKIIAEVARQGVTVNQILLTHGH 68

Query: 62  VDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
           +DHVG AA+L     + I GP K+D   +  +  Q+++  +       +  RWL++GD +
Sbjct: 69  LDHVGAAAELAAHFQIPIYGPEKEDTFWLEGLPAQSQMFGL-TECDAFTPTRWLEEGDKI 127

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
           ++G     V HCPGH+PGH+++++ +   A +GD +F   +GR+D   GD+QQLI SI  
Sbjct: 128 IVGDIELSVLHCPGHTPGHIVFIDQKGRLALVGDVIFNGGVGRSDFPRGDHQQLITSIRT 187

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFLKSN 215
           K+LPLGD+++F+ GHGP STIG ER+ NPF++  
Sbjct: 188 KLLPLGDDMTFIPGHGPMSTIGHERQTNPFIREE 221


>gi|107024365|ref|YP_622692.1| beta-lactamase-like [Burkholderia cenocepacia AU 1054]
 gi|105894554|gb|ABF77719.1| beta-lactamase-like protein [Burkholderia cenocepacia AU 1054]
          Length = 237

 Score =  194 bits (492), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 90/215 (41%), Positives = 133/215 (61%), Gaps = 1/215 (0%)

Query: 2   SKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGH 61
           + +   ++ VTPF+QNC+ L  E++  A VVDPGGDLD I+  +  +N  V+++ +THGH
Sbjct: 22  APMKVTLIPVTPFQQNCSLLVCEKTGRAAVVDPGGDLDRIEQEVARQNVQVEKVLLTHGH 81

Query: 62  VDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
           +DH  GA  L     + I GP +++   + K+  Q+        A     D+WL DGDT+
Sbjct: 82  IDHCAGAKTLATRYGVPIEGPQEEERFWIEKLPMQSERFGFPA-ADVFEPDQWLNDGDTV 140

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
             G    +V+HCPGH+PGHV++ +  +  A +GD LF  SIGRTD   G+++ L+ SI  
Sbjct: 141 RFGDETLEVYHCPGHTPGHVVFFSRAHRVAIVGDVLFAGSIGRTDFPRGNHEDLVRSIKE 200

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           K+ PLGD+++FV GHGP ST G ERR NPF+   +
Sbjct: 201 KLWPLGDDVTFVPGHGPVSTFGDERRTNPFVSDKV 235


>gi|187730154|ref|YP_001880872.1| metallo-beta-lactamase family protein [Shigella boydii CDC 3083-94]
 gi|187427146|gb|ACD06420.1| metallo-beta-lactamase family protein [Shigella boydii CDC 3083-94]
          Length = 215

 Score =  194 bits (492), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 87/213 (40%), Positives = 137/213 (64%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++ I+ VT F QNC+ ++ E++  A +VDPGGD + IK  +      + QI +THGH+D
Sbjct: 1   MNYRIIPVTAFSQNCSLIWCEQTRLAALVDPGGDAEKIKQEVDDSGLTLMQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L +   + + GP K+D   +  +  Q+R+  +    +  + DRWL +GDT+ +
Sbjct: 61  HVGAAAELAQHYGVPVFGPEKEDEFWLQGLPVQSRMFGLE-ECQPLTPDRWLNEGDTISI 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGHV++ +        GD +F+  +GR+D   GD+ QLI+SI +K+
Sbjct: 120 GNVTLQVLHCPGHTPGHVVFFDDRAKLLISGDVIFKGGVGRSDFPRGDHNQLISSIKDKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           LPLGD+++F+ GHGP ST+G ER  NPFL+  +
Sbjct: 180 LPLGDDVTFIPGHGPLSTLGYERLHNPFLQDEM 212


>gi|168822070|ref|ZP_02834070.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|205341513|gb|EDZ28277.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|320085240|emb|CBY95025.1| Hydroxyacylglutathione hydrolase Glyoxalase II; Glx II [Salmonella
           enterica subsp. enterica serovar Weltevreden str.
           2007-60-3289-1]
          Length = 215

 Score =  194 bits (492), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 86/213 (40%), Positives = 139/213 (65%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++ I+ VT F QNC+ ++ E++  A +VDPGGD + IK  + +    + QI +THGH+D
Sbjct: 1   MNYRIIPVTAFSQNCSLIWCEQTRLAALVDPGGDAEKIKQEVDASGVTLMQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG A++L +   + +IGP K+D   +  +  Q+R+  +    +  + DRWL DGD + +
Sbjct: 61  HVGAASELAQYYGVPVIGPEKEDEFWLQGLPAQSRMFGLD-ECQPLTPDRWLNDGDRVSV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGHV++ + ++     GD +F+  +GR+D   GD+ QLI++I  K+
Sbjct: 120 GNVTLQVLHCPGHTPGHVVFFDEQSQLLISGDVIFKGGVGRSDFPRGDHTQLIDAIKRKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           LPLGD+++F+ GHGP ST+G ER  NPFL+  +
Sbjct: 180 LPLGDDVTFIPGHGPLSTLGYERLHNPFLQDEM 212


>gi|16764357|ref|NP_459972.1| metallo-beta-lactamase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|62179524|ref|YP_215941.1| hypothetical protein SC0954 [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|161614764|ref|YP_001588729.1| hypothetical protein SPAB_02516 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|167553001|ref|ZP_02346751.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
 gi|167994948|ref|ZP_02576038.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|168233418|ref|ZP_02658476.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|168237102|ref|ZP_02662160.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|168243766|ref|ZP_02668698.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|168264665|ref|ZP_02686638.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
 gi|168466592|ref|ZP_02700454.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|194446110|ref|YP_002040195.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194450083|ref|YP_002044989.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|194471636|ref|ZP_03077620.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|194737484|ref|YP_002114050.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|197247583|ref|YP_002145915.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|197261729|ref|ZP_03161803.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|198246004|ref|YP_002214921.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|200391125|ref|ZP_03217736.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|204929977|ref|ZP_03220998.1| metallo-beta-lactamase family protein [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
 gi|205352204|ref|YP_002226005.1| hypothetical protein SG0939 [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|207856388|ref|YP_002243039.1| hypothetical protein SEN0901 [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|224582807|ref|YP_002636605.1| hypothetical protein SPC_0998 [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|16419510|gb|AAL19931.1| putative metallo-beta-lactamase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|62127157|gb|AAX64860.1| putative Metallo-beta-lactamase [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|161364128|gb|ABX67896.1| hypothetical protein SPAB_02516 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194404773|gb|ACF64995.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194408387|gb|ACF68606.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|194458000|gb|EDX46839.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|194712986|gb|ACF92207.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|195630915|gb|EDX49501.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|197211286|gb|ACH48683.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|197239984|gb|EDY22604.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|197289784|gb|EDY29145.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|197940520|gb|ACH77853.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|199603570|gb|EDZ02116.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|204320971|gb|EDZ06172.1| metallo-beta-lactamase family protein [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
 gi|205271985|emb|CAR36829.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|205322462|gb|EDZ10301.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
 gi|205327282|gb|EDZ14046.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|205332464|gb|EDZ19228.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|205337128|gb|EDZ23892.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|205346901|gb|EDZ33532.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
 gi|206708191|emb|CAR32484.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|224467334|gb|ACN45164.1| hypothetical protein SPC_0998 [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|261246213|emb|CBG24017.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. D23580]
 gi|267992736|gb|ACY87621.1| putative metallo-beta-lactamase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 14028S]
 gi|301157540|emb|CBW17030.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. SL1344]
 gi|312911983|dbj|BAJ35957.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. T000240]
 gi|321223321|gb|EFX48390.1| Hypothetical metal-binding enzyme [Salmonella enterica subsp.
           enterica serovar Typhimurium str. TN061786]
 gi|322616427|gb|EFY13336.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315996572]
 gi|322619677|gb|EFY16552.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-1]
 gi|322622627|gb|EFY19472.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-3]
 gi|322629776|gb|EFY26551.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-4]
 gi|322632502|gb|EFY29248.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-1]
 gi|322637003|gb|EFY33706.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-2]
 gi|322641458|gb|EFY38096.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 531954]
 gi|322646076|gb|EFY42592.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. NC_MB110209-0054]
 gi|322649622|gb|EFY46053.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. OH_2009072675]
 gi|322654077|gb|EFY50400.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. CASC_09SCPH15965]
 gi|322658609|gb|EFY54871.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 19N]
 gi|322663466|gb|EFY59668.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 81038-01]
 gi|322670202|gb|EFY66342.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MD_MDA09249507]
 gi|322671438|gb|EFY67560.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 414877]
 gi|322676794|gb|EFY72861.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 366867]
 gi|322682718|gb|EFY78737.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 413180]
 gi|322686398|gb|EFY82380.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 446600]
 gi|322713992|gb|EFZ05563.1| putative metallo-beta-lactamase [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. A50]
 gi|323129262|gb|ADX16692.1| putative metallo-beta-lactamase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 4/74]
 gi|323195921|gb|EFZ81088.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609458-1]
 gi|323199791|gb|EFZ84880.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556150-1]
 gi|323202784|gb|EFZ87820.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609460]
 gi|323209055|gb|EFZ93992.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 507440-20]
 gi|323209976|gb|EFZ94883.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556152]
 gi|323217985|gb|EGA02700.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB101509-0077]
 gi|323219021|gb|EGA03528.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB102109-0047]
 gi|323226590|gb|EGA10795.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB110209-0055]
 gi|323229786|gb|EGA13909.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB111609-0052]
 gi|323233011|gb|EGA17107.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009083312]
 gi|323240746|gb|EGA24788.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009085258]
 gi|323243062|gb|EGA27083.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315731156]
 gi|323249775|gb|EGA33677.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2009159199]
 gi|323252752|gb|EGA36590.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008282]
 gi|323259166|gb|EGA42810.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008283]
 gi|323259989|gb|EGA43617.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008284]
 gi|323268010|gb|EGA51489.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008285]
 gi|323269858|gb|EGA53307.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008287]
 gi|326622674|gb|EGE29019.1| putative metallo-beta-lactamase [Salmonella enterica subsp.
           enterica serovar Dublin str. 3246]
 gi|326627248|gb|EGE33591.1| putative metallo-beta-lactamase [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 9]
 gi|332987888|gb|AEF06871.1| putative metallo-beta-lactamase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. UK-1]
          Length = 215

 Score =  194 bits (492), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 86/213 (40%), Positives = 139/213 (65%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++ I+ VT F QNC+ ++ E++  A +VDPGGD + IK  + +    + QI +THGH+D
Sbjct: 1   MNYRIIPVTAFSQNCSLIWCEQTRLAALVDPGGDAEKIKQEVDASGVTLMQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG A++L +   + +IGP K+D   +  +  Q+R+  +    +  + DRWL DGD + +
Sbjct: 61  HVGAASELAQHYGVPVIGPEKEDEFWLQGLPAQSRMFGLD-ECQPLTPDRWLNDGDRVSV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGHV++ + ++     GD +F+  +GR+D   GD+ QLI++I  K+
Sbjct: 120 GNVTLQVLHCPGHTPGHVVFFDEQSQLLISGDVIFKGGVGRSDFPRGDHTQLIDAIKRKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           LPLGD+++F+ GHGP ST+G ER  NPFL+  +
Sbjct: 180 LPLGDDVTFIPGHGPLSTLGYERLHNPFLQDEM 212


>gi|298292277|ref|YP_003694216.1| Zn-dependent hydrolase [Starkeya novella DSM 506]
 gi|296928788|gb|ADH89597.1| putative Zn-dependent hydrolase [Starkeya novella DSM 506]
          Length = 211

 Score =  194 bits (492), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 93/213 (43%), Positives = 134/213 (62%), Gaps = 2/213 (0%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M +L   +V VTPF+QNC+ ++DE S    V+DPGGD+  I   ++      ++I +THG
Sbjct: 1   MPELKVAVVPVTPFQQNCSIVWDETSKRGAVIDPGGDIPRILAALKELEVIPEKIVLTHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DH  GAA+L E L++ + GPH+ D  ++  +   A  +   +  R  + DRWL++GDT
Sbjct: 61  HIDHAAGAAELAETLNIPVEGPHEGDKFLLDNL--PADGVRTGIPGRAVTPDRWLKEGDT 118

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           L +G   F V H PGH+PGH++ VN +N  A +GDTLF+ S+GRTD  +GD   LI  I 
Sbjct: 119 LDIGGVTFDVLHVPGHTPGHIVLVNRDNRLAIVGDTLFQRSVGRTDFPYGDGPLLIRGIK 178

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
            KILPLGD  + + GHG  + I  E+R NPFL+
Sbjct: 179 EKILPLGDAFTVLPGHGNATNIALEKRTNPFLR 211


>gi|295096373|emb|CBK85463.1| Zn-dependent hydrolases, including glyoxylases [Enterobacter
           cloacae subsp. cloacae NCTC 9394]
          Length = 215

 Score =  194 bits (492), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 88/213 (41%), Positives = 137/213 (64%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++ I+ VT F QNC+ ++ E++  A +VDPGGD + IK  + +    + QI +THGH+D
Sbjct: 1   MNYRIIPVTAFSQNCSLIWCEQTKLAALVDPGGDAETIKQEVAASGVTLMQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L E   + IIGP K+D   +  +  Q+R+  +    +  + DRWL +GD + +
Sbjct: 61  HVGAAAELAEHYGVPIIGPEKEDEFWLQGLPAQSRMFGLD-ECQPLTPDRWLNEGDRVNV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGH+++ +  +     GD +F+  +GR+D   GD+ QLI SI  K+
Sbjct: 120 GNVTLQVLHCPGHTPGHIVFFDDVSRLLISGDVIFKGGVGRSDFPRGDHGQLIQSIKQKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           LPLGD+++F+ GHGP ST+G ER  NPFL+  +
Sbjct: 180 LPLGDDVTFIPGHGPMSTLGDERLHNPFLQDEM 212


>gi|221202367|ref|ZP_03575400.1| metallo-beta-lactamase family protein [Burkholderia multivorans
           CGD2M]
 gi|221208994|ref|ZP_03581990.1| metallo-beta-lactamase family protein [Burkholderia multivorans
           CGD2]
 gi|221171116|gb|EEE03567.1| metallo-beta-lactamase family protein [Burkholderia multivorans
           CGD2]
 gi|221177781|gb|EEE10195.1| metallo-beta-lactamase family protein [Burkholderia multivorans
           CGD2M]
          Length = 214

 Score =  194 bits (492), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 91/209 (43%), Positives = 128/209 (61%), Gaps = 1/209 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           ++ VTPF+QNC+ L  E++    VVDPGGDL+ I+  I  +N  V ++ +THGH+DH  G
Sbjct: 5   LIPVTPFQQNCSLLVCEKTGRTAVVDPGGDLERIEQEIARQNVQVDKVLLTHGHIDHCAG 64

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           A  L     + I GP +D+   + K+  Q+        A     DRWL DGDT+  G   
Sbjct: 65  AKTLATHYGVPIEGPQEDERFWIEKLPTQSERFGFPA-AEAFEPDRWLNDGDTVQFGDET 123

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
            +V+HCPGH+PGHV++ +  +  A +GD LF  SIGRTD   G++  L+ SI  K+ PLG
Sbjct: 124 LEVYHCPGHTPGHVVFFSRAHRVAIVGDVLFAGSIGRTDFPRGNHADLVRSIKEKLWPLG 183

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           D+++FV GHGP ST G ERR NPF+   +
Sbjct: 184 DDVTFVPGHGPVSTFGDERRTNPFVSDKV 212


>gi|260772913|ref|ZP_05881829.1| hydroxyacylglutathione hydrolase [Vibrio metschnikovii CIP 69.14]
 gi|260612052|gb|EEX37255.1| hydroxyacylglutathione hydrolase [Vibrio metschnikovii CIP 69.14]
          Length = 218

 Score =  194 bits (492), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 92/215 (42%), Positives = 135/215 (62%), Gaps = 2/215 (0%)

Query: 3   KLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHV 62
            L + IV VTPF QNC+ ++ +E+++ +VVDPGGD+  +K +I      V ++ +THGH+
Sbjct: 2   SLKYQIVPVTPFAQNCSIVWCDETMQGIVVDPGGDVKQLKMLIDQLGVQVVKLVLTHGHL 61

Query: 63  DHVGGAAQLKEDL-SLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
           DHVGG   L   L ++ IIGPHK D   +  ++ Q+++    +        +WL +GDT+
Sbjct: 62  DHVGGTQPLAALLGNVDIIGPHKADNFWLQGLEGQSQMFGFPLT-EAFEPHQWLDEGDTV 120

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
             G     V H PGH+PGHV+  + E + A +GD LF  SIGRTD   GD+  LI+SI N
Sbjct: 121 TFGNQTLAVLHTPGHTPGHVVLFSEEASLAFVGDVLFNGSIGRTDFPQGDFNTLIDSIKN 180

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           K+ PLG++++F+ GHGP ST GRER  NPF+   +
Sbjct: 181 KLWPLGNQVTFIPGHGPTSTFGRERASNPFVADEM 215


>gi|171060721|ref|YP_001793070.1| beta-lactamase domain-containing protein [Leptothrix cholodnii
           SP-6]
 gi|170778166|gb|ACB36305.1| beta-lactamase domain protein [Leptothrix cholodnii SP-6]
          Length = 212

 Score =  194 bits (492), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 90/212 (42%), Positives = 129/212 (60%), Gaps = 1/212 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L +  V VT F+QNC+ ++ +E+L A V+DPGGDL  I+  +      ++QIW+TH H+D
Sbjct: 2   LRYLTVPVTAFQQNCSIVWCDETLAAAVIDPGGDLPRIQAEVARLGVKLEQIWLTHAHID 61

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GG   L  +L L I+GPH+ D   +  +D+Q+R+             RWL DGD++ +
Sbjct: 62  HAGGTGTLARELGLPIVGPHEGDQFWIDGLDQQSRMFGF-PPVEPFKPTRWLHDGDSVSI 120

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGH+PGHV++ + E     +GD LF  SIGRTD   GD+  LI SI  ++
Sbjct: 121 GHSTLAVRHCPGHTPGHVVFHSAEIRRCFVGDVLFAGSIGRTDFPGGDHATLIASITQRL 180

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSN 215
            P+GD+  F+ GHGP S+ GRERR NP ++  
Sbjct: 181 WPMGDDTVFIPGHGPESSFGRERRSNPHVRGT 212


>gi|262402378|ref|ZP_06078939.1| hydroxyacylglutathione hydrolase [Vibrio sp. RC586]
 gi|262351160|gb|EEZ00293.1| hydroxyacylglutathione hydrolase [Vibrio sp. RC586]
          Length = 218

 Score =  193 bits (491), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 91/215 (42%), Positives = 131/215 (60%), Gaps = 2/215 (0%)

Query: 3   KLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHV 62
            L + +V VT F QNC+ ++ +E++E VVVDPGGD+  +  +I      V Q+ +THGH+
Sbjct: 2   SLQYQVVPVTAFSQNCSIVWCDETMEGVVVDPGGDVKQLAMLIAELGVKVTQLVLTHGHL 61

Query: 63  DHVGGAAQLKEDLSLT-IIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
           DHVGG   L E L  T I+GPHK D   +  ++ Q+++    +       D+WL DGD +
Sbjct: 62  DHVGGTEPLAEALGGTRIVGPHKADNFWLQGLEGQSKMFGFPLT-EAFEPDQWLNDGDVV 120

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
             G    +V H PGH+PGH++  +     A +GD LF  SIGRTD   GD+  LI SI N
Sbjct: 121 TFGKQTLQVLHTPGHTPGHIVLFSESARLAFVGDVLFNGSIGRTDFPQGDFNTLIASIKN 180

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           K+ PLG++++F+ GHGP ST GRER  NP++   +
Sbjct: 181 KLWPLGNDVTFIPGHGPQSTFGRERANNPYVADEM 215


>gi|254507064|ref|ZP_05119202.1| glyoxylase II family protein [Vibrio parahaemolyticus 16]
 gi|219550059|gb|EED27046.1| glyoxylase II family protein [Vibrio parahaemolyticus 16]
          Length = 218

 Score =  193 bits (491), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 91/214 (42%), Positives = 134/214 (62%), Gaps = 2/214 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L + +V VT F QNC+ ++ +E++E VVVDPGGD+  +  +I+     V ++ +THGH+D
Sbjct: 3   LKYQVVPVTSFSQNCSIVWCDETMEGVVVDPGGDVKQLAMLIKELGVKVVKLVLTHGHLD 62

Query: 64  HVGGAAQLKEDLS-LTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLL 122
           HVGG   L  +L  + I+GPHKDD   +  ++ Q+++    +        +WL++GD ++
Sbjct: 63  HVGGTEPLAAELGGIEIVGPHKDDNFWLQGLENQSQMFGFPLT-EAFEPHQWLEEGDKVV 121

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
            G  +  V H PGH+PGHV+  + E   A +GD LF  SIGRTD   GD+  LI+SI  K
Sbjct: 122 FGNQVMDVIHTPGHTPGHVVLFSNEAKLAFVGDVLFNGSIGRTDFPKGDFNTLISSIKTK 181

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           + PLG+E+ FV GHGP ST GRER  NPF+   +
Sbjct: 182 LWPLGNEVRFVPGHGPESTFGRERASNPFVADEM 215


>gi|110835247|ref|YP_694106.1| metallo-beta-lactamase family protein [Alcanivorax borkumensis SK2]
 gi|110648358|emb|CAL17834.1| metallo-beta-lactamase family protein [Alcanivorax borkumensis SK2]
          Length = 213

 Score =  193 bits (491), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 93/212 (43%), Positives = 135/212 (63%), Gaps = 1/212 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + IV VTPF+QNC+ L  E + +  +VDPGGDL+ I   ++      ++I +TH H+D
Sbjct: 1   MKYAIVPVTPFQQNCSILKCEATNKVAIVDPGGDLENILTALEQIGGTPEKILVTHAHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G  A L E LSL I GPH+DD   +  + +QA+++     +R  + DRWL+ GD++ +
Sbjct: 61  HIGAVADLAERLSLPIEGPHRDDQFWIDMLPQQAQMMGF-APSRPFTPDRWLEGGDSVTV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   F+V HCPGH+PGHV++   E     +GD LF  SIGRTD   GD+  LI +I +++
Sbjct: 120 GETRFEVRHCPGHTPGHVVFYQPEAKLVVVGDVLFNGSIGRTDFPKGDHDTLIQAIKDQL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSN 215
           L L D++SF+ GHGP STIG ER  NPF+   
Sbjct: 180 LTLDDDVSFIPGHGPMSTIGHERSHNPFVSGK 211


>gi|332288326|ref|YP_004419178.1| hydroxyacylglutathione hydrolase [Gallibacterium anatis UMN179]
 gi|330431222|gb|AEC16281.1| hydroxyacylglutathione hydrolase [Gallibacterium anatis UMN179]
          Length = 216

 Score =  193 bits (491), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 93/213 (43%), Positives = 134/213 (62%), Gaps = 2/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           ++  I+ VT F+QNC+ ++D+E   A ++DPGGD + I   ++      K I +THGH+D
Sbjct: 3   MNVQIIPVTAFQQNCSVVWDDEK-NAAIIDPGGDAEKILQFLEDNKLIAKFILLTHGHLD 61

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+LK DL++ I+GP K D   +  + EQA    +   A     DRWL +GD + +
Sbjct: 62  HVGAAAKLKRDLNIDILGPEKSDEYWLQALPEQASQFGLPYCAP-LIPDRWLNEGDVVTI 120

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   F++ H PGH+PGH+ ++N E N A  GD LFR SIGRTD   G + +LINSI +K+
Sbjct: 121 GHLTFEILHLPGHTPGHIGFINKEENIAFTGDVLFRQSIGRTDFQGGSFTELINSIRDKL 180

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            PL   +  V GHGP +TIG E++ NP+L + I
Sbjct: 181 CPLDQNMQIVAGHGPLTTIGYEKQYNPYLTTQI 213


>gi|152969511|ref|YP_001334620.1| putative enzyme [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
 gi|238893983|ref|YP_002918717.1| putative enzyme [Klebsiella pneumoniae NTUH-K2044]
 gi|262040973|ref|ZP_06014195.1| metallo-beta-lactamase [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|330013902|ref|ZP_08307826.1| metallo-beta-lactamase domain protein [Klebsiella sp. MS 92-3]
 gi|150954360|gb|ABR76390.1| putative enzyme [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
 gi|238546299|dbj|BAH62650.1| putative enzyme [Klebsiella pneumoniae subsp. pneumoniae
           NTUH-K2044]
 gi|259041667|gb|EEW42716.1| metallo-beta-lactamase [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|328533307|gb|EGF60056.1| metallo-beta-lactamase domain protein [Klebsiella sp. MS 92-3]
          Length = 215

 Score =  193 bits (491), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 87/213 (40%), Positives = 137/213 (64%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++ I+ VT F QNC+ ++  ++  A +VDPGGD + IK V+      + QI +THGH+D
Sbjct: 1   MNYRIIPVTAFAQNCSLIWCGQTRLAALVDPGGDAERIKAVVAEAGVTLMQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L +   + +IGP K+D   +  +  Q+R+  +  + +    DRWL +GD + +
Sbjct: 61  HVGAAAELAQHYGVPVIGPEKEDEFWLEGLPAQSRMFGLE-DCQPLRPDRWLNEGDVVNV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGHV++ +  +     GD +F+  +GR+D   GD+ QLI +I  K+
Sbjct: 120 GNVALQVLHCPGHTPGHVVFFDDASRLLISGDVIFKGGVGRSDFPRGDHGQLIAAIKEKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           LPLGD+++F+ GHGP ST+G ERR NPFL+  +
Sbjct: 180 LPLGDDVTFIPGHGPLSTLGEERRNNPFLQDEM 212


>gi|262374077|ref|ZP_06067354.1| metallo-beta-lactamase superfamily protein [Acinetobacter junii
           SH205]
 gi|262311088|gb|EEY92175.1| metallo-beta-lactamase superfamily protein [Acinetobacter junii
           SH205]
          Length = 214

 Score =  193 bits (491), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 91/212 (42%), Positives = 131/212 (61%), Gaps = 1/212 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L   IV VT F QNC+ L+D ES EAV++D GGD  ++K  +++    VK +W+THGH+D
Sbjct: 2   LQVKIVPVTAFAQNCSILWDSESKEAVLIDAGGDAAVLKKEVEALGLTVKALWLTHGHLD 61

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H G   +L E   + +IGPHK+D   +  + E +      +  +    D+WL+ G+TL L
Sbjct: 62  HAGAVGELAEAWKIPVIGPHKEDQFWLDMIQEVSARYGFPI-PQPVKVDQWLEGGETLKL 120

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   F+V   PGH+PGHV++ N ++     GD LF+ SIGRTD   G++QQL++SI  + 
Sbjct: 121 GEDEFEVRFAPGHTPGHVMFYNQKHGLLWTGDVLFKGSIGRTDFPKGNHQQLLDSIKREC 180

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSN 215
             L DE  F+ GHGP STIG E++ NPF+ S 
Sbjct: 181 FSLPDETQFISGHGPISTIGYEKQFNPFVASK 212


>gi|186474890|ref|YP_001856360.1| beta-lactamase domain-containing protein [Burkholderia phymatum
           STM815]
 gi|184191349|gb|ACC69314.1| beta-lactamase domain protein [Burkholderia phymatum STM815]
          Length = 214

 Score =  193 bits (491), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 91/209 (43%), Positives = 131/209 (62%), Gaps = 1/209 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           ++ VTPF+QN + L  E++  A +VDPGGDLDIIK  ++ +   V+++ +THGH+DH  G
Sbjct: 5   LIPVTPFQQNSSLLVCEKTGRAAIVDPGGDLDIIKGEVERQKASVEKVLLTHGHIDHCAG 64

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           A  L E   + I GPH D+   + ++ +Q+        A      RWL+D DT+  G   
Sbjct: 65  AKTLAEHYGVPIEGPHIDERFWIDQLPQQSLRFGFPA-AEAFEPTRWLKDKDTVTFGDET 123

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
            +V+HCPGH+PGHVI+ +  +  A +GD LF  SIGRTD   G++  LI SI  K+ PLG
Sbjct: 124 LEVYHCPGHTPGHVIFFSRAHRLALVGDVLFAGSIGRTDFPRGNHGDLIRSIREKLWPLG 183

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           D+++FV GHGP ST G ERR NP++   +
Sbjct: 184 DDVTFVPGHGPTSTFGDERRTNPYVADGV 212


>gi|56413954|ref|YP_151029.1| hypothetical protein SPA1801 [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|197362877|ref|YP_002142514.1| hypothetical protein SSPA1674 [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|56128211|gb|AAV77717.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|197094354|emb|CAR59866.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
          Length = 215

 Score =  193 bits (491), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 86/213 (40%), Positives = 139/213 (65%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++ I+ VT F QNC+ ++ E++  A +VDPGGD + IK  + +    + QI +THGH+D
Sbjct: 1   MNYRIIPVTAFSQNCSLIWCEQTRLAALVDPGGDAEKIKQEVDASGVTLMQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG A++L +   + +IGP K+D   +  +  Q+R+  +    +  + DRWL DGD + +
Sbjct: 61  HVGAASELAQHYGVPVIGPEKEDEFWLQGLPAQSRMFGLD-ERQPLTPDRWLNDGDRVSV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGHV++ + ++     GD +F+  +GR+D   GD+ QLI++I  K+
Sbjct: 120 GNVTLQVLHCPGHTPGHVVFFDEQSQLLISGDVIFKGGVGRSDFPRGDHTQLIDAIKRKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           LPLGD+++F+ GHGP ST+G ER  NPFL+  +
Sbjct: 180 LPLGDDVTFIPGHGPLSTLGYERLHNPFLQDEM 212


>gi|301598408|pdb|2XF4|A Chain A, Crystal Structure Of Salmonella Enterica Serovar
           Typhimurium Ycbl
          Length = 210

 Score =  193 bits (491), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 86/210 (40%), Positives = 138/210 (65%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++ I+ VT F QNC+ ++ E++  A +VDPGGD + IK  + +    + QI +THGH+D
Sbjct: 1   MNYRIIPVTAFSQNCSLIWCEQTRLAALVDPGGDAEKIKQEVDASGVTLMQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG A++L +   + +IGP K+D   +  +  Q+R+  +    +  + DRWL DGD + +
Sbjct: 61  HVGAASELAQHYGVPVIGPEKEDEFWLQGLPAQSRMFGLD-ECQPLTPDRWLNDGDRVSV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGHV++ + ++     GD +F+  +GR+D   GD+ QLI++I  K+
Sbjct: 120 GNVTLQVLHCPGHTPGHVVFFDEQSQLLISGDVIFKGGVGRSDFPRGDHTQLIDAIKRKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           LPLGD+++F+ GHGP ST+G ER  NPFL+
Sbjct: 180 LPLGDDVTFIPGHGPLSTLGYERLHNPFLQ 209


>gi|333008913|gb|EGK28373.1| metallo-beta-lactamase superfamily protein [Shigella flexneri
           K-272]
 gi|333020223|gb|EGK39493.1| metallo-beta-lactamase superfamily protein [Shigella flexneri
           K-227]
          Length = 215

 Score =  193 bits (490), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 86/213 (40%), Positives = 137/213 (64%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++ I+ VT F QNC+ ++ E++  A +VDPGGD + IK  +      + +I +THGH+D
Sbjct: 1   MNYRIIPVTAFSQNCSLIWCEQTRLAALVDPGGDAEKIKQEVDDSGLTLMKILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L +   + + GP K+D   +  +  Q+R+  +    +  + DRWL +GDT+ +
Sbjct: 61  HVGAAAELAQHYGVPVFGPEKEDEFWLQGLPAQSRMFGLE-ECQPLTPDRWLNEGDTISI 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGHV++ +        GD +F+  +GR+D   GD+ QLI+SI +K+
Sbjct: 120 GNVTLQVLHCPGHTPGHVVFFDDRAKLLISGDVIFKGGVGRSDFPRGDHNQLISSIKDKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           LPLGD+++F+ GHGP ST+G ER  NPFL+  +
Sbjct: 180 LPLGDDVTFIPGHGPLSTLGYERLHNPFLQDEM 212


>gi|170731622|ref|YP_001763569.1| beta-lactamase domain-containing protein [Burkholderia cenocepacia
           MC0-3]
 gi|169814864|gb|ACA89447.1| beta-lactamase domain protein [Burkholderia cenocepacia MC0-3]
          Length = 214

 Score =  193 bits (490), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 90/213 (42%), Positives = 132/213 (61%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +   ++ VTPF+QNC+ L  E++  A VVDPGGDLD I+  +  +N  V+++ +THGH+D
Sbjct: 1   MKVTLIPVTPFQQNCSLLVCEKTGRAAVVDPGGDLDRIEQEVARQNVQVEKVLLTHGHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H  GA  L     + I GP +++   + K+  Q+        A     D+WL DGDT+  
Sbjct: 61  HCAGAKTLATRYGVPIEGPQEEERFWIEKLPMQSERFGFPA-ADVFEPDQWLNDGDTVQF 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V+HCPGH+PGHV++ +  +  A +GD LF  SIGRTD   G+++ L+ SI  K+
Sbjct: 120 GDETLEVYHCPGHTPGHVVFFSRAHRVAIVGDVLFAGSIGRTDFPRGNHEDLVRSIKEKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            PLGD+++FV GHGP ST G ERR NPF+   +
Sbjct: 180 WPLGDDVTFVPGHGPVSTFGDERRTNPFVSDKV 212


>gi|16128894|ref|NP_415447.1| predicted metal-binding enzyme [Escherichia coli str. K-12 substr.
           MG1655]
 gi|89107777|ref|AP_001557.1| predicted metal-binding enzyme [Escherichia coli str. K-12 substr.
           W3110]
 gi|170080585|ref|YP_001729905.1| metal-binding protein [Escherichia coli str. K-12 substr. DH10B]
 gi|188491939|ref|ZP_02999209.1| metallo-beta-lactamase family protein [Escherichia coli 53638]
 gi|194438724|ref|ZP_03070811.1| metallo-beta-lactamase family protein [Escherichia coli 101-1]
 gi|238900185|ref|YP_002925981.1| putative metal-binding enzyme [Escherichia coli BW2952]
 gi|253774044|ref|YP_003036875.1| beta-lactamase [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|254161041|ref|YP_003044149.1| putative metal-binding enzyme [Escherichia coli B str. REL606]
 gi|256023372|ref|ZP_05437237.1| predicted metal-binding enzyme [Escherichia sp. 4_1_40B]
 gi|297521036|ref|ZP_06939422.1| predicted metal-binding enzyme [Escherichia coli OP50]
 gi|300929622|ref|ZP_07145084.1| metallo-beta-lactamase domain protein [Escherichia coli MS 187-1]
 gi|300949710|ref|ZP_07163689.1| metallo-beta-lactamase domain protein [Escherichia coli MS 116-1]
 gi|300955425|ref|ZP_07167799.1| metallo-beta-lactamase domain protein [Escherichia coli MS 175-1]
 gi|301022421|ref|ZP_07186304.1| metallo-beta-lactamase domain protein [Escherichia coli MS 196-1]
 gi|301643447|ref|ZP_07243495.1| metallo-beta-lactamase domain protein [Escherichia coli MS 146-1]
 gi|307137556|ref|ZP_07496912.1| predicted metal-binding enzyme [Escherichia coli H736]
 gi|312971057|ref|ZP_07785236.1| metallo-beta-lactamase superfamily protein [Escherichia coli
           1827-70]
 gi|331641453|ref|ZP_08342588.1| putative Metallo-beta-lactamase [Escherichia coli H736]
 gi|2494856|sp|P75849|YCBL_ECOLI RecName: Full=Uncharacterized protein ycbL
 gi|1787158|gb|AAC74013.1| predicted metal-binding enzyme [Escherichia coli str. K-12 substr.
           MG1655]
 gi|4062494|dbj|BAA35673.1| predicted metal-binding enzyme [Escherichia coli str. K12 substr.
           W3110]
 gi|169888420|gb|ACB02127.1| predicted metal-binding enzyme [Escherichia coli str. K-12 substr.
           DH10B]
 gi|188487138|gb|EDU62241.1| metallo-beta-lactamase family protein [Escherichia coli 53638]
 gi|194422356|gb|EDX38356.1| metallo-beta-lactamase family protein [Escherichia coli 101-1]
 gi|238862657|gb|ACR64655.1| predicted metal-binding enzyme [Escherichia coli BW2952]
 gi|242376742|emb|CAQ31455.1| predicted metal-binding enzyme [Escherichia coli BL21(DE3)]
 gi|253325088|gb|ACT29690.1| beta-lactamase domain protein [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|253972942|gb|ACT38613.1| predicted metal-binding enzyme [Escherichia coli B str. REL606]
 gi|253977156|gb|ACT42826.1| predicted metal-binding enzyme [Escherichia coli BL21(DE3)]
 gi|260449927|gb|ACX40349.1| beta-lactamase domain protein [Escherichia coli DH1]
 gi|299881262|gb|EFI89473.1| metallo-beta-lactamase domain protein [Escherichia coli MS 196-1]
 gi|300317648|gb|EFJ67432.1| metallo-beta-lactamase domain protein [Escherichia coli MS 175-1]
 gi|300450891|gb|EFK14511.1| metallo-beta-lactamase domain protein [Escherichia coli MS 116-1]
 gi|300462459|gb|EFK25952.1| metallo-beta-lactamase domain protein [Escherichia coli MS 187-1]
 gi|301078161|gb|EFK92967.1| metallo-beta-lactamase domain protein [Escherichia coli MS 146-1]
 gi|309701203|emb|CBJ00503.1| conserved hypothetical protein [Escherichia coli ETEC H10407]
 gi|310336818|gb|EFQ01985.1| metallo-beta-lactamase superfamily protein [Escherichia coli
           1827-70]
 gi|315135575|dbj|BAJ42734.1| putative metal-binding enzyme [Escherichia coli DH1]
 gi|315619121|gb|EFU99701.1| metallo-beta-lactamase superfamily protein [Escherichia coli 3431]
 gi|323938033|gb|EGB34295.1| metallo-beta-lactamase superfamily protein [Escherichia coli E1520]
 gi|323942843|gb|EGB39008.1| metallo-beta-lactamase superfamily protein [Escherichia coli E482]
 gi|323962919|gb|EGB58493.1| metallo-beta-lactamase superfamily protein [Escherichia coli H489]
 gi|323973198|gb|EGB68390.1| metallo-beta-lactamase superfamily protein [Escherichia coli TA007]
 gi|331038251|gb|EGI10471.1| putative Metallo-beta-lactamase [Escherichia coli H736]
          Length = 215

 Score =  193 bits (490), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 87/213 (40%), Positives = 136/213 (63%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++ I+ VT F QNC+ ++ E++  A +VDPGGD + IK  +      + QI +THGH+D
Sbjct: 1   MNYRIIPVTAFSQNCSLIWCEQTRLAALVDPGGDAEKIKQEVDDSGLTLMQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L +   + + GP K+D   +  +  Q+R+  +    +  + DRWL +GDT+ +
Sbjct: 61  HVGAAAELAQHYGVPVFGPEKEDEFWLQGLPAQSRMFGLE-ECQPLTPDRWLNEGDTISI 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGHV++ +        GD +F+  +GR+D   GD+ QLI+SI +K+
Sbjct: 120 GNVTLQVLHCPGHTPGHVVFFDDRAKLLISGDVIFKGGVGRSDFPRGDHNQLISSIKDKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           LPLGD++ F+ GHGP ST+G ER  NPFL+  +
Sbjct: 180 LPLGDDVIFIPGHGPLSTLGYERLHNPFLQDEM 212


>gi|84393107|ref|ZP_00991872.1| Glyoxylase II family protein [Vibrio splendidus 12B01]
 gi|84376264|gb|EAP93147.1| Glyoxylase II family protein [Vibrio splendidus 12B01]
          Length = 217

 Score =  193 bits (490), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 87/214 (40%), Positives = 132/214 (61%), Gaps = 1/214 (0%)

Query: 3   KLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHV 62
            L + +V VT F QNC+ ++ +E++E +VVDPGGD+  +  +I+     V  + +THGH+
Sbjct: 2   SLKYQVVPVTSFSQNCSIVWCDETMEGIVVDPGGDVQQLAAIIEELGVKVVNLVLTHGHL 61

Query: 63  DHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLL 122
           DHVGG   L E L++ I+GPHK D   +  ++ Q+++    +  +    + WL++GD + 
Sbjct: 62  DHVGGTVPLAEILNVNIVGPHKADNFWLQGLENQSQMFGFPL-CKAFEPNTWLEEGDKVT 120

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
            G  +  V H PGH+PGHV+  + +   A +GD LF  +IGRTD   GD+  LI SI  K
Sbjct: 121 FGNQVIDVIHTPGHTPGHVVLFSEQARMAFVGDVLFNGAIGRTDFPQGDFNTLIASIKTK 180

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           + PLG +++FV GHGP ST GRER  NPF+   +
Sbjct: 181 LWPLGSDVTFVPGHGPESTFGRERASNPFVADEM 214


>gi|116688309|ref|YP_833932.1| beta-lactamase domain-containing protein [Burkholderia cenocepacia
           HI2424]
 gi|116646398|gb|ABK07039.1| beta-lactamase domain protein [Burkholderia cenocepacia HI2424]
          Length = 214

 Score =  193 bits (490), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 90/213 (42%), Positives = 132/213 (61%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +   ++ VTPF+QNC+ L  E++  A VVDPGGDLD I+  +  +N  V+++ +THGH+D
Sbjct: 1   MKVTLIPVTPFQQNCSLLVCEKTGRAAVVDPGGDLDRIEQEVARQNVQVEKVLLTHGHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H  GA  L     + I GP +++   + K+  Q+        A     D+WL DGDT+  
Sbjct: 61  HCAGAKTLATRYGVPIEGPQEEERFWIEKLPMQSERFGFPA-ADVFEPDQWLNDGDTVRF 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V+HCPGH+PGHV++ +  +  A +GD LF  SIGRTD   G+++ L+ SI  K+
Sbjct: 120 GDETLEVYHCPGHTPGHVVFFSRAHRVAIVGDVLFAGSIGRTDFPRGNHEDLVRSIKEKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            PLGD+++FV GHGP ST G ERR NPF+   +
Sbjct: 180 WPLGDDVTFVPGHGPVSTFGDERRTNPFVSDKV 212


>gi|254246788|ref|ZP_04940109.1| Beta-lactamase-like [Burkholderia cenocepacia PC184]
 gi|124871564|gb|EAY63280.1| Beta-lactamase-like [Burkholderia cenocepacia PC184]
          Length = 278

 Score =  192 bits (489), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 90/215 (41%), Positives = 133/215 (61%), Gaps = 1/215 (0%)

Query: 2   SKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGH 61
           + +   ++ VTPF+QNC+ L  E++  A VVDPGGDLD I+  +  +N  V+++ +THGH
Sbjct: 63  APMKVTLIPVTPFQQNCSLLVCEKTGRAAVVDPGGDLDRIEQEVARQNVQVEKVLLTHGH 122

Query: 62  VDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
           +DH  GA  L     + I GP +++   + K+  Q+        A     D+WL DGDT+
Sbjct: 123 IDHCAGAKTLAMHYGVPIEGPQEEERFWIEKLPMQSERFGFPA-ADIFEPDQWLNDGDTV 181

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
             G    +V+HCPGH+PGHV++ +  +  A +GD LF  SIGRTD   G+++ L+ SI  
Sbjct: 182 QFGDETLEVYHCPGHTPGHVVFFSRAHRVAIVGDVLFAGSIGRTDFPRGNHEDLVRSIKE 241

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           K+ PLGD+++FV GHGP ST G ERR NPF+   +
Sbjct: 242 KLWPLGDDVTFVPGHGPVSTFGDERRTNPFVSDKV 276


>gi|283784754|ref|YP_003364619.1| hypothetical protein ROD_09961 [Citrobacter rodentium ICC168]
 gi|282948208|emb|CBG87775.1| conserved hypothetical protein [Citrobacter rodentium ICC168]
          Length = 215

 Score =  192 bits (489), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 85/213 (39%), Positives = 140/213 (65%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++ I+ VT F QNC+ ++ E++  A +VDPGGD + IK  + +    + QI +THGH+D
Sbjct: 1   MNYRIIPVTAFSQNCSLIWCEQTRLAALVDPGGDAEKIKQEVDASGVTLMQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L     + +IGP K+D   +  +  Q+R+  +    +  + DRWL++G+++ +
Sbjct: 61  HVGAAAELAAHYGVPVIGPEKEDEFWLQGLPAQSRMFGLD-ECQPLTPDRWLEEGESVNV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGH+++ +  +     GD +F+  +GR+D   GD+ QLI+SI +K+
Sbjct: 120 GNVTLQVLHCPGHTPGHIVFFDDRSRLLISGDVIFKGGVGRSDFPRGDHSQLIDSIKSKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           LPLGD+++F+ GHGP ST+G ER  NPFL+  +
Sbjct: 180 LPLGDDVTFIPGHGPLSTLGYERLHNPFLQDEM 212


>gi|85374555|ref|YP_458617.1| glyoxalase II family protein [Erythrobacter litoralis HTCC2594]
 gi|84787638|gb|ABC63820.1| glyoxalase II family protein [Erythrobacter litoralis HTCC2594]
          Length = 221

 Score =  192 bits (489), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 89/211 (42%), Positives = 135/211 (63%), Gaps = 2/211 (0%)

Query: 2   SKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGH 61
           S +   I+ VTP +QNC+ ++   + +  ++DPGGDLD +K  ++     +++I ITHGH
Sbjct: 7   SPMKAGIIPVTPLQQNCSLIWCTATNKGALIDPGGDLDKLKAGVKKTGVELEKILITHGH 66

Query: 62  VDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
           +DH G A  L ++L L I GPH+ D   + ++DE  +   I         DRWL DGDT+
Sbjct: 67  IDHCGEAGVLAKELGLPIEGPHEADRFWISRLDEDGKKYGIA--GEVFEPDRWLDDGDTV 124

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
            +G     V HCPGH+PGHV++ +  + FA +GD LF+ SIGRTD   G++Q LI++I  
Sbjct: 125 TVGELELDVIHCPGHTPGHVVFYHAPSKFAVVGDVLFQGSIGRTDFPMGNHQDLIDAITQ 184

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           K+ PLG++++F+ GHGP ST G+ER+ N F+
Sbjct: 185 KLWPLGNDVTFIPGHGPTSTFGQERKTNAFV 215


>gi|300716098|ref|YP_003740901.1| hypothetical protein EbC_15190 [Erwinia billingiae Eb661]
 gi|299061934|emb|CAX59050.1| uncharacterized protein [Erwinia billingiae Eb661]
          Length = 209

 Score =  192 bits (489), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 87/210 (41%), Positives = 133/210 (63%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + I+ VT F QNC+ ++  E+L+A VVDPGGD + I+  +  +   V QI +THGH+D
Sbjct: 1   MDYQIIPVTAFAQNCSLIWCAETLQAAVVDPGGDAETIQAHVAEKGVTVTQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L     + ++GPHK DA  +  +  Q+++      A   + DRWL++G+T+ L
Sbjct: 61  HVGAAAELAAFYGVPVVGPHKADAFWLEGLPAQSQMFGFPYCA-PLTPDRWLEEGETVQL 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    ++  CPGH+PGH+++ +  +     GD +F   +GR+D   G +  LI SI  K+
Sbjct: 120 GNITLEILLCPGHTPGHIVFFDRASRLLVSGDVIFNGGVGRSDFPQGSHADLIASIKTKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           LPLGD+++F  GHGP ST+GRER  NPFL+
Sbjct: 180 LPLGDDVTFFPGHGPMSTLGRERISNPFLQ 209


>gi|300689884|ref|YP_003750879.1| enzyme with metallo-hydrolase/oxidoreductase domain [Ralstonia
           solanacearum PSI07]
 gi|299076944|emb|CBJ49557.1| putative enzyme with metallo-hydrolase/oxidoreductase domain
           [Ralstonia solanacearum PSI07]
          Length = 218

 Score =  192 bits (489), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 93/209 (44%), Positives = 129/209 (61%), Gaps = 2/209 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           +V VTPF+QNCT L  ++   A V DPGGD+D I    + +   +++I +THGHVDH   
Sbjct: 5   VVPVTPFEQNCTLLIGDDG-RAAVTDPGGDIDRILTAARQQGARIEKILLTHGHVDHCAA 63

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           A  L+  L + I GPHKD+A  + ++  Q++       AR    DRWL DGDT+      
Sbjct: 64  ADALRAQLGVPIEGPHKDEAFWIDQLPAQSQRFGF-PPARAFVPDRWLDDGDTVEAAGRT 122

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
            +VFHCPGH+PGHV++ +  +  A +GD LF  SIGRTD   G++  LI SI  K+ PLG
Sbjct: 123 LEVFHCPGHTPGHVVFFSRPDRIAIVGDVLFAGSIGRTDFPRGNHADLIRSIRTKLWPLG 182

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           D+++FV GHGP ST G ER  NP++   +
Sbjct: 183 DDVTFVPGHGPVSTFGEERATNPYVADRL 211


>gi|262171696|ref|ZP_06039374.1| hydroxyacylglutathione hydrolase [Vibrio mimicus MB-451]
 gi|261892772|gb|EEY38758.1| hydroxyacylglutathione hydrolase [Vibrio mimicus MB-451]
          Length = 218

 Score =  192 bits (489), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 91/215 (42%), Positives = 131/215 (60%), Gaps = 2/215 (0%)

Query: 3   KLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHV 62
            L + +V VT F QNC+ ++ +E++E VVVDPGGD+  +  +I      V Q+ +THGH+
Sbjct: 2   SLQYQVVPVTAFSQNCSIVWCDETMEGVVVDPGGDVKQLAMLIAELGVKVTQLVLTHGHL 61

Query: 63  DHVGGAAQLKEDLS-LTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
           DHVGG   L E L    I+GPHK D   +  ++ Q+++    +       D+WL DGD +
Sbjct: 62  DHVGGTEPLAEALGGARIVGPHKADNFWLQGLEGQSKMFGFPLT-EAFEPDQWLNDGDVV 120

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
             G    +V H PGH+PGHV+  +  +  A +GD LF  SIGRTD   GD+  LI SI N
Sbjct: 121 TFGKQTLQVLHTPGHTPGHVVLFSDSDRLAFVGDVLFNGSIGRTDFPQGDFNTLIASIKN 180

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           K+ PLG++++F+ GHGP ST GRER  NP++   +
Sbjct: 181 KLWPLGNDVTFIPGHGPKSTFGRERANNPYVADEM 215


>gi|238913230|ref|ZP_04657067.1| hypothetical protein SentesTe_19194 [Salmonella enterica subsp.
           enterica serovar Tennessee str. CDC07-0191]
          Length = 215

 Score =  192 bits (488), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 85/213 (39%), Positives = 139/213 (65%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++ I+ VT F QNC+ ++ E++  A +VDPGGD + IK  + +    + QI +THGH+D
Sbjct: 1   MNYRIIPVTAFSQNCSLIWCEQTRLAALVDPGGDAEKIKQEVDASGVTLMQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG A++L +   + +IGP K+D   +  +  Q+R+  +    +  + DRWL DGD + +
Sbjct: 61  HVGAASELAQHYGVPVIGPEKEDEFWLQGLPAQSRMFGLD-ECQPLTPDRWLNDGDRVSV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGHV++ + ++     GD +F+  +GR+D   GD+ +LI++I  K+
Sbjct: 120 GNVTLQVLHCPGHTPGHVVFFDEQSQLLISGDVIFKGGVGRSDFPRGDHTKLIDAIKRKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           LPLGD+++F+ GHGP ST+G ER  NPFL+  +
Sbjct: 180 LPLGDDVTFIPGHGPLSTLGYERLHNPFLQDEM 212


>gi|218709904|ref|YP_002417525.1| glyoxylase II family protein [Vibrio splendidus LGP32]
 gi|218322923|emb|CAV19100.1| glyoxylase II family protein [Vibrio splendidus LGP32]
          Length = 219

 Score =  192 bits (488), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 87/214 (40%), Positives = 131/214 (61%), Gaps = 1/214 (0%)

Query: 3   KLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHV 62
            L + +V VT F QNC+ ++ +E++E +VVDPGGD+  +  +I+     V  + +THGH+
Sbjct: 4   SLKYQVVPVTSFSQNCSIVWCDETMEGIVVDPGGDVQQLAAIIEELGVKVVNLVLTHGHL 63

Query: 63  DHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLL 122
           DHVGG   L E L++ I+GPHK D   +  ++ Q+++    +  +    + WL++GD + 
Sbjct: 64  DHVGGTVPLAEILNVNIVGPHKADNFWLQGLENQSQMFGFPL-CKAFEPNTWLEEGDKVT 122

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
            G  +  V H PGH+PGHV+  + +   A +GD LF  +IGRTD   GD+  LI SI  K
Sbjct: 123 FGNQVIDVIHTPGHTPGHVVLFSEQARMAFVGDVLFNGAIGRTDFPQGDFNTLIASIKTK 182

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           + PLG ++ FV GHGP ST GRER  NPF+   +
Sbjct: 183 LWPLGSDVRFVPGHGPESTFGRERASNPFVADEM 216


>gi|145299052|ref|YP_001141893.1| metallo-beta-lactamase superfamily protein [Aeromonas salmonicida
           subsp. salmonicida A449]
 gi|142851824|gb|ABO90145.1| metallo-beta-lactamase superfamily protein [Aeromonas salmonicida
           subsp. salmonicida A449]
          Length = 214

 Score =  192 bits (488), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 89/213 (41%), Positives = 132/213 (61%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L F ++ VT F QNC+ ++ +E+ +A ++DP G+ D +   I  R   +  I +THGH+D
Sbjct: 2   LKFEVIPVTQFAQNCSLIWCDETHQAALIDPCGEADKLLAAITQRGLTLTHILLTHGHLD 61

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L+E   + I GPHK+DA  +  +  Q+++     +    + + WL+ GD + +
Sbjct: 62  HVGAAAELRETTGVAITGPHKEDAFWLDMLPRQSQMFGF-AHTPAFTPNSWLEQGDKVKV 120

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V+ CPGH+PGHVI ++     A +GD LF  SIGRTD   GD+  LI SI   +
Sbjct: 121 GNCELEVYFCPGHTPGHVILLSQAEKLAWVGDVLFAGSIGRTDFPRGDHATLIKSITETL 180

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           LPLGDEI F+ GHGP+ST GRE+  NP+L   +
Sbjct: 181 LPLGDEIVFIPGHGPSSTFGREKASNPYLTQAV 213


>gi|119775277|ref|YP_928017.1| metallo-beta-lactamase family protein [Shewanella amazonensis SB2B]
 gi|119767777|gb|ABM00348.1| metallo-beta-lactamase family protein [Shewanella amazonensis SB2B]
          Length = 214

 Score =  192 bits (488), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 91/213 (42%), Positives = 134/213 (62%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + I+ VTPF+QNCT ++ E + +A VVDPGG+L+ I + ++     + +I +THGH+D
Sbjct: 1   MKYQIIPVTPFQQNCTLIWCENTRKAAVVDPGGNLERIYEALEKHGLTLDKILLTHGHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVGGAA+L  +  + I GPH DDA  +  +  Q++          A S R+L++G++L +
Sbjct: 61  HVGGAAKLSTETGVAIEGPHVDDAFWLENLPRQSQNFGFAHCDAFAPS-RYLEEGESLRI 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGH+PGH+++       A +GD LFR SIGRTD    D++ LINSI  K+
Sbjct: 120 GDVSLAVMHCPGHTPGHLVFFEPVTKLALVGDVLFRGSIGRTDFPGSDHKALINSITTKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            PLG E++F+ GHGP ST   ER  NPF+   +
Sbjct: 180 WPLGKEVAFIPGHGPMSTFAEERAHNPFVADQL 212


>gi|153827568|ref|ZP_01980235.1| glyoxylase II family protein [Vibrio cholerae MZO-2]
 gi|149738467|gb|EDM52863.1| glyoxylase II family protein [Vibrio cholerae MZO-2]
          Length = 218

 Score =  192 bits (487), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 91/215 (42%), Positives = 129/215 (60%), Gaps = 2/215 (0%)

Query: 3   KLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHV 62
            L + +V VT F QNC+ ++ +E++E +VVDPGGD+  +  +I      V Q+ +THGH+
Sbjct: 2   SLQYQVVPVTAFAQNCSIVWCDETMEGIVVDPGGDVKQLAMLIAELGVKVTQLVLTHGHL 61

Query: 63  DHVGGAAQLKEDLSLT-IIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
           DHVGG   L + L  T ++GPHK D   +  ++ Q+++    +       D WL DGD L
Sbjct: 62  DHVGGTQSLSQALGGTRVVGPHKADNFWLQGLEGQSKMFGFPLT-EAFEPDEWLDDGDVL 120

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
             G    +V H PGH+PGHV+  +     A +GD LF  SIGRTD   GD+  LI SI N
Sbjct: 121 HFGQQTLQVIHTPGHTPGHVVLFSEAARLAFVGDVLFNGSIGRTDFPQGDFNTLIASIKN 180

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           K+ PLG +++F+ GHGP ST GRER  NPF+   +
Sbjct: 181 KLWPLGSDVTFIPGHGPQSTFGRERASNPFVADEM 215


>gi|300702574|ref|YP_003744174.1| hypothetical protein RCFBP_10212 [Ralstonia solanacearum CFBP2957]
 gi|299070235|emb|CBJ41526.1| putative enzyme with metallo-hydrolase/oxidoreductase domain
           [Ralstonia solanacearum CFBP2957]
          Length = 218

 Score =  192 bits (487), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 92/209 (44%), Positives = 131/209 (62%), Gaps = 2/209 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           +V VTPF+QNCT L  ++   A V DPGGD+D I    + +   +++I +THGHVDH   
Sbjct: 5   VVPVTPFEQNCTLLIGDDG-RAAVTDPGGDIDRILSAARQQGARIEKILLTHGHVDHCAA 63

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           A  L+  L + I GPH+D+A  + ++  Q++       AR    DRWL+DGDT+      
Sbjct: 64  ADALRTQLGVPIEGPHRDEAFWIDQLPTQSQRFGF-PPARAFVPDRWLEDGDTVEAAGRT 122

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
            +VFHCPGH+PGHV++ +  +  A +GD LF  SIGRTD   G++  LI SI  K+ PLG
Sbjct: 123 LEVFHCPGHTPGHVVFFSRPDRIAIVGDVLFAGSIGRTDFPRGNHADLIRSIRTKLWPLG 182

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           D+++FV GHGP ST G ER  NP++  ++
Sbjct: 183 DDVTFVPGHGPVSTFGDERATNPYVADSL 211


>gi|154245699|ref|YP_001416657.1| beta-lactamase domain-containing protein [Xanthobacter
           autotrophicus Py2]
 gi|154159784|gb|ABS67000.1| beta-lactamase domain protein [Xanthobacter autotrophicus Py2]
          Length = 235

 Score =  192 bits (487), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 93/213 (43%), Positives = 132/213 (61%), Gaps = 1/213 (0%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M  +   +V VTPF+QNC+ L+   +++ VV+DPGGDLD I+  I      V +I +THG
Sbjct: 23  MQPIQIAVVPVTPFEQNCSLLWCTRTMKGVVIDPGGDLDKIRSAIAETGISVDKILLTHG 82

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           HVDH  GAA+L E L + + GP + D  +M  +   A    I  NAR  + DR+L +G+T
Sbjct: 83  HVDHAAGAAELAETLGVKVEGPGEADQFIMDDIPATAAKYGIP-NARAVTPDRYLSEGET 141

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           + +G     + H PGH+PGH+++V+     A +GDTLFR S+GRTD  +GD   LI  I 
Sbjct: 142 VSVGDLTLDILHVPGHTPGHLVFVHKGVGIAIVGDTLFRGSVGRTDFPYGDPDLLIAGIV 201

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
            K+LPLGD +  + GHGP ++IG E+  NPFL 
Sbjct: 202 GKLLPLGDNVVCLPGHGPVTSIGDEKAHNPFLP 234


>gi|94495943|ref|ZP_01302522.1| beta-lactamase-like protein [Sphingomonas sp. SKA58]
 gi|94424635|gb|EAT09657.1| beta-lactamase-like protein [Sphingomonas sp. SKA58]
          Length = 219

 Score =  192 bits (487), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 88/215 (40%), Positives = 130/215 (60%), Gaps = 2/215 (0%)

Query: 2   SKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGH 61
             L   ++ VTP +QNCT  +  E++    VDPGGDL ++K   Q     ++++ ITHGH
Sbjct: 4   PPLKAALIPVTPLQQNCTLFWCTETMRGAFVDPGGDLPMLKKAAQQHGVTIEKLLITHGH 63

Query: 62  VDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
           +DH G A  L  DL + I GPH++D   + ++ +     ++     +   DRWL DGD +
Sbjct: 64  IDHCGQAGVLARDLGVPIEGPHEEDRFWIERLAQDGERWNV--PGESFEPDRWLADGDQV 121

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
            +G     V+HCPGH+PGHV++ +  +  A +GD LF+ +IGRTD   GD+QQLI++I  
Sbjct: 122 TVGHLTLDVYHCPGHTPGHVVFHHAPSKLAIVGDVLFQGAIGRTDFPRGDHQQLIDAITG 181

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           K+ PLG E +FV GHGP S    ERR NPF+  ++
Sbjct: 182 KLWPLGGETAFVPGHGPMSNFAHERRTNPFVADSV 216


>gi|207744751|ref|YP_002261143.1| beta-lactamase-like protein [Ralstonia solanacearum IPO1609]
 gi|206596161|emb|CAQ63088.1| beta-lactamase-like protein [Ralstonia solanacearum IPO1609]
          Length = 218

 Score =  192 bits (487), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 92/209 (44%), Positives = 131/209 (62%), Gaps = 2/209 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           +V VTPF+QNCT L  ++   A V DPGGD+D I    + +   +++I +THGHVDH   
Sbjct: 5   VVPVTPFEQNCTLLIGDDG-SAAVTDPGGDIDRILSAARQQGARIEKILLTHGHVDHCAA 63

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           A  L+  L + I GPH+D+A  + ++  Q++       AR    DRWL+DGDT+      
Sbjct: 64  ADALRTQLGVPIEGPHRDEAFWIDQLPTQSQRFGF-PPARAFVPDRWLEDGDTVEAAGRT 122

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
            +VFHCPGH+PGHV++ +  +  A +GD LF  SIGRTD   G++  LI SI  K+ PLG
Sbjct: 123 LEVFHCPGHTPGHVVFFSRPDRIAIVGDVLFAGSIGRTDFPRGNHADLIRSIRTKLWPLG 182

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           D+++FV GHGP ST G ER  NP++  ++
Sbjct: 183 DDVTFVPGHGPVSTFGDERATNPYVADSL 211


>gi|83747433|ref|ZP_00944472.1| Hypothetical Protein RRSL_02814 [Ralstonia solanacearum UW551]
 gi|83725890|gb|EAP73029.1| Hypothetical Protein RRSL_02814 [Ralstonia solanacearum UW551]
          Length = 224

 Score =  192 bits (487), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 92/209 (44%), Positives = 131/209 (62%), Gaps = 2/209 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           +V VTPF+QNCT L  ++   A V DPGGD+D I    + +   +++I +THGHVDH   
Sbjct: 11  VVPVTPFEQNCTLLIGDDG-SAAVTDPGGDIDRILSAARQQGARIEKILLTHGHVDHCAA 69

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           A  L+  L + I GPH+D+A  + ++  Q++       AR    DRWL+DGDT+      
Sbjct: 70  ADALRTQLGVPIEGPHRDEAFWIDQLPTQSQRFGF-PPARAFVPDRWLEDGDTVEAAGRT 128

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
            +VFHCPGH+PGHV++ +  +  A +GD LF  SIGRTD   G++  LI SI  K+ PLG
Sbjct: 129 LEVFHCPGHTPGHVVFFSRPDRIAIVGDVLFAGSIGRTDFPRGNHADLIRSIRTKLWPLG 188

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           D+++FV GHGP ST G ER  NP++  ++
Sbjct: 189 DDVTFVPGHGPVSTFGDERATNPYVADSL 217


>gi|309780474|ref|ZP_07675222.1| metallo-beta-lactamase family protein [Ralstonia sp. 5_7_47FAA]
 gi|308920748|gb|EFP66397.1| metallo-beta-lactamase family protein [Ralstonia sp. 5_7_47FAA]
          Length = 218

 Score =  192 bits (487), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 93/209 (44%), Positives = 130/209 (62%), Gaps = 2/209 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           +V VTPF+QNCT L  ++   A V DPGGD+D I    Q     +++I +THGHVDH   
Sbjct: 5   VVPVTPFEQNCTLLIGDDG-AAAVTDPGGDIDRILAAAQQHGARIEKILLTHGHVDHCAA 63

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           A  L+  L + I GP KD+A  + ++  Q++       A+    DRWL+DGDT+      
Sbjct: 64  ADALRTQLGVPIEGPQKDEAFWIDQLPMQSQRFGFP-PAKAFVPDRWLEDGDTVEAAGRT 122

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
            +VFHCPGH+PGHV++ + E+  A +GD LF  SIGRTD   G++  LIN+I  K+ PLG
Sbjct: 123 LQVFHCPGHTPGHVVFFSAEDRVAIVGDVLFAGSIGRTDFPRGNHADLINAIRTKLWPLG 182

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           D+++FV GHGP ST G ER  NP++   +
Sbjct: 183 DDVTFVPGHGPVSTFGDERASNPYVADRL 211


>gi|229529649|ref|ZP_04419039.1| hydroxyacylglutathione hydrolase [Vibrio cholerae 12129(1)]
 gi|229333423|gb|EEN98909.1| hydroxyacylglutathione hydrolase [Vibrio cholerae 12129(1)]
 gi|327483958|gb|AEA78365.1| Hypothetical metal-binding enzyme, YcbL-like protein [Vibrio
           cholerae LMA3894-4]
          Length = 218

 Score =  191 bits (486), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 90/215 (41%), Positives = 129/215 (60%), Gaps = 2/215 (0%)

Query: 3   KLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHV 62
            L + +V VT F QNC+ ++ +E++E +VVDPGGD+  +  +I      V Q+ +THGH+
Sbjct: 2   SLQYQVVPVTAFAQNCSIVWCDETMEGIVVDPGGDVKQLAMLIAELGVKVTQLVLTHGHL 61

Query: 63  DHVGGAAQLKEDLSLT-IIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
           DHVGG   L + L  T ++GPHK D   +  ++ Q+++    +       D WL DGD +
Sbjct: 62  DHVGGTQSLAQALGGTRVVGPHKADNFWLQGLEGQSKMFGFPLT-EAFEPDEWLDDGDVI 120

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
             G    +V H PGH+PGHV+  +     A +GD LF  SIGRTD   GD+  LI SI N
Sbjct: 121 HFGQQTLQVIHTPGHTPGHVVLFSEAARLAFVGDVLFNGSIGRTDFPQGDFNTLIASIKN 180

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           K+ PLG +++F+ GHGP ST GRER  NPF+   +
Sbjct: 181 KLWPLGSDVTFIPGHGPQSTFGRERACNPFVADEM 215


>gi|311280159|ref|YP_003942390.1| beta-lactamase-like protein [Enterobacter cloacae SCF1]
 gi|308749354|gb|ADO49106.1| beta-lactamase-like protein [Enterobacter cloacae SCF1]
          Length = 215

 Score =  191 bits (486), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 85/213 (39%), Positives = 139/213 (65%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++ I+ VT F QNC+ ++ E++  A +VDPGGD + IK  + +    + QI +THGH+D
Sbjct: 1   MNYRIIPVTAFAQNCSLIWCEQTKLAALVDPGGDAEHIKQEVAAAGVTLMQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L +   + +IGP K+D   +  +  Q+R+  +  +    + DRWL +GDT+ +
Sbjct: 61  HVGAAAELAQHYGVPVIGPEKEDEFWLQGLPAQSRMFGLE-DCPPLTPDRWLNEGDTVSV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGHV++ +  +     GD +F+  +GR+D   G++ +LI SI  K+
Sbjct: 120 GNVSLQVLHCPGHTPGHVVFFDDASRLLISGDVIFKGGVGRSDFPRGNHAELIASIKQKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           +PLGD+++F+ GHGP ST+G ER+ NPFL+  +
Sbjct: 180 MPLGDDVTFIPGHGPLSTLGYERQHNPFLQDEM 212


>gi|127513197|ref|YP_001094394.1| beta-lactamase domain-containing protein [Shewanella loihica PV-4]
 gi|126638492|gb|ABO24135.1| beta-lactamase domain protein [Shewanella loihica PV-4]
          Length = 214

 Score =  191 bits (486), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 88/213 (41%), Positives = 134/213 (62%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + IV VTPF+QNC+ ++ E++ +A VVDPGGD++ I+  +      +++I +THGH+D
Sbjct: 1   MKYQIVPVTPFQQNCSIIWCEKTKQAAVVDPGGDIERIQQQLAHHGLTLEKILLTHGHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVGGA  L +   + IIGPHKDDA  +  + +Q++     +        ++L  GD + +
Sbjct: 61  HVGGAKALADAAGVPIIGPHKDDAFWLETLPQQSKHFGF-LPVAAFEPAQYLISGDRVTV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGH+++ +  +  A +GD LF+ SIGRTD     +  LINSI   +
Sbjct: 120 GEQTLEVLHCPGHTPGHIVFYSEADKLAWVGDVLFKGSIGRTDFPQSSHTDLINSITQVL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            PLG E+SF+ GHGP ST G ER+ NPF+   +
Sbjct: 180 WPLGREVSFIPGHGPISTFGAERQQNPFVADQL 212


>gi|322832250|ref|YP_004212277.1| hypothetical protein Rahaq_1528 [Rahnella sp. Y9602]
 gi|321167451|gb|ADW73150.1| hypothetical protein Rahaq_1528 [Rahnella sp. Y9602]
          Length = 215

 Score =  191 bits (486), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 84/213 (39%), Positives = 137/213 (64%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +  H++ VT F QNC+ ++  ++ +A +VDPGG+   I   + ++   V QI +THGH+D
Sbjct: 1   MKTHLITVTAFSQNCSLIWCAKTNQAAIVDPGGEAARIIQEVSAKGVLVTQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L     + +IGP K+D  ++  +  Q+++  +  +    + D WL++GD++ +
Sbjct: 61  HVGAAAELAAHYQVPVIGPQKEDEFLLDALPTQSQMFGLD-HCDPLTPDTWLEEGDSVSV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G  I  V HCPGH+PGH++++N +   A  GD +F+  +GR+D   GD+Q LI+SI  K+
Sbjct: 120 GEEILSVLHCPGHTPGHIVFINDKARIAVSGDVIFKGGVGRSDFPRGDHQALIHSIKTKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           LPLGD++ F+ GHGP S  G ER+ NPFL+  +
Sbjct: 180 LPLGDDMVFIPGHGPMSDFGYERKTNPFLQDEM 212


>gi|27366238|ref|NP_761766.1| hydroxyacylglutathione hydrolase [Vibrio vulnificus CMCP6]
 gi|27362439|gb|AAO11293.1| Hydroxyacylglutathione hydrolase [Vibrio vulnificus CMCP6]
          Length = 218

 Score =  191 bits (486), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 89/214 (41%), Positives = 134/214 (62%), Gaps = 2/214 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L + IV VTPF QNC+ ++ +++++ +V+DPGGD   +  +I+     V  + +THGH+D
Sbjct: 3   LKYQIVPVTPFAQNCSIVWCDDTMKGIVIDPGGDEKQLAVIIKELGVEVVNLVLTHGHLD 62

Query: 64  HVGGAAQLKEDL-SLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLL 122
           HVGG  +L E L  + I+GPHK D   +  ++ Q+++    +       ++WL DGD + 
Sbjct: 63  HVGGTERLAEMLDGIEIVGPHKADNFWLQGLEGQSQMFGFPL-TEAFEPNQWLNDGDEVC 121

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
            G  + +V H PGH+PGHV+  + E   A +GD LF  SIGRTD   GD+  LI SI NK
Sbjct: 122 FGNQVLQVLHTPGHTPGHVVLYSEEARRAFVGDVLFNGSIGRTDFPQGDFNTLIASIKNK 181

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           + PLG++++F+ GHGP ST G ERR NPF+   +
Sbjct: 182 LWPLGNDVTFIPGHGPESTFGHERRTNPFVADEM 215


>gi|37680297|ref|NP_934906.1| glyoxylase II family protein [Vibrio vulnificus YJ016]
 gi|37199044|dbj|BAC94877.1| glyoxylase II family protein [Vibrio vulnificus YJ016]
          Length = 238

 Score =  191 bits (485), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 89/214 (41%), Positives = 134/214 (62%), Gaps = 2/214 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L + IV VTPF QNC+ ++ +++++ +V+DPGGD   +  +I+     V  + +THGH+D
Sbjct: 23  LKYQIVPVTPFAQNCSIVWCDDTMKGIVIDPGGDEKQLAVIIKELGVEVVNLVLTHGHLD 82

Query: 64  HVGGAAQLKEDL-SLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLL 122
           HVGG  +L E L  + I+GPHK D   +  ++ Q+++    +       ++WL DGD + 
Sbjct: 83  HVGGTERLAEMLDGIEIVGPHKADNFWLQGLEGQSQMFGFPLT-EAFEPNQWLNDGDEVR 141

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
            G  + +V H PGH+PGHV+  + E   A +GD LF  SIGRTD   GD+  LI SI NK
Sbjct: 142 FGNQVLQVLHTPGHTPGHVVLYSEEARRAFVGDVLFNGSIGRTDFPQGDFNTLIASIKNK 201

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           + PLG++++F+ GHGP ST G ERR NPF+   +
Sbjct: 202 LWPLGNDVTFIPGHGPESTFGHERRTNPFVADEM 235


>gi|229521383|ref|ZP_04410802.1| hydroxyacylglutathione hydrolase [Vibrio cholerae TM 11079-80]
 gi|229341481|gb|EEO06484.1| hydroxyacylglutathione hydrolase [Vibrio cholerae TM 11079-80]
          Length = 218

 Score =  191 bits (485), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 90/215 (41%), Positives = 129/215 (60%), Gaps = 2/215 (0%)

Query: 3   KLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHV 62
            L + +V VT F QNC+ ++ +E++E +VVDPGGD+  +  +I      V Q+ +THGH+
Sbjct: 2   SLQYQVVPVTAFAQNCSIVWCDETMEGIVVDPGGDVKQLAMLIAELGVKVTQLVLTHGHL 61

Query: 63  DHVGGAAQLKEDLSLT-IIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
           DHVGG   L + L  T ++GPHK D   +  ++ Q+++    +       D WL DGD +
Sbjct: 62  DHVGGTQSLSQALGGTRVVGPHKADNFWLQGLEGQSKMFGFPLT-EAFEPDEWLDDGDVI 120

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
             G    +V H PGH+PGHV+  +     A +GD LF  SIGRTD   GD+  LI SI N
Sbjct: 121 HFGQQTLQVIHTPGHTPGHVVLFSEAARLAFVGDVLFNGSIGRTDFPQGDFNTLIASIKN 180

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           K+ PLG +++F+ GHGP ST GRER  NPF+   +
Sbjct: 181 KLWPLGSDVTFIPGHGPQSTFGRERASNPFVADEM 215


>gi|296103070|ref|YP_003613216.1| beta-lactamase-like protein [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
 gi|295057529|gb|ADF62267.1| beta-lactamase-like protein [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
          Length = 215

 Score =  191 bits (485), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 85/213 (39%), Positives = 137/213 (64%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++ I+ VT F QNC+ ++ E++  A +VDPGGD + IK  +      + QI +THGH+D
Sbjct: 1   MNYRIIPVTAFSQNCSLIWCEQTKLAALVDPGGDAEKIKQEVAESGVTLMQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L +   + +IGP K+D   +  +  Q+R+  +    +  + DRWL +G+ + +
Sbjct: 61  HVGAAAELAQHYGVPVIGPEKEDEFWLQGLPAQSRMFGLD-ECQPLTPDRWLNEGERVNV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGH+++ + ++     GD +F+  +GR+D   GD+ QLI SI  K+
Sbjct: 120 GNVTLQVLHCPGHTPGHIVFFDDQSRLLISGDVIFKGGVGRSDFPRGDHGQLIQSIKQKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           LPLGD+++F+ GHGP ST+G ER  NPFL+  +
Sbjct: 180 LPLGDDVTFIPGHGPMSTLGYERVHNPFLQDEM 212


>gi|114047006|ref|YP_737556.1| beta-lactamase domain-containing protein [Shewanella sp. MR-7]
 gi|113888448|gb|ABI42499.1| beta-lactamase domain protein [Shewanella sp. MR-7]
          Length = 214

 Score =  191 bits (485), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 89/213 (41%), Positives = 134/213 (62%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + I+ VTPF+QNC+ ++ E++  A VVDPGG++D I   +      ++++ +THGH+D
Sbjct: 1   MKYQIIPVTPFQQNCSLIWCEKTKRAAVVDPGGNVDRILGEMDKLGLTLEKVLLTHGHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVGGA  L +  ++ IIGPH+ D   +  + +Q++      +      D++LQDGD + +
Sbjct: 61  HVGGAKLLAQQTNVPIIGPHEADKFWIDNLPKQSQNFGFP-HCEAFEPDQYLQDGDVVTV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGH+PGHV + + E   A +GD LFRSSIGRTD    ++Q LI+SI  K+
Sbjct: 120 GEQSLSVLHCPGHTPGHVAFYSAEAKLAWVGDILFRSSIGRTDFPQSNHQSLIHSITTKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            PLG ++ F+ GHGP ST G ER  NPF+   +
Sbjct: 180 WPLGADVEFIPGHGPMSTFGEEREHNPFVADQL 212


>gi|207722180|ref|YP_002252617.1| beta-lactamase-like protein [Ralstonia solanacearum MolK2]
 gi|206587355|emb|CAQ17938.1| beta-lactamase-like protein [Ralstonia solanacearum MolK2]
          Length = 218

 Score =  191 bits (485), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 92/209 (44%), Positives = 131/209 (62%), Gaps = 2/209 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           +V VTPF+QNCT L  ++   A V DPGGD+D I    + +   +++I +THGHVDH   
Sbjct: 5   VVPVTPFEQNCTLLIGDDG-SAAVTDPGGDIDRILSAARQQGARIEKILLTHGHVDHCAA 63

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           A  L+  L + I GPH+D+A  + ++  Q++       AR    DRWL+DGDT+      
Sbjct: 64  ADALRTQLGVPIEGPHRDEAFWIDQLPTQSQRFGF-PPARAFVPDRWLEDGDTVEAAGCT 122

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
            +VFHCPGH+PGHV++ +  +  A +GD LF  SIGRTD   G++  LI SI  K+ PLG
Sbjct: 123 LEVFHCPGHTPGHVVFFSRPDRIAIVGDVLFAGSIGRTDFPRGNHADLIRSIRTKLWPLG 182

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           D+++FV GHGP ST G ER  NP++  ++
Sbjct: 183 DDVTFVPGHGPVSTFGDERATNPYVADSL 211


>gi|308049064|ref|YP_003912630.1| beta-lactamase domain protein [Ferrimonas balearica DSM 9799]
 gi|307631254|gb|ADN75556.1| beta-lactamase domain protein [Ferrimonas balearica DSM 9799]
          Length = 215

 Score =  191 bits (485), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 88/213 (41%), Positives = 134/213 (62%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + I+ VTPF+QNC+ ++ E++L+  V+DPGGD++ I+ VIQ R   V+++ +THGH+D
Sbjct: 1   MKYQIIPVTPFQQNCSLVWCEKTLKGAVIDPGGDVERIQAVIQERGITVEKVLLTHGHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GGA  L + L + I GPHK D   +  +  Q+++    + A   +  R+L+DGD +  
Sbjct: 61  HAGGADVLAQALEVGIEGPHKADQFWIDGLAHQSQMFGFPVIA-TFTPGRYLEDGDVIEF 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V H PGH+PGHV++ +     A +GD LF  SIGRTD    D+  L++SI  K+
Sbjct: 120 GEERLEVLHTPGHTPGHVVFFHRGEKLAFVGDVLFHGSIGRTDFPQSDHPSLLSSITQKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            PLG ++ FV GHGP +T   ERR NPF+   +
Sbjct: 180 WPLGSDVYFVPGHGPGATFADERRSNPFVADQV 212


>gi|15641283|ref|NP_230915.1| glyoxylase II family protein [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|121591907|ref|ZP_01679055.1| glyoxylase II family protein [Vibrio cholerae 2740-80]
 gi|153212253|ref|ZP_01948041.1| glyoxylase II family protein [Vibrio cholerae 1587]
 gi|153801335|ref|ZP_01955921.1| glyoxylase II family protein [Vibrio cholerae MZO-3]
 gi|227081442|ref|YP_002809993.1| glyoxylase II family protein [Vibrio cholerae M66-2]
 gi|229505143|ref|ZP_04394653.1| hydroxyacylglutathione hydrolase [Vibrio cholerae BX 330286]
 gi|229511185|ref|ZP_04400664.1| hydroxyacylglutathione hydrolase [Vibrio cholerae B33]
 gi|229515645|ref|ZP_04405104.1| hydroxyacylglutathione hydrolase [Vibrio cholerae TMA 21]
 gi|229518304|ref|ZP_04407748.1| hydroxyacylglutathione hydrolase [Vibrio cholerae RC9]
 gi|229608163|ref|YP_002878811.1| hydroxyacylglutathione hydrolase [Vibrio cholerae MJ-1236]
 gi|254226412|ref|ZP_04919999.1| glyoxylase II family protein [Vibrio cholerae V51]
 gi|254291721|ref|ZP_04962508.1| glyoxylase II family protein [Vibrio cholerae AM-19226]
 gi|254848394|ref|ZP_05237744.1| glyoxylase II family protein [Vibrio cholerae MO10]
 gi|255745666|ref|ZP_05419614.1| hydroxyacylglutathione hydrolase [Vibrio cholera CIRS 101]
 gi|262159057|ref|ZP_06030169.1| hydroxyacylglutathione hydrolase [Vibrio cholerae INDRE 91/1]
 gi|297578862|ref|ZP_06940790.1| glyoxylase II family protein [Vibrio cholerae RC385]
 gi|298498638|ref|ZP_07008445.1| glyoxylase II family protein [Vibrio cholerae MAK 757]
 gi|9655755|gb|AAF94429.1| glyoxylase II family protein [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|121546234|gb|EAX56546.1| glyoxylase II family protein [Vibrio cholerae 2740-80]
 gi|124116631|gb|EAY35451.1| glyoxylase II family protein [Vibrio cholerae 1587]
 gi|124123160|gb|EAY41903.1| glyoxylase II family protein [Vibrio cholerae MZO-3]
 gi|125621034|gb|EAZ49381.1| glyoxylase II family protein [Vibrio cholerae V51]
 gi|150422405|gb|EDN14365.1| glyoxylase II family protein [Vibrio cholerae AM-19226]
 gi|227009330|gb|ACP05542.1| glyoxylase II family protein [Vibrio cholerae M66-2]
 gi|229345019|gb|EEO09993.1| hydroxyacylglutathione hydrolase [Vibrio cholerae RC9]
 gi|229347414|gb|EEO12374.1| hydroxyacylglutathione hydrolase [Vibrio cholerae TMA 21]
 gi|229351150|gb|EEO16091.1| hydroxyacylglutathione hydrolase [Vibrio cholerae B33]
 gi|229357366|gb|EEO22283.1| hydroxyacylglutathione hydrolase [Vibrio cholerae BX 330286]
 gi|229370818|gb|ACQ61241.1| hydroxyacylglutathione hydrolase [Vibrio cholerae MJ-1236]
 gi|254844099|gb|EET22513.1| glyoxylase II family protein [Vibrio cholerae MO10]
 gi|255736741|gb|EET92138.1| hydroxyacylglutathione hydrolase [Vibrio cholera CIRS 101]
 gi|262029242|gb|EEY47894.1| hydroxyacylglutathione hydrolase [Vibrio cholerae INDRE 91/1]
 gi|297536456|gb|EFH75289.1| glyoxylase II family protein [Vibrio cholerae RC385]
 gi|297542971|gb|EFH79021.1| glyoxylase II family protein [Vibrio cholerae MAK 757]
          Length = 218

 Score =  191 bits (485), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 90/215 (41%), Positives = 129/215 (60%), Gaps = 2/215 (0%)

Query: 3   KLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHV 62
            L + +V VT F QNC+ ++ +E++E +VVDPGGD+  +  +I      V Q+ +THGH+
Sbjct: 2   SLQYQVVPVTAFAQNCSIVWCDETMEGIVVDPGGDVKQLAMLIAELGVKVTQLVLTHGHL 61

Query: 63  DHVGGAAQLKEDLSLT-IIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
           DHVGG   L + L  T ++GPHK D   +  ++ Q+++    +       D WL DGD +
Sbjct: 62  DHVGGTQSLAQALGGTRVVGPHKADNFWLQGLEGQSKMFGFPLT-EAFEPDEWLDDGDVI 120

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
             G    +V H PGH+PGHV+  +     A +GD LF  SIGRTD   GD+  LI SI N
Sbjct: 121 HFGQQTLQVIHTPGHTPGHVVLFSEAARLAFVGDVLFNGSIGRTDFPQGDFNTLIASIKN 180

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           K+ PLG +++F+ GHGP ST GRER  NPF+   +
Sbjct: 181 KLWPLGSDVTFIPGHGPQSTFGRERASNPFVADEM 215


>gi|121729965|ref|ZP_01682384.1| glyoxylase II family protein [Vibrio cholerae V52]
 gi|147675111|ref|YP_001216835.1| glyoxylase II family protein [Vibrio cholerae O395]
 gi|262169416|ref|ZP_06037108.1| hydroxyacylglutathione hydrolase [Vibrio cholerae RC27]
 gi|121628286|gb|EAX60797.1| glyoxylase II family protein [Vibrio cholerae V52]
 gi|146316994|gb|ABQ21533.1| glyoxylase II family protein [Vibrio cholerae O395]
 gi|227013187|gb|ACP09397.1| glyoxylase II family protein [Vibrio cholerae O395]
 gi|262022229|gb|EEY40938.1| hydroxyacylglutathione hydrolase [Vibrio cholerae RC27]
          Length = 218

 Score =  191 bits (485), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 90/215 (41%), Positives = 129/215 (60%), Gaps = 2/215 (0%)

Query: 3   KLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHV 62
            L + +V VT F QNC+ ++ +E++E +VVDPGGD+  +  +I      V Q+ +THGH+
Sbjct: 2   SLQYQVVPVTAFAQNCSIVWCDETMEGIVVDPGGDVKQLAILIAELGVKVTQLVLTHGHL 61

Query: 63  DHVGGAAQLKEDLSLT-IIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
           DHVGG   L + L  T ++GPHK D   +  ++ Q+++    +       D WL DGD +
Sbjct: 62  DHVGGTQSLAQALGGTRVVGPHKADNFWLQGLEGQSKMFGFPLT-EAFEPDEWLDDGDVI 120

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
             G    +V H PGH+PGHV+  +     A +GD LF  SIGRTD   GD+  LI SI N
Sbjct: 121 HFGQQTLQVIHTPGHTPGHVVLFSEAARLAFVGDVLFNGSIGRTDFPQGDFNTLIASIKN 180

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           K+ PLG +++F+ GHGP ST GRER  NPF+   +
Sbjct: 181 KLWPLGSDVTFIPGHGPQSTFGRERASNPFVADEM 215


>gi|315180001|gb|ADT86915.1| glyoxylase II family protein [Vibrio furnissii NCTC 11218]
          Length = 218

 Score =  191 bits (484), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 91/215 (42%), Positives = 133/215 (61%), Gaps = 2/215 (0%)

Query: 3   KLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHV 62
            L + IV VTPF QNC+ ++ +E+++ +VVDPGGD+  +K +I     +V ++ +THGH+
Sbjct: 2   SLKYQIVPVTPFAQNCSIVWCDETMDGIVVDPGGDVKQLKMMIDELGVNVVKLVLTHGHL 61

Query: 63  DHVGGAAQLKEDLS-LTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
           DHVGG   L   L  + IIGPHKDD   +  ++ Q+++    +      +  WL +GDT+
Sbjct: 62  DHVGGTEPLAALLGGIDIIGPHKDDNFWLQGLEGQSQMFGFPLTEAFEPT-AWLDEGDTI 120

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
             G     V H PGH+PGHV+  + E   A +GD LF  +IGRTD   GD+  LI SI  
Sbjct: 121 TFGHQTLNVLHTPGHTPGHVVLFSDEARLAFVGDVLFNGAIGRTDFPRGDFNTLITSIKT 180

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           K+ PLG++++F+ GHGP ST GRER  NPF+   +
Sbjct: 181 KLWPLGNDVTFIPGHGPTSTFGRERASNPFVADEM 215


>gi|161503874|ref|YP_001570986.1| hypothetical protein SARI_01963 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|160865221|gb|ABX21844.1| hypothetical protein SARI_01963 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 215

 Score =  191 bits (484), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 85/213 (39%), Positives = 138/213 (64%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++ I+ VT F QNC+ ++ E++  A +VDPGGD + IK  + +    + QI +THGH+D
Sbjct: 1   MNYRIIPVTAFSQNCSLIWCEQTRLAALVDPGGDAEKIKQEVDASGVTLMQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG A++L +   + +IGP K+D   +  +  Q+R+  +    +  + DRWL +GD + +
Sbjct: 61  HVGAASELAQHYGVPVIGPEKEDEFWLQGLPAQSRMFGLD-ECQPLTPDRWLSEGDRISV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGHV++ + ++     GD +F+  +GR+D   GD+ QLI+ I  K+
Sbjct: 120 GNVNLQVLHCPGHTPGHVVFFDEQSQLLISGDVIFKGGVGRSDFPRGDHNQLIDVIKRKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           LPLGD+++F+ GHGP ST+G ER  NPFL+  +
Sbjct: 180 LPLGDDVTFIPGHGPLSTLGYERLHNPFLQDEV 212


>gi|153823870|ref|ZP_01976537.1| glyoxylase II family protein [Vibrio cholerae B33]
 gi|126518612|gb|EAZ75835.1| glyoxylase II family protein [Vibrio cholerae B33]
          Length = 212

 Score =  191 bits (484), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 90/212 (42%), Positives = 128/212 (60%), Gaps = 2/212 (0%)

Query: 3   KLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHV 62
            L + +V VT F QNC+ ++ +E++E +VVDPGGD+  +  +I      V Q+ +THGH+
Sbjct: 2   SLQYQVVPVTAFAQNCSIVWCDETMEGIVVDPGGDVKQLAMLIAELGVKVTQLVLTHGHL 61

Query: 63  DHVGGAAQLKEDLSLT-IIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
           DHVGG   L + L  T ++GPHK D   +  ++ Q+++    +       D WL DGD +
Sbjct: 62  DHVGGTQSLAQALGGTRVVGPHKADNFWLQGLEGQSKMFGFPLT-EAFEPDEWLDDGDVI 120

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
             G    +V H PGH+PGHV+  +     A +GD LF  SIGRTD   GD+  LI SI N
Sbjct: 121 HFGQQTLQVIHTPGHTPGHVVLFSEAARLAFVGDVLFNGSIGRTDFPQGDFNTLIASIKN 180

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           K+ PLG +++F+ GHGP ST GRER  NPF+ 
Sbjct: 181 KLWPLGSDVTFIPGHGPQSTFGRERASNPFVA 212


>gi|320156747|ref|YP_004189126.1| hypothetical protein VVM_03483 [Vibrio vulnificus MO6-24/O]
 gi|319932059|gb|ADV86923.1| hypothetical metal-binding enzyme YcbL-like protein [Vibrio
           vulnificus MO6-24/O]
          Length = 218

 Score =  191 bits (484), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 89/214 (41%), Positives = 134/214 (62%), Gaps = 2/214 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L + IV VTPF QNC+ ++ +++++ +V+DPGGD   +  +I+     V  + +THGH+D
Sbjct: 3   LKYQIVPVTPFAQNCSIVWCDDTMKGIVIDPGGDEKQLAVIIKELGVEVVNLVLTHGHLD 62

Query: 64  HVGGAAQLKEDL-SLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLL 122
           HVGG  +L E L  + I+GPHK D   +  ++ Q+++    +       ++WL DGD + 
Sbjct: 63  HVGGTERLAEMLDGIEIVGPHKADNFWLQGLEGQSQMFGFPL-TEAFEPNQWLNDGDEVR 121

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
            G  + +V H PGH+PGHV+  + E   A +GD LF  SIGRTD   GD+  LI SI NK
Sbjct: 122 FGNQVLQVLHTPGHTPGHVVLYSEEARRAFVGDVLFNGSIGRTDFPQGDFNTLIASIKNK 181

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           + PLG++++F+ GHGP ST G ERR NPF+   +
Sbjct: 182 LWPLGNDVTFIPGHGPESTFGHERRTNPFVADEM 215


>gi|154253559|ref|YP_001414383.1| beta-lactamase domain-containing protein [Parvibaculum
           lavamentivorans DS-1]
 gi|154157509|gb|ABS64726.1| beta-lactamase domain protein [Parvibaculum lavamentivorans DS-1]
          Length = 216

 Score =  191 bits (484), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 90/209 (43%), Positives = 129/209 (61%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L   I+ VTPF+QNCT ++++E++   V DPGGDL+ IK         +++I +THGH+D
Sbjct: 3   LKAAILPVTPFQQNCTLMWNDENMRGAVSDPGGDLERIKAAAAEAGVTIEKILLTHGHLD 62

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H   A  L  +L + + GPH+DD  ++  + +QA              DRWL+DGD +  
Sbjct: 63  HASAAGDLARELGVPVEGPHEDDLFLIEALPDQAAKYGFP-PVGAFRPDRWLKDGDQVTF 121

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
               F V HCPGH+PGHV++ +  +  A +GD LF+ SIGRTD   GD+  L+ SI  ++
Sbjct: 122 AGLTFDVRHCPGHTPGHVVFFHEPSRLAIVGDVLFQGSIGRTDFPRGDHGALVRSIRERL 181

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
            PLGD+++FV GHGP ST G ERR NPF+
Sbjct: 182 WPLGDDVTFVPGHGPLSTFGVERRTNPFV 210


>gi|17547985|ref|NP_521387.1| hypothetical protein RSc3268 [Ralstonia solanacearum GMI1000]
 gi|17430291|emb|CAD17056.1| putative beta-lactamase-like protein [Ralstonia solanacearum
           GMI1000]
          Length = 224

 Score =  191 bits (484), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 92/209 (44%), Positives = 129/209 (61%), Gaps = 2/209 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           +V VTPF+QNCT L  ++   A V DPGGD+D I    + +   +++I +THGHVDH   
Sbjct: 11  VVPVTPFEQNCTLLIGDDG-RAAVTDPGGDIDRILSAARQQGARIEKILLTHGHVDHCAA 69

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           A  L+  L + I GPH+D+A  + ++  Q++       AR    DRWL DGDT+      
Sbjct: 70  ADALRTQLGVPIEGPHRDEAFWIDQLPTQSQRFGF-PPARAFVPDRWLDDGDTVEAAGRT 128

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
            +VFHCPGH+PGHV++ +  +  A +GD LF  SIGRTD   G++  LI SI  K+ PLG
Sbjct: 129 LEVFHCPGHTPGHVVFFSRPDRIAIVGDVLFAGSIGRTDFPRGNHADLIRSIRTKLWPLG 188

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           D+++FV GHGP ST G ER  NP++   +
Sbjct: 189 DDVTFVPGHGPVSTFGDERATNPYVADRL 217


>gi|113969777|ref|YP_733570.1| beta-lactamase domain-containing protein [Shewanella sp. MR-4]
 gi|113884461|gb|ABI38513.1| beta-lactamase domain protein [Shewanella sp. MR-4]
          Length = 214

 Score =  191 bits (484), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 89/213 (41%), Positives = 134/213 (62%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + I+ VTPF+QNC+ ++ E++  A VVDPGG++D I   +      ++++ +THGH+D
Sbjct: 1   MKYQIIPVTPFQQNCSLIWCEKTKRAAVVDPGGNVDRILGEMDKLGLTLEKVLLTHGHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVGGA  L +  ++ IIGPH+ D   +  + +Q++      +      D++LQDGD + +
Sbjct: 61  HVGGAKLLAQQTNVPIIGPHEADKFWIDNLPKQSQNFGFP-HCEAFEPDQYLQDGDVVTV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGH+PGHV + + E   A +GD LFRSSIGRTD    ++Q LI+SI  K+
Sbjct: 120 GEQNLSVLHCPGHTPGHVAFYSAEAKLAWVGDILFRSSIGRTDFPQSNHQSLIHSITTKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            PLG ++ F+ GHGP ST G ER  NPF+   +
Sbjct: 180 WPLGADVEFIPGHGPMSTFGEEREHNPFVADQL 212


>gi|258620188|ref|ZP_05715227.1| glyoxylase II family protein [Vibrio mimicus VM573]
 gi|258587546|gb|EEW12256.1| glyoxylase II family protein [Vibrio mimicus VM573]
          Length = 218

 Score =  190 bits (483), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 91/215 (42%), Positives = 130/215 (60%), Gaps = 2/215 (0%)

Query: 3   KLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHV 62
            L + +V VT F QNC+ ++ +E++E VVVDPGGD+  +  +I      V Q+ +THGH+
Sbjct: 2   SLQYQVVPVTAFSQNCSIVWCDETMEGVVVDPGGDVKQLAMLIAGLGVKVTQLVLTHGHL 61

Query: 63  DHVGGAAQLKEDLSLT-IIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
           DHVGG   L E L  T I+GPHK D   +  ++ Q+++    +        +WL DGD +
Sbjct: 62  DHVGGTEPLAEALGGTRIVGPHKADNFWLQGLEGQSKMFGFPLT-EAFEPHQWLNDGDVV 120

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
             G    +V H PGH+PGHV+  +     A +GD LF  SIGRTD   GD+  LI SI N
Sbjct: 121 TFGKQTLQVLHTPGHTPGHVVLFSDSARLAFVGDVLFNGSIGRTDFPQGDFNTLIASIKN 180

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           K+ PLG++++F+ GHGP ST GRER  NP++   +
Sbjct: 181 KLWPLGNDVTFIPGHGPKSTFGRERANNPYVADEM 215


>gi|323492994|ref|ZP_08098131.1| hypothetical protein VIBR0546_16226 [Vibrio brasiliensis LMG 20546]
 gi|323312773|gb|EGA65900.1| hypothetical protein VIBR0546_16226 [Vibrio brasiliensis LMG 20546]
          Length = 218

 Score =  190 bits (483), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 90/214 (42%), Positives = 131/214 (61%), Gaps = 2/214 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L + +V VT F QNC+ ++ ++++E +VVDPGGD+  +  +I+     V  + +THGH+D
Sbjct: 3   LKYQVVPVTSFSQNCSIVWCDQTMEGIVVDPGGDVKQLAMLIKELGVKVVNLVLTHGHLD 62

Query: 64  HVGGAAQLKEDLS-LTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLL 122
           HVGG   L  +L  + IIGPHKDD   +  ++ Q+++    +       ++WL DGD + 
Sbjct: 63  HVGGTEPLSRELGDIEIIGPHKDDNFWLQGLEGQSQMFGFPL-TEAFEPNQWLNDGDKIT 121

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
            G     V H PGH+PGHV+  + E   A +GD LF  S+GRTD   GD+  LINSI  K
Sbjct: 122 FGQQTMDVIHTPGHTPGHVVLFSQEAKLAFVGDVLFNGSVGRTDFPKGDFDTLINSIKTK 181

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           + PLG+++ FV GHGP ST GRER  NPF+   +
Sbjct: 182 LWPLGNDVRFVPGHGPESTFGRERASNPFVADEM 215


>gi|258543469|ref|YP_003188902.1| metallo-beta-lactamase [Acetobacter pasteurianus IFO 3283-01]
 gi|256634547|dbj|BAI00523.1| metallo-beta-lactamase [Acetobacter pasteurianus IFO 3283-01]
 gi|256637605|dbj|BAI03574.1| metallo-beta-lactamase [Acetobacter pasteurianus IFO 3283-03]
 gi|256640657|dbj|BAI06619.1| metallo-beta-lactamase [Acetobacter pasteurianus IFO 3283-07]
 gi|256643714|dbj|BAI09669.1| metallo-beta-lactamase [Acetobacter pasteurianus IFO 3283-22]
 gi|256646769|dbj|BAI12717.1| metallo-beta-lactamase [Acetobacter pasteurianus IFO 3283-26]
 gi|256649822|dbj|BAI15763.1| metallo-beta-lactamase [Acetobacter pasteurianus IFO 3283-32]
 gi|256652810|dbj|BAI18744.1| metallo-beta-lactamase [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256655866|dbj|BAI21793.1| metallo-beta-lactamase [Acetobacter pasteurianus IFO 3283-12]
          Length = 223

 Score =  190 bits (483), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 96/216 (44%), Positives = 139/216 (64%), Gaps = 7/216 (3%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +   IV VTPF+QNC+ L+ E++ +AV+VD GGD+D++ D ++     V+ I +THGH+D
Sbjct: 8   MQLRIVPVTPFRQNCSVLWHEKTRKAVIVDAGGDVDVLLDFLKKNILEVEAILLTHGHLD 67

Query: 64  HVGGAAQLKEDLSLT------IIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQD 117
           H GG A L   L  T      ++GP+  D  ++  + EQAR   +  +  NA  DR+ +D
Sbjct: 68  HAGGVAALCRGLENTQKTQPDVVGPNIHDQFLLQSIVEQARHFGLS-DLENADVDRFTED 126

Query: 118 GDTLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLIN 177
           G++L      F+V H PGH+PGHV++V+ +  FA +GD LFR +IGRTD  +G+ QQLI 
Sbjct: 127 GESLNYLGCTFRVVHVPGHTPGHVVFVDEKARFAFVGDVLFRGTIGRTDFAYGNSQQLIQ 186

Query: 178 SINNKILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
            I  K+LPLGD+I  V GHG  +T+G ER  NPFL+
Sbjct: 187 GIKEKLLPLGDDIVIVPGHGGLTTLGAERASNPFLQ 222


>gi|16759866|ref|NP_455483.1| hypothetical protein STY0999 [Salmonella enterica subsp. enterica
           serovar Typhi str. CT18]
 gi|29142361|ref|NP_805703.1| hypothetical protein t1937 [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|213160798|ref|ZP_03346508.1| hypothetical protein Salmoneentericaenterica_12368 [Salmonella
           enterica subsp. enterica serovar Typhi str. E00-7866]
 gi|213581707|ref|ZP_03363533.1| hypothetical protein SentesTyph_11074 [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-0664]
 gi|213620685|ref|ZP_03373468.1| hypothetical protein SentesTyp_25617 [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-2068]
 gi|213650526|ref|ZP_03380579.1| hypothetical protein SentesTy_26783 [Salmonella enterica subsp.
           enterica serovar Typhi str. J185]
 gi|213852478|ref|ZP_03382010.1| hypothetical protein SentesT_06134 [Salmonella enterica subsp.
           enterica serovar Typhi str. M223]
 gi|289825303|ref|ZP_06544575.1| hypothetical protein Salmonellentericaenterica_07921 [Salmonella
           enterica subsp. enterica serovar Typhi str. E98-3139]
 gi|25311010|pir||AC0616 conserved hypothetical protein ycbL [imported] - Salmonella
           enterica subsp. enterica serovar Typhi (strain CT18)
 gi|16502159|emb|CAD05397.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Typhi]
 gi|29137991|gb|AAO69552.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
          Length = 215

 Score =  190 bits (483), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 85/213 (39%), Positives = 138/213 (64%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++ I+ VT F QNC+ ++ E++  A +VDPGGD + IK  + +    + QI +THGH+D
Sbjct: 1   MNYRIIPVTAFSQNCSLIWCEQTRLAALVDPGGDAEKIKQEVDASGVTLMQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG A++L +   + +IGP K+D   +  +  Q+R+  +    +  + DRWL DGD + +
Sbjct: 61  HVGAASELAQHYGVPVIGPEKEDEFWLQGLPAQSRMFGLD-ECQPLTPDRWLNDGDRVSV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGHV++ + ++     GD +F+  +GR+D   GD+ QLI++I  K+
Sbjct: 120 GNVTLQVLHCPGHTPGHVVFFDEQSQLLISGDVIFKGGVGRSDFPRGDHTQLIDAIKRKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           LPLGD+++F+ GHGP ST+G ER  N FL+  +
Sbjct: 180 LPLGDDVTFIPGHGPLSTLGYERLHNSFLQDEM 212


>gi|260768293|ref|ZP_05877227.1| hydroxyacylglutathione hydrolase [Vibrio furnissii CIP 102972]
 gi|260616323|gb|EEX41508.1| hydroxyacylglutathione hydrolase [Vibrio furnissii CIP 102972]
          Length = 218

 Score =  190 bits (483), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 90/215 (41%), Positives = 133/215 (61%), Gaps = 2/215 (0%)

Query: 3   KLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHV 62
            L + IV VTPF QNC+ ++ +E+++ +VVDPGGD+  +K ++     +V ++ +THGH+
Sbjct: 2   SLKYQIVPVTPFAQNCSIVWCDETMDGIVVDPGGDVKQLKMMVDELGVNVVKLVLTHGHL 61

Query: 63  DHVGGAAQLKEDLS-LTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
           DHVGG   L   L  + IIGPHKDD   +  ++ Q+++    +      +  WL +GDT+
Sbjct: 62  DHVGGTEPLAALLGGIDIIGPHKDDNFWLQGLEGQSQMFGFPLTEAFEPT-AWLDEGDTI 120

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
             G     V H PGH+PGHV+  + E   A +GD LF  +IGRTD   GD+  LI SI  
Sbjct: 121 TFGHQTLNVLHTPGHTPGHVVLFSDEARLAFVGDVLFNGAIGRTDFPRGDFNTLITSIKT 180

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           K+ PLG++++F+ GHGP ST GRER  NPF+   +
Sbjct: 181 KLWPLGNDVTFIPGHGPTSTFGRERASNPFVADEM 215


>gi|258624452|ref|ZP_05719399.1| glyoxylase II family protein [Vibrio mimicus VM603]
 gi|258583299|gb|EEW08101.1| glyoxylase II family protein [Vibrio mimicus VM603]
          Length = 218

 Score =  190 bits (483), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 91/215 (42%), Positives = 130/215 (60%), Gaps = 2/215 (0%)

Query: 3   KLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHV 62
            L + +V VT F QNC+ ++ +E++E VVVDPGGD+  +  +I      V Q+ +THGH+
Sbjct: 2   SLQYQVVPVTAFSQNCSIVWCDETMEGVVVDPGGDVKQLAMLIAELGVKVTQLVLTHGHL 61

Query: 63  DHVGGAAQLKEDLSLT-IIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
           DHVGG   L E L  T I+GPHK D   +  ++ Q+++    +        +WL DGD +
Sbjct: 62  DHVGGTEPLAEALGGTRIVGPHKADNFWLQGLEGQSKMFGFPLT-EAFEPHQWLNDGDVV 120

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
             G    +V H PGH+PGHV+  +     A +GD LF  SIGRTD   GD+  LI SI N
Sbjct: 121 TFGKQTLQVLHTPGHTPGHVVLFSDSARLAFVGDVLFNGSIGRTDFPQGDFNTLIASIKN 180

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           K+ PLG++++F+ GHGP ST GRER  NP++   +
Sbjct: 181 KLWPLGNDVTFIPGHGPKSTFGRERANNPYVADEM 215


>gi|229525869|ref|ZP_04415274.1| hydroxyacylglutathione hydrolase [Vibrio cholerae bv. albensis
           VL426]
 gi|229339450|gb|EEO04467.1| hydroxyacylglutathione hydrolase [Vibrio cholerae bv. albensis
           VL426]
          Length = 218

 Score =  190 bits (482), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 89/215 (41%), Positives = 129/215 (60%), Gaps = 2/215 (0%)

Query: 3   KLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHV 62
            L + +V VT F QNC+ ++ +E++E +VVDPGGD+  +  +I      V Q+ +THGH+
Sbjct: 2   SLQYQVVPVTAFAQNCSIVWCDETMEGIVVDPGGDVKQLAMLIAELGVKVTQLVLTHGHL 61

Query: 63  DHVGGAAQLKEDLSLT-IIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
           DHVGG   L + L  T ++GPHK D   +  ++ Q+++    +       D WL DGD +
Sbjct: 62  DHVGGTQSLSQALGGTRVVGPHKADNFWLQGLEGQSKMFGFPLT-EAFEPDEWLDDGDVI 120

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
             G    +V H PGH+PGHV+  +     A +GD LF  SIGRTD   GD+  L+ SI N
Sbjct: 121 HFGQQTLQVIHTPGHTPGHVVLFSEAARLAFVGDVLFNGSIGRTDFPQGDFNTLMASIKN 180

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           K+ PLG +++F+ GHGP ST GRER  NPF+   +
Sbjct: 181 KLWPLGSDVTFIPGHGPQSTFGRERASNPFVADEM 215


>gi|241664717|ref|YP_002983077.1| beta-lactamase domain-containing protein [Ralstonia pickettii 12D]
 gi|240866744|gb|ACS64405.1| beta-lactamase domain protein [Ralstonia pickettii 12D]
          Length = 218

 Score =  189 bits (481), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 92/209 (44%), Positives = 129/209 (61%), Gaps = 2/209 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           +V VTPF+QNCT L  ++   A V DPGGD+D I    Q     +++I +THGHVDH   
Sbjct: 5   VVPVTPFEQNCTLLIGDDG-AAAVTDPGGDIDRILAAAQQHGARIEKILLTHGHVDHCAA 63

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           A  L+  L + I GP KD+A  + ++  Q++       A+    DRWL+DGDT+      
Sbjct: 64  ADALRTQLGVPIEGPQKDEAFWIDQLPMQSQRFGFP-PAKAFVPDRWLEDGDTVEAAGRT 122

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
            +VFHCPGH+PGHV++ + E+  A +GD LF  SIGRTD   G++  LI +I  K+ PLG
Sbjct: 123 LQVFHCPGHTPGHVVFFSAEDRVAIVGDVLFAGSIGRTDFPRGNHADLIKAIRTKLWPLG 182

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           D+++FV GHGP ST G ER  NP++   +
Sbjct: 183 DDVTFVPGHGPVSTFGDERASNPYVADRL 211


>gi|153829600|ref|ZP_01982267.1| glyoxylase II family protein [Vibrio cholerae 623-39]
 gi|148874934|gb|EDL73069.1| glyoxylase II family protein [Vibrio cholerae 623-39]
          Length = 218

 Score =  189 bits (480), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 89/215 (41%), Positives = 129/215 (60%), Gaps = 2/215 (0%)

Query: 3   KLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHV 62
            L + +V VT F QNC+ ++ ++++E +VVDPGGD+  +  +I      V Q+ +THGH+
Sbjct: 2   SLQYQVVPVTAFAQNCSIVWCDDTMEGIVVDPGGDVKQLAMLIAELGVKVTQLVLTHGHL 61

Query: 63  DHVGGAAQLKEDLSLT-IIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
           DHVGG   L + L  T ++GPHK D   +  ++ Q+++    +       D WL DGD +
Sbjct: 62  DHVGGTQSLAQALGGTRVVGPHKADNFWLQGLEGQSKMFGFPLT-EAFEPDEWLDDGDVI 120

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
             G    +V H PGH+PGHV+  +     A +GD LF  SIGRTD   GD+  LI SI N
Sbjct: 121 HFGQQTLQVIHTPGHTPGHVVLFSEAARLAFVGDVLFNGSIGRTDFPQGDFNTLIASIKN 180

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           K+ PLG +++F+ GHGP ST GRER  NPF+   +
Sbjct: 181 KLWPLGSDVTFIPGHGPQSTFGRERASNPFVADEM 215


>gi|167624548|ref|YP_001674842.1| beta-lactamase domain-containing protein [Shewanella halifaxensis
           HAW-EB4]
 gi|167354570|gb|ABZ77183.1| beta-lactamase domain protein [Shewanella halifaxensis HAW-EB4]
          Length = 214

 Score =  189 bits (480), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 85/213 (39%), Positives = 141/213 (66%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + ++ VTPF+QNC+ ++ E++++A VVDPGG+++ I +     N  ++++ +THGH+D
Sbjct: 1   MKYQLIPVTPFQQNCSLIWCEQTMKAAVVDPGGNVERILEQASKNNLVIEKVLLTHGHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVGGA  L + L++ IIGPHK D   +  + +Q++     ++    +  ++L++GD + +
Sbjct: 61  HVGGAKLLADQLNVPIIGPHKADDYWLESLPKQSQHFGF-VHCDAFTPTQYLEEGDEVTV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G  + KV H PGH+PGH+++   E+  A +GD LFR SIGRTD    ++Q LI+SI  K+
Sbjct: 120 GQQVLKVIHTPGHTPGHIVFFAKESKVAWVGDVLFRGSIGRTDFPLSNHQDLIDSITQKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            PLG+++ F+ GHGP ST G ER  NPF+   +
Sbjct: 180 WPLGNDVQFIPGHGPLSTFGDERVQNPFVADQL 212


>gi|254427186|ref|ZP_05040893.1| metallo-beta-lactamase superfamily, putative [Alcanivorax sp.
           DG881]
 gi|196193355|gb|EDX88314.1| metallo-beta-lactamase superfamily, putative [Alcanivorax sp.
           DG881]
          Length = 213

 Score =  189 bits (480), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 91/212 (42%), Positives = 135/212 (63%), Gaps = 1/212 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + I+ VT F+QNC+FL  E + +  +VDPGGDL+ I   ++      ++I +TH H+D
Sbjct: 1   MKYAILPVTQFQQNCSFLKCEATDKVAIVDPGGDLNQILATLKQVGGTPEKILVTHAHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG  A+L E L L I GPH+DD   +  + +QA+++     +   + +RWL+ GDT+ +
Sbjct: 61  HVGAVAELAETLGLPIEGPHRDDQFWIDMLPQQAQMMGF-APSPPFTPNRWLEGGDTVTV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G+   +V HCPGH+PGHV++   E+  A +GD LF  SIGRTD   GD+  LI +I  ++
Sbjct: 120 GSTQLEVRHCPGHTPGHVVFYQRESKLAVVGDVLFNGSIGRTDFPKGDFDTLITAIKEQL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSN 215
           L L D++SF+ GHGP STIG ER  NPF+   
Sbjct: 180 LTLDDDVSFIPGHGPMSTIGHERTHNPFVSGK 211


>gi|120598397|ref|YP_962971.1| beta-lactamase domain-containing protein [Shewanella sp. W3-18-1]
 gi|146293524|ref|YP_001183948.1| beta-lactamase domain-containing protein [Shewanella putrefaciens
           CN-32]
 gi|120558490|gb|ABM24417.1| beta-lactamase domain protein [Shewanella sp. W3-18-1]
 gi|145565214|gb|ABP76149.1| beta-lactamase domain protein [Shewanella putrefaciens CN-32]
 gi|319426829|gb|ADV54903.1| beta-lactamase domain-containing protein [Shewanella putrefaciens
           200]
          Length = 214

 Score =  189 bits (480), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 88/213 (41%), Positives = 135/213 (63%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + I+ VTPF+QNC+ ++ E++  A VVDPGG++D I+  +  R   +++I +THGH+D
Sbjct: 1   MKYQIIPVTPFQQNCSLIWCEKTKLAAVVDPGGNIDRIQAEVAKRGLTLEKILLTHGHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVGGA  L +  ++ IIGPH  D   +  + +Q++      +       ++LQDGD + +
Sbjct: 61  HVGGAKSLAQSANIPIIGPHIADKFWIDNLPKQSQNFGFP-HCDAFEPAQYLQDGDIVKV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGH+PGH+ + + ++  A +GD LFRSSIGRTD    ++Q LI+SI  K+
Sbjct: 120 GEQSLSVLHCPGHTPGHIAFYSAQSKLAWVGDILFRSSIGRTDFPQSNHQDLIHSITEKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            PLG ++ F+ GHGP ST G ER  NPF+   +
Sbjct: 180 WPLGADVEFIPGHGPLSTFGEEREHNPFVADQL 212


>gi|329113552|ref|ZP_08242332.1| Putative protein YcbL [Acetobacter pomorum DM001]
 gi|326697074|gb|EGE48735.1| Putative protein YcbL [Acetobacter pomorum DM001]
          Length = 223

 Score =  189 bits (479), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 97/216 (44%), Positives = 138/216 (63%), Gaps = 7/216 (3%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +   IV VTPF+QNC+ L++E++ +AV+VD GGD +++ D ++     V+ I +THGH+D
Sbjct: 8   MQLRIVPVTPFRQNCSVLWNEKTRKAVIVDAGGDANVLLDFLKKNILEVEAILLTHGHLD 67

Query: 64  HVGGAAQLKEDLSLT------IIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQD 117
           H GG A L   L  T      +IGP+  D  ++  + EQAR   +  +  NA  DR+ QD
Sbjct: 68  HAGGVAALCRGLENTQVTRPDVIGPNIHDQFLLQSIVEQARHFGLS-DLENADVDRFTQD 126

Query: 118 GDTLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLIN 177
           G++L      F+V H PGH+PGHV++V+ +  FA  GD LFR +IGRTD  +G+ QQLI 
Sbjct: 127 GESLNYLGCTFRVVHVPGHTPGHVVFVDEKARFAFGGDVLFRGTIGRTDFAYGNSQQLIQ 186

Query: 178 SINNKILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
            I  K+LPLGD+I  V GHG  +T+G ER  NPFL+
Sbjct: 187 GIKEKLLPLGDDIVIVPGHGGLTTLGAERASNPFLQ 222


>gi|86148445|ref|ZP_01066735.1| Glyoxylase II family protein [Vibrio sp. MED222]
 gi|85833742|gb|EAQ51910.1| Glyoxylase II family protein [Vibrio sp. MED222]
          Length = 217

 Score =  189 bits (479), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 86/214 (40%), Positives = 131/214 (61%), Gaps = 1/214 (0%)

Query: 3   KLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHV 62
            L + +V VT F QNC+ ++ +E++E +VVDPGGD+  +  +I+     V  + +THGH+
Sbjct: 2   SLKYQVVPVTSFSQNCSIVWCDETMEGIVVDPGGDVQQLAAIIEELGVKVVNLVLTHGHL 61

Query: 63  DHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLL 122
           DHVGG   L E L++ I+GPHK D   +  ++ Q+++    +  +    + WL++GD + 
Sbjct: 62  DHVGGTVPLAEILNVNIVGPHKADNFWLQGLENQSQMFGFPL-CKAFEPNTWLEEGDKVT 120

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
            G  +  V H PGH+PGHV+  + +   A +GD LF  +IGRTD   GD+  LI SI  K
Sbjct: 121 FGNQVIDVIHTPGHTPGHVVLFSEQARMAFVGDVLFNGAIGRTDFPQGDFNTLIASIKTK 180

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           + PLG +++FV GHG  ST GRER  NPF+   +
Sbjct: 181 LWPLGSDVTFVPGHGLESTFGRERASNPFVADEM 214


>gi|261253177|ref|ZP_05945750.1| hydroxyacylglutathione hydrolase [Vibrio orientalis CIP 102891]
 gi|260936568|gb|EEX92557.1| hydroxyacylglutathione hydrolase [Vibrio orientalis CIP 102891]
          Length = 218

 Score =  189 bits (479), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 89/214 (41%), Positives = 132/214 (61%), Gaps = 2/214 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L + +V VT F QNC+ ++ +E++E VVVDPGGD+  +  +I+     V  + +THGH+D
Sbjct: 3   LKYQVVPVTSFSQNCSIVWCDETMEGVVVDPGGDVKQLAVLIKELGVKVVNLVLTHGHLD 62

Query: 64  HVGGAAQLKEDL-SLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLL 122
           HVGG   L  +L  + I+GPH+DD   +  ++ Q+++    +       D+WL +GD + 
Sbjct: 63  HVGGTEPLARELDGVRIVGPHQDDNFWLQGLEGQSQMFGFPL-TEAFEPDQWLNEGDKIK 121

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
            G  +  V H PGH+PGHV+  + E   A +GD LF  S+GRTD   GD+  LI+SI  K
Sbjct: 122 FGNQVMDVIHTPGHTPGHVVLFSDEAKLAFVGDVLFNGSVGRTDFPKGDFDTLISSIKTK 181

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           + PLG+++ FV GHGP ST GRER  NPF+   +
Sbjct: 182 LWPLGNDVRFVPGHGPESTFGRERASNPFVADEM 215


>gi|187930531|ref|YP_001901018.1| beta-lactamase domain-containing protein [Ralstonia pickettii 12J]
 gi|187727421|gb|ACD28586.1| beta-lactamase domain protein [Ralstonia pickettii 12J]
          Length = 218

 Score =  189 bits (479), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 90/209 (43%), Positives = 130/209 (62%), Gaps = 2/209 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           +V VTPF+QNCT L  ++   A V DPGGD++ I    +     +++I +THGHVDH   
Sbjct: 5   VVPVTPFEQNCTLLIGDDGT-AAVTDPGGDIERILAAAKQHGARIEKILLTHGHVDHCAA 63

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           A  L+  L + I GP KD+A  + ++  Q++       A+    DRWL+DGDT+      
Sbjct: 64  ADALRTQLGVPIEGPQKDEAFWIDQLPAQSQRFGF-PPAKAFVPDRWLEDGDTVEAAGRT 122

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
            +VFHCPGH+PGHV++ + ++  A +GD LF  SIGRTD   G++  LIN+I  K+ PLG
Sbjct: 123 LQVFHCPGHTPGHVVFFSAQDRVAIVGDVLFAGSIGRTDFPRGNHADLINAIRTKLWPLG 182

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           D+++FV GHGP ST G ER  NP++   +
Sbjct: 183 DDVTFVPGHGPVSTFGEERASNPYVADRL 211


>gi|117919941|ref|YP_869133.1| beta-lactamase domain-containing protein [Shewanella sp. ANA-3]
 gi|117612273|gb|ABK47727.1| beta-lactamase domain protein [Shewanella sp. ANA-3]
          Length = 214

 Score =  189 bits (479), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 88/213 (41%), Positives = 134/213 (62%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + I+ VTPF+QNC+ ++ E++  A VVDPGG++D I   +      +++I +THGH+D
Sbjct: 1   MKYQIIPVTPFQQNCSLIWCEKTKRAAVVDPGGNVDRILGEMNKLGLTLQKILLTHGHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVGGA  L +  ++ I+GPH  D   +  + +Q++      +      +++LQDGD + +
Sbjct: 61  HVGGAKSLAQQTNVPIVGPHVADKFWIDNLPKQSQNFGFP-HCDAFEPEQYLQDGDVVTV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    KV HCPGH+PGHV + + + + A +GD LFRSSIGRTD    ++Q LI SI  K+
Sbjct: 120 GEQSLKVLHCPGHTPGHVAFYSADAHLAWVGDILFRSSIGRTDFPQSNHQDLIQSITTKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            PLG ++ F+ GHGP ST G ER  NPF+   +
Sbjct: 180 WPLGADVEFIPGHGPMSTFGEEREHNPFVADQL 212


>gi|184156713|ref|YP_001845052.1| Zn-dependent hydrolase [Acinetobacter baumannii ACICU]
 gi|332873123|ref|ZP_08441080.1| metallo-beta-lactamase domain protein [Acinetobacter baumannii
           6014059]
 gi|183208307|gb|ACC55705.1| Zn-dependent hydrolase, including glyoxylase [Acinetobacter
           baumannii ACICU]
 gi|322506602|gb|ADX02056.1| Zn-dependent hydrolase, including glyoxylase [Acinetobacter
           baumannii 1656-2]
 gi|323516479|gb|ADX90860.1| Zn-dependent hydrolase, including glyoxylase [Acinetobacter
           baumannii TCDC-AB0715]
 gi|332738635|gb|EGJ69505.1| metallo-beta-lactamase domain protein [Acinetobacter baumannii
           6014059]
          Length = 214

 Score =  188 bits (478), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 87/212 (41%), Positives = 129/212 (60%), Gaps = 1/212 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L   IV VT F QNC+ ++D E+ EAV++D GGD  ++K  +++    VK +W+THGH+D
Sbjct: 2   LQVKIVPVTAFAQNCSLVWDSETKEAVLIDAGGDAAVLKKEVEALGLKVKALWLTHGHLD 61

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H G   +L ++ S+ ++GPHK+D   +  + E +      +  +    D+WL+ G+ L L
Sbjct: 62  HAGAVGELAKEWSVPVVGPHKEDQFWLDMIQEVSARYGFPI-PQPVKVDQWLEGGEVLKL 120

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   F+V   PGH+PGHV++ N  +     GD LF+ SIGRTD   G++ QLI SI  + 
Sbjct: 121 GEDEFEVRFAPGHTPGHVMFYNKNHGLLWTGDVLFKGSIGRTDFPRGNHDQLIESIQREC 180

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSN 215
             L DE  F+ GHGP STIG E++ NPF+ S 
Sbjct: 181 FSLPDETQFISGHGPMSTIGYEKQFNPFVASK 212


>gi|317047574|ref|YP_004115222.1| hypothetical protein Pat9b_1345 [Pantoea sp. At-9b]
 gi|316949191|gb|ADU68666.1| conserved hypothetical protein [Pantoea sp. At-9b]
          Length = 209

 Score =  188 bits (478), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 87/210 (41%), Positives = 132/210 (62%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++ I+ VT F QNC+ ++ +++ +A +VDPGGD   I  V+  R     QI +THGH+D
Sbjct: 1   MNYLIIPVTAFSQNCSVIWGDDTQQAALVDPGGDAATIIAVLAERGITPAQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L     + I+GP   DA  +  +  Q+R+  +   A   + DRWL++G+T+ +
Sbjct: 61  HVGAAAELAAHYQVPIVGPQLLDAFWLEALPTQSRMFGLPECA-PLTPDRWLEEGETVQV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGH+++ +        GD +F   +GRTD   G +  LI +I  K+
Sbjct: 120 GEVTLEVLHCPGHTPGHIVFFDRAGRLLISGDVIFNGGVGRTDFPQGSHSDLIAAIKTKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           LPLGD+++FV GHGP ST+GRER  NPFL+
Sbjct: 180 LPLGDDVTFVPGHGPISTLGRERISNPFLQ 209


>gi|225075566|ref|ZP_03718765.1| hypothetical protein NEIFLAOT_00579 [Neisseria flavescens
           NRL30031/H210]
 gi|224953111|gb|EEG34320.1| hypothetical protein NEIFLAOT_00579 [Neisseria flavescens
           NRL30031/H210]
          Length = 212

 Score =  188 bits (478), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 85/209 (40%), Positives = 132/209 (63%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L F I  VTPF+QNCT ++D+E+ EAV+ D GGD+  +   +Q++   +  IW+THGH+D
Sbjct: 3   LQFEINAVTPFRQNCTLIWDDETKEAVLTDVGGDVPYLLQQVQNKGLKLTAIWLTHGHLD 62

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GG  +L +   + ++GPHKDD  ++  + +     S  ++  + +  RWL++G++L +
Sbjct: 63  HAGGVVELLKTCDIPVLGPHKDDEFLLQALPQTTAQYSFPVSP-SFTPTRWLEEGESLKV 121

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G H F+V H PGH+PG V++ N EN     GD LF  ++GRTD   G++  LIN+I  K+
Sbjct: 122 GNHSFQVLHIPGHTPGQVVFYNAENGLLVAGDVLFYETVGRTDFPRGNHDDLINNICTKL 181

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           L L +    + GHG  ++IG E+R NPFL
Sbjct: 182 LTLPETTQVIAGHGRMTSIGHEKRYNPFL 210


>gi|262280805|ref|ZP_06058588.1| metallo-beta-lactamase superfamily protein [Acinetobacter
           calcoaceticus RUH2202]
 gi|262257705|gb|EEY76440.1| metallo-beta-lactamase superfamily protein [Acinetobacter
           calcoaceticus RUH2202]
          Length = 214

 Score =  188 bits (478), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 86/209 (41%), Positives = 130/209 (62%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L   IV VT F QNC+ ++D E+ EAV++D GGD  ++K  +++    VK +W+THGH+D
Sbjct: 2   LQVKIVPVTAFAQNCSLVWDSETKEAVLIDAGGDAAVLKKEVEALGLKVKALWLTHGHLD 61

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H G   +L ++ S+ +IGPHK+D   +  + E +      +  +    D+WL+ G+ L L
Sbjct: 62  HAGAVGELAKEWSVPVIGPHKEDQFWLDMIQEVSARYGFPI-PQPVKVDQWLEGGEVLKL 120

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   F+V   PGH+PGHV++ N ++     GD LF+ SIGRTD   G+++QLI SI  + 
Sbjct: 121 GEDEFEVRFAPGHTPGHVVFYNKKHGLLWTGDVLFKGSIGRTDFPRGNHEQLIESIKREC 180

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
             L D+  F+ GHGP STIG E++ NPF+
Sbjct: 181 FSLPDDTQFISGHGPMSTIGYEKQFNPFV 209


>gi|329298734|ref|ZP_08256070.1| hypothetical protein Pstas_23584 [Plautia stali symbiont]
          Length = 209

 Score =  188 bits (478), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 87/210 (41%), Positives = 133/210 (63%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++ I+ VT F QNC+ ++D+E+ +A +VDPGGD + I   +  R     QI +THGH+D
Sbjct: 1   MNYLIIPVTAFSQNCSVIWDDETQQAALVDPGGDAETIIAELAERGLTPSQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L +   + I+GP   DA  +  +  Q+R+  +   A   + DRWL++G+T+ L
Sbjct: 61  HVGAAAELAQHYQVPIVGPQPADAFWLDNLPTQSRMFGLPECAP-LTPDRWLEEGETVQL 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+ GH+++ +        GD +F   +GRTD   G +  LI +I +K+
Sbjct: 120 GNVTLEVLHCPGHTLGHIVFFDRAGRLLISGDVIFNGGVGRTDFPQGSHSDLIAAIRDKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           LPLGD+++FV GHGP ST+G ER  NPFL+
Sbjct: 180 LPLGDDVTFVPGHGPISTLGHERVSNPFLQ 209


>gi|188534254|ref|YP_001908051.1| Putative metallo-beta-lactamase [Erwinia tasmaniensis Et1/99]
 gi|188029296|emb|CAO97173.1| Putative metallo-beta-lactamase [Erwinia tasmaniensis Et1/99]
          Length = 209

 Score =  188 bits (477), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 89/210 (42%), Positives = 137/210 (65%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + FHI+ VT F QNC+ ++  E+ +A +VDPGGD   IK  I +    +KQI +THGH+D
Sbjct: 1   MEFHIIPVTAFAQNCSVIWCPETGDAALVDPGGDAQKIKTEIAALGVTLKQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L E   ++IIGPHK D   +  + +Q+++      A   + +RWL++G+++ +
Sbjct: 61  HVGAAAELAEHYDVSIIGPHKADKFWLDGLPQQSQMFGFDECAP-LTPNRWLEEGESVHV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V  C GH+PGH+++ + E      GD +F   +GR+D   G +  LI SI++K+
Sbjct: 120 GHTELEVLLCSGHTPGHIVFFDREGRLLVSGDVIFNGGVGRSDFPQGSHDDLIASIHSKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           LPLGD+++F+ GHGP ST+GRER  NPFL+
Sbjct: 180 LPLGDDVAFIPGHGPMSTLGRERISNPFLQ 209


>gi|224826028|ref|ZP_03699131.1| beta-lactamase domain protein [Lutiella nitroferrum 2002]
 gi|224601665|gb|EEG07845.1| beta-lactamase domain protein [Lutiella nitroferrum 2002]
          Length = 216

 Score =  188 bits (477), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 87/210 (41%), Positives = 129/210 (61%), Gaps = 1/210 (0%)

Query: 3   KLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHV 62
            L  H V VTPF QNC+ L+ + +L A +VDPGGD++ I   + +R+  V +I +THGH+
Sbjct: 2   SLKLHTVPVTPFAQNCSLLWCDVTLNAAIVDPGGDIERILAEVAARDLTVVKILLTHGHI 61

Query: 63  DHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLL 122
           DH G    L   L + + GP ++++  + ++  Q ++      A   + DRWL++GDT+ 
Sbjct: 62  DHAGATMPLARRLGVPVEGPQREESFWLDQLPNQGQMFGFP-PAEAVTPDRWLEEGDTVT 120

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
           LG     V HCPGH+PGHV++ +        GD LF+ SIGRTD   G++QQLI++I  K
Sbjct: 121 LGEETLAVLHCPGHTPGHVVFYSAAAGLLIAGDVLFQGSIGRTDFPRGNHQQLIDAIRGK 180

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           +  L +E   V GHGP +TIG E+R NPF+
Sbjct: 181 LFVLPEETVVVPGHGPYTTIGDEKRHNPFV 210


>gi|304415072|ref|ZP_07395812.1| metallo-beta-lactamase superfamily protein [Candidatus Regiella
           insecticola LSR1]
 gi|304283076|gb|EFL91499.1| metallo-beta-lactamase superfamily protein [Candidatus Regiella
           insecticola LSR1]
          Length = 209

 Score =  188 bits (477), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 86/209 (41%), Positives = 135/209 (64%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + I+ VT F QNC+ ++ E + +A ++DPGGD D +   I  +   + +I +THGH+D
Sbjct: 1   MKYEILPVTAFNQNCSLIWCERTYQAALIDPGGDADKLIAAINHKKVTINKILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AAQL +   ++I GP  +D  ++ K+  Q+++  +    +      WL++GD + +
Sbjct: 61  HVGAAAQLAKHFQVSIHGPAVEDRFLLEKLPIQSKMFGLD-ECQPFEPTCWLKEGDKITI 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGH+PGH++++N  +  A +GD +FR S+GRTD    D+ QLI+SI NK+
Sbjct: 120 GDIKLMVLHCPGHTPGHIVFINQTDRLALVGDVIFRGSVGRTDFPLSDHAQLISSIQNKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           LPLGD+I+F+ GHG  ST G ER+ NPF+
Sbjct: 180 LPLGDDITFIPGHGKISTFGYERKHNPFI 208


>gi|209965760|ref|YP_002298675.1| metallo-beta-lactamase superfamily [Rhodospirillum centenum SW]
 gi|209959226|gb|ACI99862.1| metallo-beta-lactamase superfamily [Rhodospirillum centenum SW]
          Length = 237

 Score =  188 bits (477), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 87/210 (41%), Positives = 127/210 (60%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L   ++ VTPF QNC+ L+   +  A VVDPGG +  I + ++     V++I +THGHVD
Sbjct: 21  LRVAVIPVTPFAQNCSLLWCTATRRAAVVDPGGGVPTILEAVRRHGLTVERILVTHGHVD 80

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H    A L E L + + GP + D   + ++        +   AR  + DRWL DGDT+ +
Sbjct: 81  HAAAVADLAERLKVPVEGPGRQDDYWIAELAGHGAAYGMPY-ARPFTPDRWLGDGDTVTV 139

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGHV++ +  + FA +GD LFR S+GRTD   G ++ L  SI  K+
Sbjct: 140 GALTLQVLHCPGHTPGHVVFFHAPSRFAVVGDVLFRGSVGRTDFPGGSFEALAASIRGKL 199

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
            PLGD+++F+ GHG  ST G+ER+ NPF+ 
Sbjct: 200 FPLGDDVTFLPGHGETSTFGQERQGNPFVS 229


>gi|169634509|ref|YP_001708245.1| putative enzyme [Acinetobacter baumannii SDF]
 gi|215484803|ref|YP_002327038.1| Metallo-beta-lactamase superfamily protein [Acinetobacter baumannii
           AB307-0294]
 gi|260556256|ref|ZP_05828475.1| metallo-beta-lactamase superfamily protein [Acinetobacter baumannii
           ATCC 19606]
 gi|332851880|ref|ZP_08433783.1| metallo-beta-lactamase domain protein [Acinetobacter baumannii
           6013150]
 gi|332867938|ref|ZP_08437926.1| metallo-beta-lactamase domain protein [Acinetobacter baumannii
           6013113]
 gi|169153301|emb|CAP02407.1| putative enzyme [Acinetobacter baumannii]
 gi|193076219|gb|ABO10842.2| hypothetical protein A1S_0383 [Acinetobacter baumannii ATCC 17978]
 gi|213987918|gb|ACJ58217.1| Metallo-beta-lactamase superfamily protein [Acinetobacter baumannii
           AB307-0294]
 gi|260410311|gb|EEX03610.1| metallo-beta-lactamase superfamily protein [Acinetobacter baumannii
           ATCC 19606]
 gi|332729665|gb|EGJ61001.1| metallo-beta-lactamase domain protein [Acinetobacter baumannii
           6013150]
 gi|332733639|gb|EGJ64798.1| metallo-beta-lactamase domain protein [Acinetobacter baumannii
           6013113]
          Length = 214

 Score =  188 bits (477), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 86/209 (41%), Positives = 129/209 (61%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L   IV VT F QNC+ ++D E+ EAV++D GGD  ++K  +++    VK +W+THGH+D
Sbjct: 2   LQVKIVPVTAFAQNCSLVWDSETKEAVLIDAGGDAAVLKKEVEALGLKVKALWLTHGHLD 61

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H G   +L ++ S+ ++GPHK+D   +  + E +      +  +    D+WL+ G+ L L
Sbjct: 62  HAGAVGELAKEWSVPVVGPHKEDQFWLDMIQEVSARYGFPI-PQPVKVDQWLEGGEVLKL 120

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   F+V   PGH+PGHV++ N  +     GD LF+ SIGRTD   G+++QLI SI  + 
Sbjct: 121 GEDEFEVRFAPGHTPGHVMFYNKNHGLLWTGDVLFKGSIGRTDFPRGNHEQLIESIQREC 180

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
             L DE  F+ GHGP STIG E++ NPF+
Sbjct: 181 FSLPDETQFISGHGPMSTIGYEKQFNPFV 209


>gi|217972802|ref|YP_002357553.1| beta-lactamase domain-containing protein [Shewanella baltica OS223]
 gi|217497937|gb|ACK46130.1| beta-lactamase domain protein [Shewanella baltica OS223]
          Length = 214

 Score =  187 bits (476), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 89/213 (41%), Positives = 134/213 (62%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + I+ VTPF+QNC+ ++ E++  A VVDPGG++D I++ +      + +I +THGH+D
Sbjct: 1   MKYQIIPVTPFQQNCSLIWCEKTKRAAVVDPGGNIDRIQNEVTKLGLVLDKIILTHGHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVGGA  L +  ++ IIGPH  D   +  + +Q++      +      D++LQDGD + +
Sbjct: 61  HVGGAKALAQATNVPIIGPHIADKFWIDNLPKQSQNFGFP-HCDAFEPDQYLQDGDNVQV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGH+PGH+   + ++  A +GD LFRSSIGRTD    ++Q LI+SI  K+
Sbjct: 120 GEQSLSVLHCPGHTPGHIALFSAQSKLAWVGDILFRSSIGRTDFPQSNHQDLIHSITEKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            PLG E+ F+ GHGP ST G ER  NPF+   +
Sbjct: 180 WPLGIEVEFIPGHGPMSTFGEEREHNPFVADQL 212


>gi|254230626|ref|ZP_04923978.1| Zn-dependent hydrolases, including glyoxylases [Vibrio sp. Ex25]
 gi|151936851|gb|EDN55757.1| Zn-dependent hydrolases, including glyoxylases [Vibrio sp. Ex25]
          Length = 218

 Score =  187 bits (476), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 87/214 (40%), Positives = 132/214 (61%), Gaps = 2/214 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + +V VT F QNC+ ++ +E+++ +V+DPGGD   +  +I+     +  + +THGH+D
Sbjct: 3   MKYQVVPVTSFSQNCSIVWCDETMKGIVIDPGGDEKQLAMLIKELGIEIVNLVLTHGHLD 62

Query: 64  HVGGAAQLKEDLS-LTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLL 122
           HVGG   L   L  + IIGPHK D   +  ++ Q+++    +        +WL +GDT+ 
Sbjct: 63  HVGGTEPLAAMLGGIEIIGPHKADNFWLQGLEGQSQMFGFPLT-EAFEPHQWLNEGDTVT 121

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
            G  + KVFH PGH+PGHV+  + E   A +GD LF  SIGRTD   GD+  LI+SI  K
Sbjct: 122 FGNQVLKVFHTPGHTPGHVVLYSEEARLAFVGDVLFNGSIGRTDFPQGDFNTLISSIKEK 181

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           + PLG++++FV GHGP ST G ER+ NPF+   +
Sbjct: 182 LWPLGNDVTFVPGHGPQSTFGHERKTNPFVADEM 215


>gi|299771735|ref|YP_003733761.1| Metallo-beta-lactamase superfamily protein [Acinetobacter sp. DR1]
 gi|298701823|gb|ADI92388.1| Metallo-beta-lactamase superfamily protein [Acinetobacter sp. DR1]
          Length = 214

 Score =  187 bits (476), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 87/209 (41%), Positives = 129/209 (61%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L   IV VT F QNC+ ++D E+ EAV++D GGD  ++K  +++    VK +W+THGH+D
Sbjct: 2   LQVKIVPVTAFAQNCSLVWDSETKEAVLIDAGGDAAVLKKEVEALGLKVKALWLTHGHLD 61

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H G   +L ++ S+ +IGPHK+D   +  + E +      +  +    D+WL+ G+ L L
Sbjct: 62  HAGAVGELAKEWSVPVIGPHKEDQFWLDMIQEVSARYGFPI-PQPVKVDQWLEGGEVLKL 120

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   F+V   PGH+PGHVI+ N  +     GD LF+ SIGRTD   G+++QLI SI  + 
Sbjct: 121 GEDEFEVRFAPGHTPGHVIFYNKNHGLLWTGDVLFKGSIGRTDFPRGNHEQLIESIKREC 180

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
             L D+  F+ GHGP STIG E++ NPF+
Sbjct: 181 FSLPDDTQFISGHGPMSTIGYEKQFNPFV 209


>gi|59711801|ref|YP_204577.1| metal-binding protein [Vibrio fischeri ES114]
 gi|197335598|ref|YP_002155993.1| metallo-beta-lactamase superfamily protein [Vibrio fischeri MJ11]
 gi|59479902|gb|AAW85689.1| predicted metal-binding enzyme [Vibrio fischeri ES114]
 gi|197317088|gb|ACH66535.1| metallo-beta-lactamase superfamily protein [Vibrio fischeri MJ11]
          Length = 217

 Score =  187 bits (476), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 87/213 (40%), Positives = 131/213 (61%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L + I+ VT ++QNC+ ++ +E+++ VV+DPGGD+ ++K  I++ N  V  + +THGH+D
Sbjct: 3   LQYQIIPVTSYEQNCSIVWCDETMKGVVIDPGGDVQLLKQAIEALNVDVVHMVLTHGHLD 62

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVGG   L    + TI+GPHK+D   +  +  Q+             S +WL +GD +  
Sbjct: 63  HVGGTEDLAAITNATIVGPHKEDNFWLQGLPNQSERFGFPHTEAFEPS-QWLNEGDVIEF 121

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V H PGH+PGHV+  N E   A +GD LF+ +IGR+D   GD+  LI+SI  K+
Sbjct: 122 GNQKLDVLHTPGHTPGHVVLFNQEAKMAFVGDVLFKGAIGRSDFPKGDFDTLISSIKTKL 181

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            PLG+++ FV GHGP ST G ER+ NPF+   +
Sbjct: 182 WPLGNDMRFVPGHGPESTFGHERQTNPFVADKM 214


>gi|153001267|ref|YP_001366948.1| beta-lactamase domain-containing protein [Shewanella baltica OS185]
 gi|151365885|gb|ABS08885.1| beta-lactamase domain protein [Shewanella baltica OS185]
          Length = 214

 Score =  187 bits (476), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 89/213 (41%), Positives = 134/213 (62%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + I+ VTPF+QNC+ ++ E++  A VVDPGG++D I++ +      + +I +THGH+D
Sbjct: 1   MKYQIIPVTPFQQNCSLMWCEKTKRAAVVDPGGNIDRIQNEVTKLGLVLDKIILTHGHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVGGA  L +  ++ IIGPH  D   +  + +Q++      +      D++LQDGD + +
Sbjct: 61  HVGGAKALAQATNVPIIGPHIADKFWIDNLPKQSQNFGFP-HCDAFEPDQYLQDGDNVQV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGH+PGH+   + ++  A +GD LFRSSIGRTD    ++Q LI+SI  K+
Sbjct: 120 GEQSLSVLHCPGHTPGHIALFSAQSKLAWVGDILFRSSIGRTDFPQSNHQDLIHSITEKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            PLG E+ F+ GHGP ST G ER  NPF+   +
Sbjct: 180 WPLGVEVEFIPGHGPISTFGEEREHNPFVADQL 212


>gi|226951881|ref|ZP_03822345.1| beta-lactamase domain-containing protein [Acinetobacter sp. ATCC
           27244]
 gi|294649138|ref|ZP_06726580.1| metallo-beta-lactamase [Acinetobacter haemolyticus ATCC 19194]
 gi|226837421|gb|EEH69804.1| beta-lactamase domain-containing protein [Acinetobacter sp. ATCC
           27244]
 gi|292825021|gb|EFF83782.1| metallo-beta-lactamase [Acinetobacter haemolyticus ATCC 19194]
          Length = 214

 Score =  187 bits (476), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 87/212 (41%), Positives = 129/212 (60%), Gaps = 1/212 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L   IV VT F QNC+ L+D E+ EA+++D GGD  ++K  ++     VK +W+THGH+D
Sbjct: 2   LQVKIVPVTAFAQNCSILWDSETKEAILIDAGGDAAVLKKEVEDLGLKVKALWLTHGHLD 61

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H G   +L E   + +IGPHK+D   +  + E +      +  +    ++WL+ G+ L L
Sbjct: 62  HAGAVGELAEAWKIPVIGPHKEDQFWLDMIQEVSARYGFPI-PQPVKVNQWLEGGEVLKL 120

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   F+V   PGH+PGHV++ N ++     GD LF+ SIGRTD   G++QQL++SI  + 
Sbjct: 121 GEDEFEVRFAPGHTPGHVMFYNKKHGLLWTGDVLFKGSIGRTDFPRGNHQQLLDSIQREC 180

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSN 215
             L DE  F+ GHGP STIG E++ NPF+ S 
Sbjct: 181 FSLPDETQFISGHGPISTIGYEKQFNPFVASK 212


>gi|299065247|emb|CBJ36413.1| putative enzyme with metallo-hydrolase/oxidoreductase domain
           [Ralstonia solanacearum CMR15]
          Length = 218

 Score =  187 bits (476), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 91/209 (43%), Positives = 128/209 (61%), Gaps = 2/209 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           +V VTPF+QNCT L  ++   A V DPGGD+D I    + +   +++I +THGHVDH   
Sbjct: 5   VVPVTPFEQNCTLLIGDDG-RAAVTDPGGDIDRILSAARQQGARIEKILLTHGHVDHCAA 63

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           A  L+  L + I GPH+D+A  + ++  Q++       A     DRWL DGDT+      
Sbjct: 64  ADALRTQLGVPIEGPHRDEAFWIDQLPTQSQRFGF-PPALAFVPDRWLDDGDTVEAAGRT 122

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
            +VFHCPGH+PGHV++ +  +  A +GD LF  SIGRTD   G++  LI SI  K+ PLG
Sbjct: 123 LEVFHCPGHTPGHVVFFSRPDRIAIVGDVLFAGSIGRTDFPRGNHADLIRSIRTKLWPLG 182

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           D+++FV GHGP ST G ER  NP++   +
Sbjct: 183 DDVTFVPGHGPVSTFGDERATNPYVADRL 211


>gi|262393900|ref|YP_003285754.1| hydroxyacylglutathione hydrolase [Vibrio sp. Ex25]
 gi|262337494|gb|ACY51289.1| hydroxyacylglutathione hydrolase [Vibrio sp. Ex25]
          Length = 216

 Score =  187 bits (475), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 87/214 (40%), Positives = 132/214 (61%), Gaps = 2/214 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + +V VT F QNC+ ++ +E+++ +V+DPGGD   +  +I+     +  + +THGH+D
Sbjct: 1   MKYQVVPVTSFSQNCSIVWCDETMKGIVIDPGGDEKQLAMLIKELGIEIVNLVLTHGHLD 60

Query: 64  HVGGAAQLKEDLS-LTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLL 122
           HVGG   L   L  + IIGPHK D   +  ++ Q+++    +        +WL +GDT+ 
Sbjct: 61  HVGGTEPLAAMLGGIEIIGPHKADNFWLQGLEGQSQMFGFPL-TEAFEPHQWLNEGDTVT 119

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
            G  + KVFH PGH+PGHV+  + E   A +GD LF  SIGRTD   GD+  LI+SI  K
Sbjct: 120 FGNQVLKVFHTPGHTPGHVVLYSEEARLAFVGDVLFNGSIGRTDFPQGDFNTLISSIKEK 179

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           + PLG++++FV GHGP ST G ER+ NPF+   +
Sbjct: 180 LWPLGNDVTFVPGHGPQSTFGHERKTNPFVADEM 213


>gi|296114658|ref|ZP_06833311.1| Beta-lactamase-like protein [Gluconacetobacter hansenii ATCC 23769]
 gi|295979014|gb|EFG85739.1| Beta-lactamase-like protein [Gluconacetobacter hansenii ATCC 23769]
          Length = 222

 Score =  187 bits (475), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 95/218 (43%), Positives = 136/218 (62%), Gaps = 8/218 (3%)

Query: 3   KLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHV 62
            L+  +V VT F QNC+ L+D  S  AVVVDPGGD+  +  VI  +N  V  I +THGH+
Sbjct: 6   SLALEVVAVTAFAQNCSILWDRRSRHAVVVDPGGDVPRLLQVIADKNLTVDAIILTHGHL 65

Query: 63  DHVGGAAQLKEDLS-------LTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWL 115
           DH GGA  L++ L+       + +IGP   D  ++  + +QA    +     +A  DR++
Sbjct: 66  DHAGGADALRDALTTRQDGVTVPLIGPDARDQFLLESITQQAARFGVD-GMHDAHVDRFV 124

Query: 116 QDGDTLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQL 175
            DG+ L L  H F+V H PGH+PGHV+Y N +  FA +GDTLF+ S+GRTD  +GD   L
Sbjct: 125 TDGERLDLLGHEFQVLHVPGHTPGHVVYFNPQTRFAFVGDTLFQGSVGRTDFAYGDADVL 184

Query: 176 INSINNKILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
             +I  ++LPLGD+++ + GHGP +TIG ER+ N FL+
Sbjct: 185 KEAIVRQLLPLGDDVTILPGHGPTTTIGAERQGNLFLR 222


>gi|119502757|ref|ZP_01624842.1| metallo-beta-lactamase family protein [marine gamma proteobacterium
           HTCC2080]
 gi|119461103|gb|EAW42193.1| metallo-beta-lactamase family protein [marine gamma proteobacterium
           HTCC2080]
          Length = 216

 Score =  187 bits (475), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 88/209 (42%), Positives = 136/209 (65%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L+  IV VT ++QNC+ +  + + +A +VDPGGD++ I   ++  +  V++I +THGH+D
Sbjct: 3   LAVTIVPVTQYQQNCSIVKCQATGKAAIVDPGGDIEKILAAVEQMDAQVEKILLTHGHMD 62

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H   +  L++ L + I GP + D   + K+ E  ++ +   +A     DRWL+DG+T+ +
Sbjct: 63  HCAASDVLRQRLQIPIEGPEEGDRFWIDKLPEWCQMANFP-HADAFEPDRWLKDGETVTV 121

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   F+V HCPGH+PGHV++++     A +GD +F  SIGRTD   G++  LINSI  K+
Sbjct: 122 GEAQFQVIHCPGHTPGHVVFLHTPQKLAWVGDVIFAGSIGRTDFPMGNHDDLINSIREKL 181

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
            PLGD+I F+ GHGP+ST GRER  NPF+
Sbjct: 182 FPLGDDIQFIPGHGPDSTFGRERASNPFV 210


>gi|169797363|ref|YP_001715156.1| putative enzyme [Acinetobacter baumannii AYE]
 gi|213155823|ref|YP_002317867.1| beta-lactamase domain protein [Acinetobacter baumannii AB0057]
 gi|301345464|ref|ZP_07226205.1| beta-lactamase domain protein [Acinetobacter baumannii AB056]
 gi|301511094|ref|ZP_07236331.1| beta-lactamase domain protein [Acinetobacter baumannii AB058]
 gi|301596666|ref|ZP_07241674.1| beta-lactamase domain protein [Acinetobacter baumannii AB059]
 gi|169150290|emb|CAM88187.1| putative enzyme [Acinetobacter baumannii AYE]
 gi|213054983|gb|ACJ39885.1| beta-lactamase domain protein [Acinetobacter baumannii AB0057]
          Length = 214

 Score =  187 bits (475), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 86/209 (41%), Positives = 128/209 (61%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L   IV VT F QNC+ ++D E+ EAV++D GGD  ++K  +++    VK +W+THGH+D
Sbjct: 2   LQVKIVPVTAFAQNCSLVWDSETKEAVLIDAGGDAAVLKKEVEALGLKVKALWLTHGHLD 61

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H G   +L +  S+ ++GPHK+D   +  + E +      +  +    D+WL+ G+ L L
Sbjct: 62  HAGAVGELAKQWSVPVVGPHKEDQFWLDMIQEVSARYGFPI-PQPVKVDQWLEGGEVLKL 120

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   F+V   PGH+PGHV++ N  +     GD LF+ SIGRTD   G+++QLI SI  + 
Sbjct: 121 GEDEFEVRFAPGHTPGHVMFYNKNHGLLWTGDVLFKGSIGRTDFPRGNHEQLIESIQREC 180

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
             L DE  F+ GHGP STIG E++ NPF+
Sbjct: 181 FSLPDETQFISGHGPMSTIGYEKQFNPFV 209


>gi|114562588|ref|YP_750101.1| beta-lactamase domain-containing protein [Shewanella frigidimarina
           NCIMB 400]
 gi|114333881|gb|ABI71263.1| beta-lactamase domain protein [Shewanella frigidimarina NCIMB 400]
          Length = 214

 Score =  187 bits (475), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 90/214 (42%), Positives = 140/214 (65%), Gaps = 3/214 (1%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + I+ VTPF+QNC+ ++ E++L+A VVDPGG++D I   +     +V++I +THGH+D
Sbjct: 1   MKYQIIPVTPFQQNCSVIWCEKTLKAAVVDPGGNIDRILAEVAKLGVNVEKILLTHGHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSI-RMNARNASSDRWLQDGDTLL 122
           HVGGAA+L + L++ IIGPH  D   +  + +Q++     R  A   +  ++L +GD + 
Sbjct: 61  HVGGAAELAKKLAVPIIGPHIADKFWLENLVKQSQNFGFPRTEAFEPT--QYLNEGDEVS 118

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
           +G    +V HCPGH+PGH+++ +   N A +GD LFR SIGRTD    ++Q L++SI  K
Sbjct: 119 VGEQHLQVLHCPGHTPGHIVFYDKIANLAWVGDVLFRGSIGRTDFPQSNHQDLLHSITTK 178

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           + PLG  +SF+ GHGP ST   ER+ NPF+   +
Sbjct: 179 LWPLGLNVSFIPGHGPMSTFADERQHNPFVADQL 212


>gi|160875938|ref|YP_001555254.1| beta-lactamase domain-containing protein [Shewanella baltica OS195]
 gi|160861460|gb|ABX49994.1| beta-lactamase domain protein [Shewanella baltica OS195]
 gi|315268133|gb|ADT94986.1| beta-lactamase domain protein [Shewanella baltica OS678]
          Length = 214

 Score =  187 bits (475), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 89/213 (41%), Positives = 134/213 (62%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + I+ VTPF+QNC+ ++ E++  A VVDPGG++D I++ +      + QI +THGH+D
Sbjct: 1   MKYQIIPVTPFQQNCSLIWCEKTKRAAVVDPGGNIDRIQNEVTKLGLVLDQIILTHGHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVGGA  L +  ++ IIGPH  D   +  + +Q++      +      D++LQDGD + +
Sbjct: 61  HVGGAKALAQAANVPIIGPHIADKFWIDNLPKQSQNFGFP-HCDAFEPDQYLQDGDIVKV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGH+PGH+   + ++  A +GD LFRSSIGRTD    ++Q LI+SI  K+
Sbjct: 120 GEQSLSVLHCPGHTPGHIALFSAQSKLAWVGDILFRSSIGRTDFPQSNHQDLIHSITEKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            PLG ++ F+ GHGP ST G ER  NPF+   +
Sbjct: 180 WPLGVDVEFIPGHGPISTFGEEREHNPFVADQL 212


>gi|319638918|ref|ZP_07993676.1| glyoxalase II family protein [Neisseria mucosa C102]
 gi|317399822|gb|EFV80485.1| glyoxalase II family protein [Neisseria mucosa C102]
          Length = 212

 Score =  187 bits (475), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 85/209 (40%), Positives = 131/209 (62%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L F I  VTPF+QNCT ++D+E+ EAV+ D GGD+  +   +Q++   +  IW+THGH+D
Sbjct: 3   LQFEINAVTPFRQNCTLIWDDETKEAVLTDVGGDVPYLLQQVQNKGLRLTAIWLTHGHLD 62

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GG  +L +   + ++GPHKDD  ++  + +        ++  + +  RWL++G+TL +
Sbjct: 63  HAGGVVELLKTCDVPVLGPHKDDEFLLQALPQTTAQYGFPVSP-SFTPTRWLEEGETLKV 121

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G H F+V H PGH+PG V++ N EN     GD LF  ++GRTD   G++  LIN+I  K+
Sbjct: 122 GNHSFQVLHIPGHTPGQVVFYNAENGLLVAGDVLFYETVGRTDFPRGNHDDLINNICAKL 181

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           L L +    + GHG  ++IG E+R NPFL
Sbjct: 182 LTLPENTQVIAGHGRMTSIGHEKRYNPFL 210


>gi|103486908|ref|YP_616469.1| beta-lactamase-like protein [Sphingopyxis alaskensis RB2256]
 gi|98976985|gb|ABF53136.1| beta-lactamase-like protein [Sphingopyxis alaskensis RB2256]
          Length = 221

 Score =  187 bits (474), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 90/206 (43%), Positives = 128/206 (62%), Gaps = 2/206 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           IV VT F+QNCT L+  E+ +A  VDPGGDL  +K+ ++     V++I +THGH+DH G 
Sbjct: 12  IVPVTAFQQNCTLLWCTETNKAAFVDPGGDLPKLKEAVRQTGVEVEKILVTHGHMDHCGQ 71

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           A  L  +L + I GPH+DD   + +  E        M       DRWL DGDT+ +G  +
Sbjct: 72  AGMLARELGVPIEGPHEDDRFWIERFAEDGARFG--MVGEPFEPDRWLVDGDTVTVGNLV 129

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
             V HCPGH+PGHV++ +  +  A +GD +F+ SIGRTD   G++QQL++SI  K+ PLG
Sbjct: 130 IDVIHCPGHTPGHVVFHHAPSKLAIVGDVIFQGSIGRTDFPRGNHQQLLDSITQKLWPLG 189

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLK 213
            + +F+ GHG +S    ERR NPF+ 
Sbjct: 190 GDTTFLPGHGAHSNFAHERRTNPFVS 215


>gi|261379480|ref|ZP_05984053.1| metallo-beta-lactamase domain protein [Neisseria subflava NJ9703]
 gi|284797939|gb|EFC53286.1| metallo-beta-lactamase domain protein [Neisseria subflava NJ9703]
          Length = 212

 Score =  187 bits (474), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 85/209 (40%), Positives = 131/209 (62%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L F I  VTPF+QNCT ++D+E+ EAV+ D GGD+  +   +Q++   +  IW+THGH+D
Sbjct: 3   LQFEINAVTPFRQNCTLIWDDETKEAVLTDVGGDVPYLLQQVQNKGLKLTAIWLTHGHLD 62

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GG  +L +   + ++GPHKDD  ++  + +        ++  + +  RWL++G+TL +
Sbjct: 63  HAGGVVELLKTCDVPVLGPHKDDEFLLQALPQTTAQYGFPVSP-SFTPTRWLEEGETLKV 121

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G H F+V H PGH+PG V++ N EN     GD LF  ++GRTD   G++  LIN+I  K+
Sbjct: 122 GNHSFQVLHIPGHTPGQVVFYNAENGLLVAGDVLFYETVGRTDFPRGNHDDLINNICAKL 181

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           L L +    + GHG  ++IG E+R NPFL
Sbjct: 182 LTLPETTQVIAGHGRMTSIGHEKRYNPFL 210


>gi|260549198|ref|ZP_05823419.1| metallo-beta-lactamase superfamily protein [Acinetobacter sp.
           RUH2624]
 gi|260407926|gb|EEX01398.1| metallo-beta-lactamase superfamily protein [Acinetobacter sp.
           RUH2624]
          Length = 214

 Score =  187 bits (474), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 85/209 (40%), Positives = 129/209 (61%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L   IV VT F QNC+ ++D E+ EAV++D GGD  ++K  +++    VK +W+THGH+D
Sbjct: 2   LQVKIVPVTAFAQNCSLVWDSETKEAVLIDAGGDAAVLKKEVEALGLKVKALWLTHGHLD 61

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H G   +L ++ S+ ++GPHK+D   +  + E +      +  +    D+WL+ G+ L L
Sbjct: 62  HAGAVGELAQEWSVPVVGPHKEDQFWLDMIQEVSARYGFPI-PQPVKVDQWLEGGEVLKL 120

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   F+V   PGH+PGHV++ N  +     GD LF+ SIGRTD   G+++QLI SI  + 
Sbjct: 121 GEDEFEVRFAPGHTPGHVMFYNKNHGLLWTGDVLFKGSIGRTDFPRGNHEQLIESIQREC 180

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
             L D+  F+ GHGP STIG E++ NPF+
Sbjct: 181 FSLPDQTQFISGHGPMSTIGYEKQFNPFV 209


>gi|329894659|ref|ZP_08270464.1| Hypothetical metal-binding enzyme, YcbL like protein [gamma
           proteobacterium IMCC3088]
 gi|328922915|gb|EGG30244.1| Hypothetical metal-binding enzyme, YcbL like protein [gamma
           proteobacterium IMCC3088]
          Length = 216

 Score =  187 bits (474), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 89/205 (43%), Positives = 135/205 (65%), Gaps = 1/205 (0%)

Query: 11  VTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQ 70
           VTP++QNC+ +  + + +A VVDPGGD+D I    +     +++I +THGH+DH G +A+
Sbjct: 10  VTPYQQNCSIIQCQATGKAAVVDPGGDIDRILSAAEQMGATIEKIILTHGHLDHCGVSAE 69

Query: 71  LKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFKV 130
           L++ L + I GP   D   + ++ +  +L     +A   + DRWL DGDT+ +G    +V
Sbjct: 70  LRDKLEVPIEGPEAADKFWIDQLPDYCKLAGFP-HADAFTPDRWLHDGDTVNVGEVELQV 128

Query: 131 FHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEI 190
            HCPGH+PGHV++V+ EN  A +GD +F+ SIGRTD     +  LI+SI +K+ PLGD+I
Sbjct: 129 IHCPGHTPGHVVFVSDENRIAWVGDVIFQGSIGRTDFPMSKHDDLIHSIRDKLFPLGDDI 188

Query: 191 SFVCGHGPNSTIGRERRLNPFLKSN 215
           +FV GHGP ST G+ER+ NPF+  +
Sbjct: 189 TFVPGHGPTSTFGQERQTNPFVADS 213


>gi|239500884|ref|ZP_04660194.1| Zn-dependent hydrolase, including glyoxylase [Acinetobacter
           baumannii AB900]
          Length = 214

 Score =  187 bits (474), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 86/209 (41%), Positives = 128/209 (61%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L   IV VT F QNC+ ++D E+ EAV++D GGD  ++K  +++    VK +W+THGH+D
Sbjct: 2   LQVKIVPVTAFAQNCSLVWDSETKEAVLIDAGGDAAVLKKEVEALGLKVKALWLTHGHLD 61

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H G   +L ++ S+ ++GPHK+D   +  + E +      +  +    D+WL+ G+ L L
Sbjct: 62  HAGAVGELAKEWSVPVVGPHKEDQFWLDMIQEVSARYGFPI-PQPVKVDQWLEGGEVLKL 120

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   F+V   PGH+PGHV++ N  +     GD LF+ SIGRTD   G++ QLI SI  + 
Sbjct: 121 GEDEFEVRFAPGHTPGHVMFYNKNHGLLWTGDVLFKGSIGRTDFPRGNHDQLIESIQREC 180

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
             L DE  F+ GHGP STIG E++ NPF+
Sbjct: 181 FSLPDETQFISGHGPMSTIGYEKQFNPFV 209


>gi|255321269|ref|ZP_05362435.1| metallo-beta-lactamase family protein [Acinetobacter radioresistens
           SK82]
 gi|262380047|ref|ZP_06073202.1| conserved hypothetical protein [Acinetobacter radioresistens SH164]
 gi|255301823|gb|EET81074.1| metallo-beta-lactamase family protein [Acinetobacter radioresistens
           SK82]
 gi|262298241|gb|EEY86155.1| conserved hypothetical protein [Acinetobacter radioresistens SH164]
          Length = 214

 Score =  187 bits (474), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 87/212 (41%), Positives = 131/212 (61%), Gaps = 1/212 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L   IV VT F QNC+ ++D E+ EA+++D GGD + +K  +++   +VK +W+THGH+D
Sbjct: 2   LQVKIVPVTAFAQNCSIVWDAETKEAILIDAGGDAEKLKAEVEALGINVKALWLTHGHLD 61

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H G   +L     + +IGPHK+D   +  + E +      +  +    D+WL+ G+TL L
Sbjct: 62  HAGAVGELANTWDVPVIGPHKEDQFWLDMIQEVSARYGFPI-PQPVKVDQWLEGGETLKL 120

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   F+V   PGH+PGHVI+ N ++     GD LF+ SIGRTD   G+++QL++SI  + 
Sbjct: 121 GKSEFEVRFTPGHTPGHVIFYNAQHGLLWTGDVLFKGSIGRTDFPRGNHRQLLDSIQREC 180

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSN 215
             L D+  F+CGHGP STIG E++ NPFL   
Sbjct: 181 FTLPDDTQFICGHGPMSTIGFEKQHNPFLAGK 212


>gi|148556454|ref|YP_001264036.1| beta-lactamase domain-containing protein [Sphingomonas wittichii
           RW1]
 gi|148501644|gb|ABQ69898.1| beta-lactamase domain protein [Sphingomonas wittichii RW1]
          Length = 483

 Score =  186 bits (473), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 89/212 (41%), Positives = 125/212 (58%), Gaps = 2/212 (0%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M  L   I+ VT F+QNCT ++   +++   VD GGDL+ +K         ++++ +THG
Sbjct: 267 MPPLKAAIIPVTAFQQNCTLIWCTATMKGAFVDAGGDLERLKAAAAEHGVTIEKLLVTHG 326

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DH GG   L E L + I GPH +D   + ++ +  R   I    R    DRWL DGD 
Sbjct: 327 HIDHCGGTGILAEQLGVPIEGPHPEDRFWIARLGDDGRGYGI--EGRPFEPDRWLDDGDQ 384

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           + +G  +  V HCPGH+PGHV++ +  +N A +GD LF+ SIGRTD   G++  LI SI 
Sbjct: 385 VTVGDLVLDVIHCPGHTPGHVVFHHAPSNLALVGDVLFQGSIGRTDFPRGNHGDLIASIT 444

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
            K+ PLG E +FV GHGP ST   ER  NPF+
Sbjct: 445 KKLWPLGGETAFVPGHGPMSTFAHERATNPFV 476


>gi|294141599|ref|YP_003557577.1| metallo-beta-lactamase family protein [Shewanella violacea DSS12]
 gi|293328068|dbj|BAJ02799.1| metallo-beta-lactamase family protein [Shewanella violacea DSS12]
          Length = 214

 Score =  186 bits (473), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 87/213 (40%), Positives = 134/213 (62%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + I+ VTPF+QNC+ ++ +E+  A VVDPGGD+D I   +      +++I +THGH+D
Sbjct: 1   MKYQIIPVTPFQQNCSLIWCDETKAAAVVDPGGDMDRILAEVDKLGVKLEKILLTHGHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG A +L +   + IIGPHK D+  +  + EQ++      +   A + ++L  GDT+ L
Sbjct: 61  HVGAAKELADHAGIPIIGPHKADSFWLDNLPEQSKHFGFAHSEPFAPT-QYLASGDTVTL 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G+   +V HCPGH+PGH+++ +  +    +GD LF  SIGRTD    ++Q LI+SI   +
Sbjct: 120 GSLTLEVLHCPGHTPGHIVFFSATSRTVWVGDVLFHGSIGRTDFPQSNHQDLIDSITKNL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            PLG ++ FV GHGP ST+G ER  NPF+   +
Sbjct: 180 WPLGRDVEFVPGHGPISTLGTERDQNPFVADQL 212


>gi|157961461|ref|YP_001501495.1| beta-lactamase domain-containing protein [Shewanella pealeana ATCC
           700345]
 gi|157846461|gb|ABV86960.1| beta-lactamase domain protein [Shewanella pealeana ATCC 700345]
          Length = 214

 Score =  186 bits (473), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 85/213 (39%), Positives = 136/213 (63%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + ++ VTPF+QNC+ ++ +++++A VVDPGG+++ I +        V+++ +THGH+D
Sbjct: 1   MKYQLIPVTPFQQNCSLIWCDQTMKAAVVDPGGNIERILEEAAKNKVVVEKVLLTHGHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG A  L E L++ IIGPHK D   +  + +Q++     ++    +  ++L+DGD + +
Sbjct: 61  HVGAAKSLAEQLNVPIIGPHKADEYWLDSLPKQSQHFGF-VHCDAFAPTQYLEDGDDVTV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G  + KV HCPGH+PGHV++       A +GD LFR SIGRTD    ++Q LI+SI  K+
Sbjct: 120 GNQVLKVLHCPGHTPGHVVFFAQSAKLAWVGDVLFRGSIGRTDFPLSNHQDLIDSITQKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
             LG ++ F+ GHGP ST G ER  NPF+   +
Sbjct: 180 WSLGSDVQFIPGHGPLSTFGDERVQNPFVADQL 212


>gi|262275622|ref|ZP_06053431.1| hydroxyacylglutathione hydrolase [Grimontia hollisae CIP 101886]
 gi|262219430|gb|EEY70746.1| hydroxyacylglutathione hydrolase [Grimontia hollisae CIP 101886]
          Length = 217

 Score =  186 bits (473), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 88/215 (40%), Positives = 136/215 (63%), Gaps = 5/215 (2%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L + IV VT F+QNC+ ++ +++ EA +VDPGGD+  +   +      V ++ +THGH+D
Sbjct: 3   LKYEIVPVTGFQQNCSIIWCDKTHEAALVDPGGDVSKLVAKVNDLGVKVTKVLLTHGHLD 62

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNAS--SDRWLQDGDTL 121
           HVGG  +++   ++ +IGP K DA  +  +  Q+ +      AR  +   D+WL+DGD +
Sbjct: 63  HVGGTEEVRLAYNVPVIGPEKQDAFWLQALPAQSEMFGF---ARTEAFDPDQWLEDGDEV 119

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
            +G     V H PGH+PGH++  + E+  A +GD LF  SIGRTD   GD+  LI+SI +
Sbjct: 120 TIGESTLTVIHTPGHTPGHIVLFSEEDRIAWVGDVLFNGSIGRTDFPKGDHATLISSIKD 179

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           K+ PLG++I+FV GHGP ST G ER+ NP++  N+
Sbjct: 180 KLFPLGNDITFVPGHGPTSTFGIERQQNPYVADNM 214


>gi|24374576|ref|NP_718619.1| metallo-beta-lactamase family protein [Shewanella oneidensis MR-1]
 gi|24349179|gb|AAN56063.1|AE015741_8 metallo-beta-lactamase family protein [Shewanella oneidensis MR-1]
          Length = 214

 Score =  186 bits (473), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 88/213 (41%), Positives = 134/213 (62%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + I+ VTPF+QNC+ ++ E++  A VVDPGG++D I   I      + ++ +THGH+D
Sbjct: 1   MKYQIIPVTPFQQNCSLIWCEKTKRAAVVDPGGNVDRILREIAKLGLTLDKVLLTHGHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVGGA  L +  ++ IIGPH+ D   +  + +Q++      +      D++L DG+T+ +
Sbjct: 61  HVGGAKLLAQQANVPIIGPHEADKFWIENLPKQSQNFGFP-HCDAFEPDQYLHDGNTVTV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGH+PGHV + +  +  A +GD LFRSSIGRTD    ++Q LI+SI +K+
Sbjct: 120 GEQSLTVLHCPGHTPGHVAFYSASSKLAWVGDILFRSSIGRTDFPQSNHQSLIHSITSKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            PLG ++ F+ GHGP ST G ER  NPF+   +
Sbjct: 180 WPLGADVEFIPGHGPISTFGEEREHNPFVADQL 212


>gi|91227206|ref|ZP_01261665.1| glyoxylase II family protein [Vibrio alginolyticus 12G01]
 gi|91188734|gb|EAS75022.1| glyoxylase II family protein [Vibrio alginolyticus 12G01]
          Length = 218

 Score =  186 bits (472), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 89/214 (41%), Positives = 131/214 (61%), Gaps = 2/214 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L + +V VT F QNC+ ++ +E+++ +VVDPGGD   +  +I+     V  + +THGH+D
Sbjct: 3   LKYQVVPVTSFSQNCSIVWCDETMKGIVVDPGGDEKQLAMLIKELGVDVVNLVLTHGHLD 62

Query: 64  HVGGAAQLKEDLSLT-IIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLL 122
           HVGG   L   L  T I+GPHK D   +  ++ Q+++    +        +WL +GDT+ 
Sbjct: 63  HVGGTEPLSALLGGTEIVGPHKADNFWLQGLEGQSQMFGFPL-TEAFEPHQWLNEGDTVT 121

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
            G  +  VFH PGH+PGHV+  + E   A +GD LF  SIGRTD   GD+  LI+SI  K
Sbjct: 122 FGNQVLNVFHTPGHTPGHVVLYSEEARLAFVGDVLFNGSIGRTDFPQGDFNTLISSIKEK 181

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           + PLG++++FV GHGP ST G ER+ NPF+   +
Sbjct: 182 LWPLGNDVTFVPGHGPQSTFGHERKTNPFVADEM 215


>gi|293610180|ref|ZP_06692481.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292827412|gb|EFF85776.1| conserved hypothetical protein [Acinetobacter sp. SH024]
          Length = 214

 Score =  186 bits (472), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 86/209 (41%), Positives = 128/209 (61%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L   IV VT F QNC+ ++D E+ EAV++D GGD  ++K  +++    VK +W+THGH+D
Sbjct: 2   LQVKIVPVTAFAQNCSLVWDSETKEAVLIDAGGDAAVLKKEVEALGLKVKALWLTHGHLD 61

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H G   +L ++ S+ +IGPHK+D   +  + E +      +  +    D+WL+ G+ L L
Sbjct: 62  HAGAVGELAKEWSVPVIGPHKEDQFWLDMIQEVSARYGFPI-PQPVKVDQWLEGGEVLKL 120

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   F+V   PGH+PGHV++ N  +     GD LF+ SIGRTD   G++ QLI SI  + 
Sbjct: 121 GEDEFEVRFAPGHTPGHVVFYNKNHGLLWTGDVLFKGSIGRTDFPRGNHDQLIESIKREC 180

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
             L D+  F+ GHGP STIG E++ NPF+
Sbjct: 181 FSLPDDTQFISGHGPMSTIGYEKQFNPFV 209


>gi|269967087|ref|ZP_06181155.1| glyoxylase II family protein [Vibrio alginolyticus 40B]
 gi|269828346|gb|EEZ82612.1| glyoxylase II family protein [Vibrio alginolyticus 40B]
          Length = 218

 Score =  186 bits (472), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 89/214 (41%), Positives = 130/214 (60%), Gaps = 2/214 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L + +V VT F QNC+ ++ +E+++ +VVDPGGD   +  +I+     V  + +THGH+D
Sbjct: 3   LKYQVVPVTSFSQNCSIVWCDETMKGIVVDPGGDEKQLAMLIKELGVDVVNLVLTHGHLD 62

Query: 64  HVGGAAQLKEDLSLT-IIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLL 122
           HVGG   L   L  T I+GPHK D   +  ++ Q+++    +        +WL +GDT+ 
Sbjct: 63  HVGGTEPLSALLGGTEIVGPHKADNFWLQGLEGQSQMFGFPLT-EAFEPHQWLSEGDTVT 121

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
            G  +  VFH PGH+PGHV+  + E   A +GD LF  SIGRTD   GD+  LI+SI  K
Sbjct: 122 FGNQVLNVFHTPGHTPGHVVLYSEEARLAFVGDVLFNGSIGRTDFPQGDFNTLISSIKEK 181

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           + PLG +++FV GHGP ST G ER+ NPF+   +
Sbjct: 182 LWPLGSDVTFVPGHGPQSTFGHERKTNPFVADEM 215


>gi|241758936|ref|ZP_04757048.1| hydroxyacylglutathione hydrolase [Neisseria flavescens SK114]
 gi|241320757|gb|EER56990.1| hydroxyacylglutathione hydrolase [Neisseria flavescens SK114]
          Length = 212

 Score =  186 bits (471), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 84/209 (40%), Positives = 131/209 (62%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L F I  VTPF+QNCT ++D+E+ EAV+ D GGD+  +   +Q++   +  IW+THGH+D
Sbjct: 3   LQFEINAVTPFRQNCTLIWDDETKEAVLTDVGGDVPYLLQQVQNKGLKLTAIWLTHGHLD 62

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GG  +L +   + ++GPHKDD  ++  + +        ++  + +  RWL++G++L +
Sbjct: 63  HAGGVVELLKTCDIPVLGPHKDDEFLLQALPQTTAQYGFPVSP-SFTPTRWLEEGESLKV 121

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G H F+V H PGH+PG V++ N EN     GD LF  ++GRTD   G++  LIN+I  K+
Sbjct: 122 GNHSFQVLHIPGHTPGQVVFYNAENGLLVAGDVLFYETVGRTDFPRGNHDDLINNICAKL 181

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           L L +    + GHG  ++IG E+R NPFL
Sbjct: 182 LTLPETTQVIAGHGRMTSIGHEKRYNPFL 210


>gi|304411881|ref|ZP_07393492.1| beta-lactamase domain-containing protein [Shewanella baltica OS183]
 gi|307303351|ref|ZP_07583106.1| beta-lactamase domain-containing protein [Shewanella baltica BA175]
 gi|304349741|gb|EFM14148.1| beta-lactamase domain-containing protein [Shewanella baltica OS183]
 gi|306913711|gb|EFN44133.1| beta-lactamase domain-containing protein [Shewanella baltica BA175]
          Length = 214

 Score =  186 bits (471), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 88/213 (41%), Positives = 134/213 (62%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + I+ VTPF+QNC+ ++ E++  A VVDPGG++D I++ +      + +I +THGH+D
Sbjct: 1   MKYQIIPVTPFQQNCSLIWCEKTKRAAVVDPGGNIDRIQNEVTKLGLVLDKIILTHGHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVGGA  L +  ++ IIGPH  D   +  + +Q++      +      D++LQDGD + +
Sbjct: 61  HVGGAKALAQAANVPIIGPHIADKFWIENLPKQSQNFGFP-HCDAFEPDQYLQDGDNVQV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGH+PGH+   + ++  A +GD LFRSSIGRTD    ++Q LI+SI  K+
Sbjct: 120 GEQSLSVLHCPGHTPGHIALFSAQSKLAWVGDILFRSSIGRTDFPQSNHQDLIHSITEKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            PLG ++ F+ GHGP ST G ER  NPF+   +
Sbjct: 180 WPLGVDVEFIPGHGPISTFGEEREHNPFVADQL 212


>gi|126174941|ref|YP_001051090.1| beta-lactamase domain-containing protein [Shewanella baltica OS155]
 gi|125998146|gb|ABN62221.1| beta-lactamase domain protein [Shewanella baltica OS155]
          Length = 214

 Score =  186 bits (471), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 88/213 (41%), Positives = 134/213 (62%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + I+ VTPF+QNC+ ++ E++  A VVDPGG++D I++ +      + +I +THGH+D
Sbjct: 1   MKYQIIPVTPFQQNCSLIWCEKTKRAAVVDPGGNIDRIQNEVTKLGLVLDKIILTHGHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVGGA  L +  ++ IIGPH  D   +  + +Q++      +      D++LQDGD + +
Sbjct: 61  HVGGAKALAQATNVPIIGPHIADKFWIDNLPKQSQNFGFP-HCDAFEPDQYLQDGDNVQV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGH+PGH+   + ++  A +GD LFRSSIGRTD    ++Q LI+SI  K+
Sbjct: 120 GEQSLSVLHCPGHTPGHIALFSAQSKLAWVGDILFRSSIGRTDFPQSNHQDLIHSITEKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            PLG ++ F+ GHGP ST G ER  NPF+   +
Sbjct: 180 WPLGVDVEFIPGHGPISTFGEEREHNPFVADQL 212


>gi|114321333|ref|YP_743016.1| beta-lactamase domain-containing protein [Alkalilimnicola ehrlichii
           MLHE-1]
 gi|114227727|gb|ABI57526.1| beta-lactamase domain protein [Alkalilimnicola ehrlichii MLHE-1]
          Length = 215

 Score =  186 bits (471), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 84/209 (40%), Positives = 131/209 (62%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +  +++ VT F+QNC  +  E +  A VVDPGG++D +   ++     V +I +TH H+D
Sbjct: 1   MKLYVIPVTSFRQNCAVVACERTGLAAVVDPGGEVDKVLAEVEDLGLTVDRILLTHAHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVGG  ++ + L + I GPH+ D  ++ ++DEQAR+      A     D W++DG+ + +
Sbjct: 61  HVGGVREMADRLQVPIFGPHQADRELLSQLDEQARMFG-HPPAPAFEPDHWVEDGEIVRV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V   PGH+PGHV Y + E+ +A  GD LF+ +IGR+D   GD+  L+ SI  K+
Sbjct: 120 GEVALRVVLVPGHTPGHVAYFDPESRYALTGDLLFQGAIGRSDFPGGDHDTLVQSIREKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
            PLGD+++F+ GHGP S+ G ERR NPF+
Sbjct: 180 FPLGDDVTFIPGHGPASSFGEERRSNPFV 208


>gi|325124355|gb|ADY83878.1| enzyme with metallo-hydrolase/oxidoreductase domain [Acinetobacter
           calcoaceticus PHEA-2]
          Length = 214

 Score =  186 bits (471), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 86/209 (41%), Positives = 128/209 (61%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L   IV VT F QNC+ ++D E+ EAV++D GGD  ++K  +++    VK +W+THGH+D
Sbjct: 2   LQVKIVPVTAFAQNCSLVWDSETKEAVLIDAGGDASVLKKEVEALGLKVKALWLTHGHLD 61

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H G   +L ++ ++ +IGPHK+D   +  + E +      +  +    D+WL+ G+ L L
Sbjct: 62  HAGAVGELAKEWNVPVIGPHKEDQFWLDMIQEVSARYGFPI-PQPVKVDQWLEGGEVLKL 120

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   F+V   PGH+PGHVI+ N  +     GD LF+ SIGRTD   G++ QLI SI  + 
Sbjct: 121 GEDEFEVRFAPGHTPGHVIFYNKNHGLLWTGDVLFKGSIGRTDFPRGNHDQLIESIKREC 180

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
             L D+  F+ GHGP STIG E++ NPF+
Sbjct: 181 FSLPDDTQFISGHGPMSTIGYEKQFNPFV 209


>gi|163750204|ref|ZP_02157446.1| metallo-beta-lactamase family protein [Shewanella benthica KT99]
 gi|161330060|gb|EDQ01044.1| metallo-beta-lactamase family protein [Shewanella benthica KT99]
          Length = 214

 Score =  185 bits (470), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 85/213 (39%), Positives = 135/213 (63%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + I+ VTPF+QNC+ ++ +++  A VVDPGGD+D I   +      ++++ +THGH+D
Sbjct: 1   MKYQIIPVTPFQQNCSLIWCDKTKAAAVVDPGGDMDRILVEVDKLGVKLEKVLLTHGHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG A +L E + + IIGPHK D+  +  + EQ++     ++    +  ++L+ GDT+ L
Sbjct: 61  HVGAAKKLSEHVGIPIIGPHKADSFWLENLAEQSKHFGF-VHCEPFAPTQYLESGDTVTL 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G+   +V HCPGH+PGH+++ +  +  A +GD LF  SIGRTD    ++Q LI+SI   +
Sbjct: 120 GSLTLEVLHCPGHTPGHIVFFSASSCTAWVGDVLFHGSIGRTDFPQSNHQDLIHSITKTL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            PLG  + F+ GHGP ST G ER  NPF+   +
Sbjct: 180 WPLGRNVEFIPGHGPISTFGTERDQNPFVADQL 212


>gi|323500085|ref|ZP_08105039.1| hypothetical protein VISI1226_08734 [Vibrio sinaloensis DSM 21326]
 gi|323314941|gb|EGA67998.1| hypothetical protein VISI1226_08734 [Vibrio sinaloensis DSM 21326]
          Length = 218

 Score =  185 bits (469), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 86/214 (40%), Positives = 131/214 (61%), Gaps = 2/214 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L + +V VT F QNC+ ++ +E+++ +VVDPGGD+  +  +I+     V  + +THGH+D
Sbjct: 3   LKYQVVPVTSFSQNCSIVWCDETMKGIVVDPGGDVKQLAMLIKELGVDVVNLVLTHGHLD 62

Query: 64  HVGGAAQLKEDLS-LTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLL 122
           HVGG   L + L  + I+GPH++D   +  ++ Q+++    +        +WL +GD + 
Sbjct: 63  HVGGTEPLADALGGVEIVGPHREDNFWLQGLEGQSQMFGFPL-TEAFEPHKWLNEGDKIT 121

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
            G  +  V H PGH+PGHV+  + E   A +GD LF  S+GRTD   GD+  LINSI  K
Sbjct: 122 FGNQVMDVIHTPGHTPGHVVLFSQEAKLAFVGDVLFNGSVGRTDFPKGDFNTLINSIKTK 181

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           + PLG+++ FV GHGP ST GRER  NPF+   +
Sbjct: 182 LWPLGNDVRFVPGHGPESTFGRERASNPFVADEM 215


>gi|237808753|ref|YP_002893193.1| beta-lactamase domain-containing protein [Tolumonas auensis DSM
           9187]
 gi|237501014|gb|ACQ93607.1| beta-lactamase domain protein [Tolumonas auensis DSM 9187]
          Length = 214

 Score =  185 bits (469), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 88/209 (42%), Positives = 137/209 (65%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L + I+ VT F+QNCT L+ +E+ +A ++DPGGD++ +   ++  N  + ++ +THGH+D
Sbjct: 2   LQYQIIPVTAFQQNCTLLWCDETHQAALIDPGGDIEKLLQAVEKNNLTLTKLLLTHGHLD 61

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVGGA +L++     IIGPH+ DA  +  +  Q+ +     +    + D WL + DT+ +
Sbjct: 62  HVGGADKLRKRTGCPIIGPHQADAFWLNALPAQSEMFGFA-HTDVFTPDNWLTETDTVTV 120

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGHV++ + ++  A +GD LF  SIGRTD   G++  LIN+I  K+
Sbjct: 121 GNLELQVLHCPGHTPGHVVFYHADSQLAIVGDVLFNGSIGRTDFPQGNHTDLINAITQKL 180

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           LPLGD++ F+ GHGP ST+G ER  NP+L
Sbjct: 181 LPLGDDVKFIPGHGPMSTLGHERVSNPYL 209


>gi|50086246|ref|YP_047756.1| hypothetical protein ACIAD3254 [Acinetobacter sp. ADP1]
 gi|49532222|emb|CAG69934.1| putative enzyme [Acinetobacter sp. ADP1]
          Length = 215

 Score =  185 bits (469), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 88/209 (42%), Positives = 128/209 (61%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L   IV VT F QNC+ L+D ES EAV++D GG+   +K  +++    VK +W+THGH+D
Sbjct: 3   LQVKIVPVTAFAQNCSILWDSESKEAVLIDAGGEAVKLKQEVEAMGLKVKALWLTHGHLD 62

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H G   +L +   + +IGPHKDD   +  + + ++     +  +    D WL+ G+ L L
Sbjct: 63  HAGAVGELAKLWQVPVIGPHKDDQFWLDMIQDVSKRYGFPI-PQPVQVDTWLEGGEILEL 121

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   F+V   PGH+PGHV++ + E +    GD LF+ SIGRTD   G++QQLI+SI  + 
Sbjct: 122 GQTKFEVRFAPGHTPGHVMFYSPEYHLLWTGDVLFKGSIGRTDFPRGNHQQLIDSIQREC 181

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
             L DE  F+ GHGP STIG E++ NPF+
Sbjct: 182 FSLPDETQFISGHGPMSTIGHEKKFNPFV 210


>gi|157374801|ref|YP_001473401.1| beta-lactamase domain-containing protein [Shewanella sediminis
           HAW-EB3]
 gi|157317175|gb|ABV36273.1| beta-lactamase domain protein [Shewanella sediminis HAW-EB3]
          Length = 223

 Score =  184 bits (468), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 83/213 (38%), Positives = 133/213 (62%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + I+ VTP++QNC+ ++  ++++A V+DPGGDL+ I   +      V+++ +THGH+D
Sbjct: 10  MKYQIIPVTPYQQNCSLIWCNKTMKAAVIDPGGDLERILAEVNKLGVTVEKVLLTHGHID 69

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG A +L + L +T++GPH+DD  ++  + +Q+                +L+DG ++ +
Sbjct: 70  HVGAAKRLADHLGITVLGPHRDDTFLLETLPDQSSDFGFPA-CEVLIPGEYLEDGASVTV 128

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGHV++ +  +  A +GD LF  S+GRTD     +Q LI+SI  K+
Sbjct: 129 GEQTLQVIHCPGHTPGHVVFYSEADKRAWVGDVLFHGSVGRTDFPRSSHQDLIDSITKKL 188

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            PLG E+ FV GHGP ST G ER  NPF+   +
Sbjct: 189 WPLGREVEFVPGHGPISTFGNERDQNPFVADQL 221


>gi|307293475|ref|ZP_07573319.1| beta-lactamase-like protein [Sphingobium chlorophenolicum L-1]
 gi|306879626|gb|EFN10843.1| beta-lactamase-like protein [Sphingobium chlorophenolicum L-1]
          Length = 237

 Score =  184 bits (466), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 87/215 (40%), Positives = 125/215 (58%), Gaps = 2/215 (0%)

Query: 2   SKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGH 61
             L   ++ VTP +QNCT  +   +     VDPGGDL ++K   +     +++I +THGH
Sbjct: 23  PPLKAALIPVTPLQQNCTLFWCTATNRGAFVDPGGDLPMLKKAAEQHGVTIEKILVTHGH 82

Query: 62  VDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
           +DH G A  L  DL + I GPH+ D   + ++ E      I  N  +   DRWL+DGD +
Sbjct: 83  IDHCGQAGMLARDLGVPIEGPHEADRFWIDRLGEDGTKYGI--NGESFEPDRWLKDGDQV 140

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
            +G     V+HCPGH+PGHV++ +  +  A +GD LF+ SIGRTD   G++Q LI++I  
Sbjct: 141 TVGNLTLDVYHCPGHTPGHVVFHHAPSKLAIVGDVLFQGSIGRTDFPMGNHQDLIDAITG 200

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           K+ PLG +  FV GHGP S    ERR NPF+   +
Sbjct: 201 KLWPLGGDTVFVPGHGPMSNFAHERRTNPFVGDAV 235


>gi|162146767|ref|YP_001601228.1| beta-lactamase-like protein [Gluconacetobacter diazotrophicus PAl
           5]
 gi|161785344|emb|CAP54891.1| Beta-lactamase-like protein [Gluconacetobacter diazotrophicus PAl
           5]
          Length = 231

 Score =  184 bits (466), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 96/218 (44%), Positives = 135/218 (61%), Gaps = 7/218 (3%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           +  L   +V VT F QNC+ L+D  S  AVVVDPGGD+  +   + SR+  V  I +THG
Sbjct: 14  LDGLELVVVPVTAFGQNCSILWDPGSRHAVVVDPGGDVPRLLHELASRDLTVDAILLTHG 73

Query: 61  HVDHVGGAAQLKEDLS------LTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRW 114
           H+DH GGA  L+ +LS      + +IGP   DA ++  +  QA    +    R+ + DR+
Sbjct: 74  HLDHAGGADALRAELSGRQGAAVPVIGPDARDAFLLSDIAAQAARYGLE-GMRDVTVDRF 132

Query: 115 LQDGDTLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQ 174
           + D + L L    F+V H PGH+PGHV++ +    FA +GDTLFR S+GRTD  +GD  Q
Sbjct: 133 VTDNEILPLLGRSFEVRHVPGHTPGHVVFYDPRARFACVGDTLFRGSVGRTDFPYGDGPQ 192

Query: 175 LINSINNKILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           LI +I +++LPLGD++S + GHG  +TIG ER  NPFL
Sbjct: 193 LIKAITDRLLPLGDDVSILPGHGGLTTIGAERHGNPFL 230


>gi|34495542|ref|NP_899757.1| metallo-beta-lactamase [Chromobacterium violaceum ATCC 12472]
 gi|34101397|gb|AAQ57766.1| probable metallo-beta-lactamase [Chromobacterium violaceum ATCC
           12472]
          Length = 216

 Score =  184 bits (466), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 84/209 (40%), Positives = 133/209 (63%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L +H++ VTPF QNC+ L+ + S +A VVD GGD++ I+  +  +   V+++ +THGH+D
Sbjct: 3   LKYHVIPVTPFAQNCSVLWCDASRKAAVVDAGGDIERIQAWVDGQGLTVEKLLLTHGHID 62

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GGAA+L E L ++I GP + +   + ++  Q ++      +   +  RWL++GDT+ +
Sbjct: 63  HAGGAARLAEKLGVSIEGPQRAERFWLDQLPTQGQMFGFP-RSEPLTPQRWLEEGDTVTV 121

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGH+PGHV++ +        GD LF+ SIGRTD   G++QQLI++I  K+
Sbjct: 122 GQETLDVIHCPGHTPGHVVFHSPAAKVLVAGDVLFQGSIGRTDFPMGNHQQLIDAIQQKL 181

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
             L D+   + GHGP +TIG E+R NP++
Sbjct: 182 FVLPDDTVVIPGHGPFTTIGAEKRGNPYV 210


>gi|209543246|ref|YP_002275475.1| beta-lactamase domain-containing protein [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209530923|gb|ACI50860.1| beta-lactamase domain protein [Gluconacetobacter diazotrophicus PAl
           5]
          Length = 226

 Score =  183 bits (465), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 96/218 (44%), Positives = 135/218 (61%), Gaps = 7/218 (3%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           +  L   +V VT F QNC+ L+D  S  AVVVDPGGD+  +   + SR+  V  I +THG
Sbjct: 9   LDGLELVVVPVTAFGQNCSILWDPGSRHAVVVDPGGDVPRLLHELASRDLTVDAILLTHG 68

Query: 61  HVDHVGGAAQLKEDLS------LTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRW 114
           H+DH GGA  L+ +LS      + +IGP   DA ++  +  QA    +    R+ + DR+
Sbjct: 69  HLDHAGGADALRAELSGRQGAAVPVIGPDARDAFLLSDIAAQAARYGLE-GMRDVTVDRF 127

Query: 115 LQDGDTLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQ 174
           + D + L L    F+V H PGH+PGHV++ +    FA +GDTLFR S+GRTD  +GD  Q
Sbjct: 128 VTDNEILPLLGRSFEVRHVPGHTPGHVVFYDPRARFACVGDTLFRGSVGRTDFPYGDGPQ 187

Query: 175 LINSINNKILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           LI +I +++LPLGD++S + GHG  +TIG ER  NPFL
Sbjct: 188 LIKAITDRLLPLGDDVSILPGHGGLTTIGAERHGNPFL 225


>gi|294013221|ref|YP_003546681.1| beta-lactamase-like protein [Sphingobium japonicum UT26S]
 gi|292676551|dbj|BAI98069.1| beta-lactamase-like protein [Sphingobium japonicum UT26S]
          Length = 218

 Score =  183 bits (464), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 86/215 (40%), Positives = 126/215 (58%), Gaps = 2/215 (0%)

Query: 2   SKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGH 61
             L   ++ VTP +QNCT  +   +     VDPGGDL +++   +     +++I +THGH
Sbjct: 4   PPLKAALIPVTPLQQNCTLFWCTATNRGAFVDPGGDLPLLRKAAEQHGVTIEKILVTHGH 63

Query: 62  VDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
           +DH G A  L  DL + I GPH+ D   + ++ E      I  N  +   DRWL+DGD +
Sbjct: 64  IDHCGQAGILARDLGVPIEGPHEADRFWIDRLGEDGARYGI--NGESFEPDRWLKDGDQV 121

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
            +G     V+HCPGH+PGHV++ +  +  A +GD LF+ SIGRTD   G++Q LI++I  
Sbjct: 122 TVGNLTLDVYHCPGHTPGHVVFHHAPSKLAIVGDVLFQGSIGRTDFPMGNHQDLIDAITG 181

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           K+ PLG + +FV GHGP S    ERR NPF+   +
Sbjct: 182 KLWPLGGDTAFVPGHGPMSNFAHERRTNPFVGDAV 216


>gi|71279331|ref|YP_270254.1| metallo-beta-lactamase family protein [Colwellia psychrerythraea
           34H]
 gi|71145071|gb|AAZ25544.1| metallo-beta-lactamase family protein [Colwellia psychrerythraea
           34H]
          Length = 219

 Score =  183 bits (464), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 90/208 (43%), Positives = 127/208 (61%), Gaps = 1/208 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L   I+ VTPF+QNCT  +  ++ +A VVDPGGD++ IK  I      +++I ITH H+D
Sbjct: 2   LKHEIIPVTPFEQNCTLFWCSDTKKAAVVDPGGDIEKIKAGITKHGLTLEKILITHAHID 61

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMM-GKVDEQARLLSIRMNARNASSDRWLQDGDTLL 122
           H G    L     + I GPHK+D   + G  D++ R       A+  + +R+L  GDT+ 
Sbjct: 62  HAGATDDLANHYDVLIEGPHKEDQFWIDGIEDQKQRFGGAFSYAKKFTPNRFLDQGDTVS 121

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
            G  + +V+ CPGH+PGHV++ + E+  A +GD LF  SIGRTD   GD+  LINSI   
Sbjct: 122 FGNIVMEVYFCPGHTPGHVVFFHRESKLAQVGDVLFSGSIGRTDFPRGDHATLINSIRKN 181

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNP 210
           +  LGD++ F+ GHGP ST G+ERR NP
Sbjct: 182 LFLLGDDVRFIPGHGPMSTFGQERRSNP 209


>gi|145588220|ref|YP_001154817.1| beta-lactamase domain-containing protein [Polynucleobacter
           necessarius subsp. asymbioticus QLW-P1DMWA-1]
 gi|145046626|gb|ABP33253.1| beta-lactamase domain protein [Polynucleobacter necessarius subsp.
           asymbioticus QLW-P1DMWA-1]
          Length = 214

 Score =  183 bits (464), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 86/209 (41%), Positives = 134/209 (64%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +   IV VTP++QNC+ L  +E+ +A V+DPGGD++ I D ++     VK+I +THGH+D
Sbjct: 3   IKLGIVPVTPYEQNCSILVCQETGDAAVIDPGGDIEKILDGVKQMGGQVKKILLTHGHLD 62

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H   A  L + L++ I GP +++   + ++ EQ        +A+    +RWL DGD + +
Sbjct: 63  HCAAAKDLADQLAVPIEGPQEEERFWIDQLPEQTVRFGFG-HAKVFEPNRWLNDGDHVKV 121

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +VFHCPGH+PGH+++ +  +  A +GD LF  SIGRTD   G++  LI++I  K+
Sbjct: 122 GNVDLEVFHCPGHTPGHIVFFDRADRLAIVGDVLFAGSIGRTDFPRGNHADLIHAIRTKL 181

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
            PLGD++ FV GHGP S  G+ER+ NP++
Sbjct: 182 WPLGDDVQFVPGHGPMSNFGQERKTNPYV 210


>gi|325129367|gb|EGC52202.1| metallo-beta-lactamase domain protein [Neisseria meningitidis
           OX99.30304]
          Length = 210

 Score =  183 bits (464), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 82/209 (39%), Positives = 130/209 (62%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L + I+ VTPF+QNCT ++D+ES EAV+ D GGD+  +   + +R   +  IW+THGH+D
Sbjct: 3   LRYEILSVTPFRQNCTLIWDDESGEAVLTDVGGDVPFLLQALANRKLTLTAIWLTHGHLD 62

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GG  ++ +  ++ ++GPH DD  ++  + +        ++   A  +RWL++G+TL +
Sbjct: 63  HAGGVVEMLKTRNVPVLGPHPDDEFLLQSLPQTTAQYGFPVSPAFAP-NRWLEEGETLTV 121

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G + F+V H PGH+PGH+++   E      GD LF  +IGRTD   G++  LIN+I NK+
Sbjct: 122 GRYAFQVLHIPGHTPGHIVFYCAEAELLIAGDVLFYETIGRTDFPRGNHADLINNIRNKL 181

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
             L + +  V GHG  ++IG E+R NPF 
Sbjct: 182 FALPETVQVVAGHGRMTSIGHEKRHNPFF 210


>gi|261378660|ref|ZP_05983233.1| metallo-beta-lactamase domain protein [Neisseria cinerea ATCC
           14685]
 gi|269145003|gb|EEZ71421.1| metallo-beta-lactamase domain protein [Neisseria cinerea ATCC
           14685]
          Length = 210

 Score =  182 bits (463), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 83/209 (39%), Positives = 130/209 (62%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L + I+ VTPF+QNCT ++D+ES EAV+ D GGD+  +   + +R   +  IW+THGH+D
Sbjct: 3   LRYEILSVTPFRQNCTLIWDDESGEAVLTDVGGDVPFLLQELANRKLTLTAIWLTHGHLD 62

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GG  ++ +  ++ ++GPH DD  ++  + +        ++    S +RWL++G+TL +
Sbjct: 63  HAGGVVEMLKTRNVPVLGPHPDDEFLLQSLPQTTAQYGFPVSPA-FSPNRWLEEGETLTV 121

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G + F+V H PGH+PGHV++   E      GD LF  +IGRTD   G++  LIN+I NK+
Sbjct: 122 GRYAFQVLHIPGHTPGHVVFYCAEAELLIAGDVLFYETIGRTDFPRGNHADLINNIRNKL 181

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
             L + +  V GHG  ++IG E+R NPF 
Sbjct: 182 FALPETVQVVAGHGRMTSIGHEKRHNPFF 210


>gi|87200383|ref|YP_497640.1| beta-lactamase-like [Novosphingobium aromaticivorans DSM 12444]
 gi|87136064|gb|ABD26806.1| beta-lactamase-like protein [Novosphingobium aromaticivorans DSM
           12444]
          Length = 245

 Score =  182 bits (463), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 83/205 (40%), Positives = 130/205 (63%), Gaps = 2/205 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           I+ VTP +QNCT ++  ++++   +D GGDL+ ++  ++     ++++ +THGH+DH G 
Sbjct: 37  IIPVTPLEQNCTLVWCTKTMKGAFIDAGGDLEKLRKAVEKTGVTIEKLLVTHGHIDHCGM 96

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
              L ++L + I GPH+ D   + ++DE  R   I       +  RWL DGD + +G   
Sbjct: 97  TGILAKELGVPIEGPHEADRFWISRLDEDGRRWGITGEVFEPT--RWLSDGDKVTVGEVE 154

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
             V HCPGH+PGHV++    +  A +GD LF+ SIGRTD   G++Q LI+SI  K+ PLG
Sbjct: 155 LDVIHCPGHTPGHVVFHYAPSRVAIVGDVLFQGSIGRTDFPMGNHQDLIDSITGKLWPLG 214

Query: 188 DEISFVCGHGPNSTIGRERRLNPFL 212
           ++++FV GHGPNST GRER+ N ++
Sbjct: 215 NDVTFVPGHGPNSTFGRERQTNAYV 239


>gi|194099693|ref|YP_002002828.1| putative hydrolase [Neisseria gonorrhoeae NCCP11945]
 gi|239999883|ref|ZP_04719807.1| putative hydrolase [Neisseria gonorrhoeae 35/02]
 gi|240015612|ref|ZP_04722152.1| putative hydrolase [Neisseria gonorrhoeae FA6140]
 gi|240081780|ref|ZP_04726323.1| putative hydrolase [Neisseria gonorrhoeae FA19]
 gi|240114060|ref|ZP_04728550.1| putative hydrolase [Neisseria gonorrhoeae MS11]
 gi|240114702|ref|ZP_04728764.1| putative hydrolase [Neisseria gonorrhoeae PID18]
 gi|240122539|ref|ZP_04735495.1| putative hydrolase [Neisseria gonorrhoeae PID332]
 gi|254492759|ref|ZP_05105930.1| hydrolase [Neisseria gonorrhoeae 1291]
 gi|260441490|ref|ZP_05795306.1| putative hydrolase [Neisseria gonorrhoeae DGI2]
 gi|268595693|ref|ZP_06129860.1| glyoxalase II family protein [Neisseria gonorrhoeae 35/02]
 gi|268597879|ref|ZP_06132046.1| glyoxalase II family protein [Neisseria gonorrhoeae FA19]
 gi|268600127|ref|ZP_06134294.1| hydrolase [Neisseria gonorrhoeae MS11]
 gi|268600348|ref|ZP_06134515.1| hydrolase [Neisseria gonorrhoeae PID18]
 gi|268681128|ref|ZP_06147990.1| hydrolase [Neisseria gonorrhoeae PID332]
 gi|291044854|ref|ZP_06570563.1| conserved hypothetical protein [Neisseria gonorrhoeae DGI2]
 gi|293397932|ref|ZP_06642138.1| hydrolase [Neisseria gonorrhoeae F62]
 gi|193934983|gb|ACF30807.1| putative hydrolase [Neisseria gonorrhoeae NCCP11945]
 gi|226511799|gb|EEH61144.1| hydrolase [Neisseria gonorrhoeae 1291]
 gi|268549082|gb|EEZ44500.1| glyoxalase II family protein [Neisseria gonorrhoeae 35/02]
 gi|268551667|gb|EEZ46686.1| glyoxalase II family protein [Neisseria gonorrhoeae FA19]
 gi|268584258|gb|EEZ48934.1| hydrolase [Neisseria gonorrhoeae MS11]
 gi|268584479|gb|EEZ49155.1| hydrolase [Neisseria gonorrhoeae PID18]
 gi|268621412|gb|EEZ53812.1| hydrolase [Neisseria gonorrhoeae PID332]
 gi|291011748|gb|EFE03744.1| conserved hypothetical protein [Neisseria gonorrhoeae DGI2]
 gi|291611878|gb|EFF40947.1| hydrolase [Neisseria gonorrhoeae F62]
 gi|317165178|gb|ADV08719.1| putative hydrolase [Neisseria gonorrhoeae TCDC-NG08107]
          Length = 210

 Score =  182 bits (463), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 82/209 (39%), Positives = 129/209 (61%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L + I+ VTPF+QNCT ++D+ES EAV+ D GGD+  +   + +R   +  IW+THGH+D
Sbjct: 3   LRYEILPVTPFRQNCTLIWDDESGEAVLTDVGGDVPFLLQALANRKLTLTAIWLTHGHLD 62

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GG  ++ E   + ++GPH++D  ++  + +        ++   A  +RWL++G+TL +
Sbjct: 63  HAGGVVEMLETHKVPVLGPHREDEFLLQSLPQTTAQYGFPVSPAFAP-NRWLEEGETLTV 121

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G + F+V H PGH+PGHV++   E      GD LF  +IGRTD   G++  LIN+I NK+
Sbjct: 122 GRYAFQVLHIPGHTPGHVVFYCAEAELLIAGDVLFYETIGRTDFPRGNHADLINNIRNKL 181

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
               + +  V GHG  ++IG E+R NPF 
Sbjct: 182 FAFPETVQVVAGHGRMTSIGHEKRHNPFF 210


>gi|296314833|ref|ZP_06864774.1| metallo-beta-lactamase domain protein [Neisseria polysaccharea ATCC
           43768]
 gi|296838386|gb|EFH22324.1| metallo-beta-lactamase domain protein [Neisseria polysaccharea ATCC
           43768]
          Length = 210

 Score =  182 bits (463), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 82/209 (39%), Positives = 131/209 (62%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L + I+ VTPF+QNCT ++D+ES EAV+ D GGD+  +   + +R   +  IW+THGH+D
Sbjct: 3   LRYEILSVTPFRQNCTLIWDDESGEAVLTDVGGDVPFLLQELANRKLTLTAIWLTHGHLD 62

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GG  ++ +  ++ ++GPH++D  ++  + +        ++   A + RWL++G+TL +
Sbjct: 63  HAGGVVEMLKTRNVPVLGPHREDEFLLQSLPQTTAQYGFPVSPAFAPT-RWLEEGETLTV 121

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G + F+V H PGH+PGHV++   E      GD LF  +IGRTD   G++  LIN+I NK+
Sbjct: 122 GRYAFQVLHIPGHTPGHVVFYCAEAELLIAGDVLFYETIGRTDFPRGNHADLINNIRNKL 181

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
             L + +  V GHG  ++IG E+R NPF 
Sbjct: 182 FALPETVQVVAGHGRMTSIGHEKRHNPFF 210


>gi|218767379|ref|YP_002341891.1| putative hydrolase [Neisseria meningitidis Z2491]
 gi|121051387|emb|CAM07679.1| putative hydrolase [Neisseria meningitidis Z2491]
 gi|254673753|emb|CBA09424.1| glyoxalase II family protein [Neisseria meningitidis alpha275]
 gi|319409640|emb|CBY89940.1| putative metallo-dependent hydrolase [Neisseria meningitidis WUE
           2594]
 gi|325133375|gb|EGC56040.1| metallo-beta-lactamase domain protein [Neisseria meningitidis
           M13399]
 gi|325206953|gb|ADZ02406.1| metallo-beta-lactamase domain protein [Neisseria meningitidis
           M04-240196]
          Length = 210

 Score =  182 bits (463), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 82/209 (39%), Positives = 129/209 (61%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L + I+ VTPF+QNCT ++D+ES EAV+ D GGD+  +   + +R   +  IW+THGH+D
Sbjct: 3   LRYEILSVTPFRQNCTLIWDDESGEAVLTDVGGDVPFLLQALANRKLTLTAIWLTHGHLD 62

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GG  ++ +   + ++GPH DD  ++  + +        ++   A  +RWL++G+TL +
Sbjct: 63  HAGGVVEMLKTHKVPVLGPHPDDEFLLQSLPQTTAQYGFPVSPAFAP-NRWLEEGETLTV 121

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G + F+V H PGH+PGH+++   E      GD LF  +IGRTD   G++  LIN+I NK+
Sbjct: 122 GRYAFQVLHIPGHTPGHIVFYCAEAELLIAGDVLFYETIGRTDFPRGNHADLINNIRNKL 181

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
             L + +  V GHG  ++IG E+R NPF 
Sbjct: 182 FALPETVQVVAGHGRMTSIGHEKRHNPFF 210


>gi|124265285|ref|YP_001019289.1| putative metallo-beta-lactamase family protein [Methylibium
           petroleiphilum PM1]
 gi|124258060|gb|ABM93054.1| putative metallo-beta-lactamase family protein [Methylibium
           petroleiphilum PM1]
          Length = 215

 Score =  182 bits (463), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 87/213 (40%), Positives = 131/213 (61%), Gaps = 4/213 (1%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L +  V VT F+QNC+ ++ + +  A V+DPGG+L  ++  ++     ++ IW+TH H+D
Sbjct: 2   LQYLTVPVTAFQQNCSIVWCDATRRAAVIDPGGELPRLRAEVRRLGLTLEAIWLTHAHID 61

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDG---DT 120
           H GG AQL  + +L IIGPH  D   +  + +Q+R+      +   +  RWL  G   D 
Sbjct: 62  HAGGTAQLAREDALPIIGPHAADQFWIDGLAQQSRMFGF-PPSEPFTPTRWLCPGGVDDR 120

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           + LG    +V HCPGH+PGHV++V+ E   A +GD LF   IGRTD   GD+  L+ +I 
Sbjct: 121 VTLGDCELEVRHCPGHTPGHVVFVSREAQRAFVGDVLFAGGIGRTDFPLGDHDTLVAAIR 180

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
            ++ PLGD+I F+ GHGP S+ GRERR NP+++
Sbjct: 181 TQLWPLGDDIVFIPGHGPESSFGRERRHNPYVR 213


>gi|28898688|ref|NP_798293.1| glyoxylase II family protein [Vibrio parahaemolyticus RIMD 2210633]
 gi|153839463|ref|ZP_01992130.1| glyoxylase II family protein [Vibrio parahaemolyticus AQ3810]
 gi|260363713|ref|ZP_05776497.1| Zn-dependent hydrolase, glyoxalase II family [Vibrio
           parahaemolyticus K5030]
 gi|260879720|ref|ZP_05892075.1| Zn-dependent hydrolase, glyoxalase II family [Vibrio
           parahaemolyticus AN-5034]
 gi|260901619|ref|ZP_05910014.1| Zn-dependent hydrolase, glyoxalase II family [Vibrio
           parahaemolyticus AQ4037]
 gi|28806906|dbj|BAC60177.1| glyoxylase II family protein [Vibrio parahaemolyticus RIMD 2210633]
 gi|149747020|gb|EDM58008.1| glyoxylase II family protein [Vibrio parahaemolyticus AQ3810]
 gi|308093264|gb|EFO42959.1| Zn-dependent hydrolase, glyoxalase II family [Vibrio
           parahaemolyticus AN-5034]
 gi|308108674|gb|EFO46214.1| Zn-dependent hydrolase, glyoxalase II family [Vibrio
           parahaemolyticus AQ4037]
 gi|308113386|gb|EFO50926.1| Zn-dependent hydrolase, glyoxalase II family [Vibrio
           parahaemolyticus K5030]
 gi|328474747|gb|EGF45552.1| glyoxylase II family protein [Vibrio parahaemolyticus 10329]
          Length = 218

 Score =  182 bits (462), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 87/214 (40%), Positives = 130/214 (60%), Gaps = 2/214 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L + +V VT F QNC+ ++ +E+++ +VVDPGGD   +  +I+     V ++ +THGH+D
Sbjct: 3   LKYQVVPVTSFSQNCSIVWCDETMKGIVVDPGGDEKQLAMLIKELGVDVVKLVLTHGHLD 62

Query: 64  HVGGAAQLKEDLSLT-IIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLL 122
           HVGG   L   L  T I+GPHK D   +  ++ Q+++    +       ++WL +GD + 
Sbjct: 63  HVGGTEPLSALLGGTEIVGPHKADNFWLQGLEGQSKMFGFPL-TEAFEPNQWLNEGDVVT 121

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
            G     V H PGH+PGHV+  + E   A +GD LF  SIGRTD   GD+  LI+SI  K
Sbjct: 122 FGNQKLNVIHTPGHTPGHVVLYSEEARLAFVGDVLFNGSIGRTDFPQGDFNTLISSIKEK 181

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           + PLG++++FV GHGP ST G ER+ NPF+   +
Sbjct: 182 LWPLGNDVTFVPGHGPQSTFGHERKTNPFVADEM 215


>gi|240127248|ref|ZP_04739909.1| putative hydrolase [Neisseria gonorrhoeae SK-93-1035]
 gi|268685609|ref|ZP_06152471.1| hydrolase [Neisseria gonorrhoeae SK-93-1035]
 gi|268625893|gb|EEZ58293.1| hydrolase [Neisseria gonorrhoeae SK-93-1035]
          Length = 210

 Score =  182 bits (461), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 82/209 (39%), Positives = 128/209 (61%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L + I  VTPF+QNCT ++D+ES EAV+ D GGD+  +   + +R   +  IW+THGH+D
Sbjct: 3   LRYEIFPVTPFRQNCTLIWDDESGEAVLTDVGGDVPFLLQALANRKLTLTAIWLTHGHLD 62

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GG  ++ E   + ++GPH++D  ++  + +        ++   A  +RWL++G+TL +
Sbjct: 63  HAGGVVEMLETHKVPVLGPHREDEFLLQSLPQTTAQYGFPVSPAFAP-NRWLEEGETLTV 121

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G + F+V H PGH+PGHV++   E      GD LF  +IGRTD   G++  LIN+I NK+
Sbjct: 122 GRYAFQVLHIPGHTPGHVVFYCAEAELLIAGDVLFYETIGRTDFPRGNHADLINNIRNKL 181

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
               + +  V GHG  ++IG E+R NPF 
Sbjct: 182 FAFPETVQVVAGHGRMTSIGHEKRHNPFF 210


>gi|240116904|ref|ZP_04730966.1| putative hydrolase [Neisseria gonorrhoeae PID1]
 gi|268602580|ref|ZP_06136747.1| glyoxalase II family protein [Neisseria gonorrhoeae PID1]
 gi|268586711|gb|EEZ51387.1| glyoxalase II family protein [Neisseria gonorrhoeae PID1]
          Length = 210

 Score =  182 bits (461), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 81/209 (38%), Positives = 130/209 (62%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L + I  VTPF+QNCT ++D+ES EAV+ D GGD+  +   + +R   +  IW+THGH+D
Sbjct: 3   LRYEIFPVTPFRQNCTLIWDDESGEAVLTDVGGDVPFLLQALANRKLTLTAIWLTHGHLD 62

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GG  ++ +  ++ ++GPH++D  ++  + +        ++   A  +RWL++G+TL +
Sbjct: 63  HAGGVVEMLKTRNVPVLGPHREDEFLLQSLPQTTAQYGFPVSPAFAP-NRWLEEGETLTV 121

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G + F+V H PGH+PGH+++   E      GD LF  +IGRTD   G++  LIN+I NK+
Sbjct: 122 GRYAFQVLHIPGHTPGHIVFYCAEAELLIAGDVLFYETIGRTDFPRGNHADLINNIRNKL 181

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
             L + +  V GHG  ++IG E+R NPF 
Sbjct: 182 FALPETVQVVAGHGRMTSIGHEKRHNPFF 210


>gi|261400817|ref|ZP_05986942.1| metallo-beta-lactamase domain protein [Neisseria lactamica ATCC
           23970]
 gi|269209427|gb|EEZ75882.1| metallo-beta-lactamase domain protein [Neisseria lactamica ATCC
           23970]
          Length = 210

 Score =  182 bits (461), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 81/209 (38%), Positives = 129/209 (61%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L + I+ VTPF+QNCT ++D+ES EAV+ D GGD+  +   + +R   +  IW+THGH+D
Sbjct: 3   LRYEILPVTPFRQNCTLIWDDESGEAVLTDVGGDVPFLLQALANRKLTLTAIWLTHGHLD 62

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GG  ++ +   + ++GPH++D  ++  + +         +   A + RWL++G+TL +
Sbjct: 63  HAGGVVEMLKTHKVPVLGPHREDEFLLQSLPQTTAQYGFPASPAFAPT-RWLEEGETLTV 121

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G + F+V H PGH+PGH+++   E      GD LF  +IGRTD   G++  LIN+I NK+
Sbjct: 122 GRYAFQVLHIPGHTPGHIVFYCAEAELLIAGDVLFYETIGRTDFPRGNHADLINNIRNKL 181

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
             L + +  V GHG  ++IG E+R NPF 
Sbjct: 182 FALPETVQVVAGHGRMTSIGHEKRHNPFF 210


>gi|240013170|ref|ZP_04720083.1| putative hydrolase [Neisseria gonorrhoeae DGI18]
 gi|240120241|ref|ZP_04733203.1| putative hydrolase [Neisseria gonorrhoeae PID24-1]
          Length = 210

 Score =  182 bits (461), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 81/209 (38%), Positives = 130/209 (62%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L + I+ VTPF+QNCT ++D+ES EAV+ D GGD+  +   + +R   +  IW+THGH+D
Sbjct: 3   LRYEILPVTPFRQNCTLIWDDESGEAVLTDVGGDVPFLLQALANRKLTLTAIWLTHGHLD 62

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GG  ++ +  ++ ++GPH++D  ++  + +        ++   A  +RWL++G+TL +
Sbjct: 63  HAGGVVEMLKTRNVPVLGPHREDEFLLQSLPQTTAQYGFPVSPAFAP-NRWLEEGETLTV 121

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G + F+V H PGH+PGHV++   E      GD LF  +IGRTD   G++  LIN+I NK+
Sbjct: 122 GRYAFQVLHIPGHTPGHVVFYCAEAELLIAGDVLFYETIGRTDFPRGNHADLINNIRNKL 181

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
               + +  V GHG  ++IG E+R NPF 
Sbjct: 182 FAFPETVQVVAGHGRMTSIGHEKRHNPFF 210


>gi|121635707|ref|YP_975952.1| putative hydrolase [Neisseria meningitidis FAM18]
 gi|120867413|emb|CAM11185.1| putative hydrolase [Neisseria meningitidis FAM18]
 gi|316983936|gb|EFV62915.1| metallo-beta-lactamase superfamily protein [Neisseria meningitidis
           H44/76]
 gi|325131292|gb|EGC54003.1| metallo-beta-lactamase domain protein [Neisseria meningitidis
           M6190]
 gi|325139372|gb|EGC61912.1| metallo-beta-lactamase domain protein [Neisseria meningitidis
           CU385]
          Length = 221

 Score =  182 bits (461), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 82/209 (39%), Positives = 128/209 (61%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L + I  VTPF+QNCT ++D+ES EAV+ D GGD+  +   + +R   +  IW+THGH+D
Sbjct: 14  LRYEIFPVTPFRQNCTLIWDDESGEAVLTDVGGDVPFLLQALANRKLTLTAIWLTHGHLD 73

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GG  ++ +   + ++GPH DD  ++  + +        ++   A  +RWL++G+TL +
Sbjct: 74  HAGGVVEMLKTHKVPVLGPHPDDEFLLQSLPQTTAQYGFPVSPAFAP-NRWLEEGETLTV 132

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G + F+V H PGH+PGH+++   E      GD LF  +IGRTD   G++  LIN+I NK+
Sbjct: 133 GRYAFQVLHIPGHTPGHIVFYCAEAELLIAGDVLFYETIGRTDFPRGNHADLINNIRNKL 192

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
             L + +  V GHG  ++IG E+R NPF 
Sbjct: 193 FTLPETVQVVAGHGRMTSIGHEKRHNPFF 221


>gi|332529944|ref|ZP_08405895.1| beta-lactamase domain-containing protein [Hylemonella gracilis ATCC
           19624]
 gi|332040641|gb|EGI77016.1| beta-lactamase domain-containing protein [Hylemonella gracilis ATCC
           19624]
          Length = 212

 Score =  181 bits (460), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 97/209 (46%), Positives = 129/209 (61%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L +  V VT F+QNCT ++ +E+++A V+DPGGDL  I          +K IWITH H+D
Sbjct: 2   LQYLTVPVTAFQQNCTIVWCDETMDAAVIDPGGDLPRITAAASGAGVTLKAIWITHAHLD 61

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H G AA+L   LSL IIGPH DD   +  + EQ R   +        + RWL DGDT+ +
Sbjct: 62  HAGAAAELARALSLPIIGPHPDDQFWIDGLAEQGRRFGMPAGEPFVPT-RWLHDGDTVQI 120

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGH+PGHV++ + E + A +GD LF  SIGRTD   G++  LI SI  ++
Sbjct: 121 GHCTLNVRHCPGHTPGHVVFHSPEAHRAFVGDVLFAGSIGRTDFPRGNHGDLIRSITERL 180

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
            PLGD+  F+ GHGP ST G+ER  NPF+
Sbjct: 181 WPLGDDTVFIPGHGPESTFGQERETNPFV 209


>gi|255065460|ref|ZP_05317315.1| metallo-beta-lactamase domain protein [Neisseria sicca ATCC 29256]
 gi|255050285|gb|EET45749.1| metallo-beta-lactamase domain protein [Neisseria sicca ATCC 29256]
          Length = 248

 Score =  181 bits (460), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 84/212 (39%), Positives = 128/212 (60%), Gaps = 1/212 (0%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           +  L   I+ VTPF+QNCT L+D+E+ EAV+ D GGD+  +   + ++N  +  IW+THG
Sbjct: 38  LMALQAEIIAVTPFRQNCTLLWDDETREAVLTDVGGDVPYLLQELDAKNLTLTAIWLTHG 97

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DH GG  +L+E   + +IGPH DD  ++  + E        ++     + RWL +G+T
Sbjct: 98  HLDHAGGVVELREHRPVPVIGPHADDGFLLQALPETTAQYGFPVSPAFEPT-RWLTEGET 156

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           L +G+H F+V H PGH+PGHV++   E      GD LF  +IGRTD   G++  LI++I 
Sbjct: 157 LKVGSHAFQVLHIPGHTPGHVVFYCAEAGLLIAGDVLFYETIGRTDFPRGNHADLIHNIR 216

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
            K+  L ++   + GHG  + IG E+R NPF 
Sbjct: 217 TKLFVLPEDTRVIAGHGRMTDIGHEKRHNPFF 248


>gi|15677871|ref|NP_275039.1| glyoxalase II family protein [Neisseria meningitidis MC58]
 gi|254804141|ref|YP_003082362.1| putative Zn-dependent hydrolase [Neisseria meningitidis alpha14]
 gi|7227311|gb|AAF42369.1| glyoxalase II family protein [Neisseria meningitidis MC58]
 gi|254667683|emb|CBA03530.1| putative Zn-dependent hydrolase [Neisseria meningitidis alpha14]
 gi|261393373|emb|CAX51009.1| putative metallo-dependent hydrolase [Neisseria meningitidis 8013]
 gi|308390148|gb|ADO32468.1| glyoxalase II family protein [Neisseria meningitidis alpha710]
 gi|325127327|gb|EGC50262.1| metallo-beta-lactamase domain protein [Neisseria meningitidis
           N1568]
 gi|325137321|gb|EGC59909.1| metallo-beta-lactamase domain protein [Neisseria meningitidis
           ES14902]
 gi|325141408|gb|EGC63887.1| metallo-beta-lactamase domain protein [Neisseria meningitidis
           961-5945]
 gi|325199140|gb|ADY94596.1| metallo-beta-lactamase domain protein [Neisseria meningitidis
           G2136]
 gi|325201097|gb|ADY96552.1| metallo-beta-lactamase domain protein [Neisseria meningitidis
           H44/76]
 gi|325204998|gb|ADZ00452.1| metallo-beta-lactamase domain protein [Neisseria meningitidis
           M01-240355]
          Length = 210

 Score =  181 bits (459), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 82/209 (39%), Positives = 128/209 (61%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L + I  VTPF+QNCT ++D+ES EAV+ D GGD+  +   + +R   +  IW+THGH+D
Sbjct: 3   LRYEIFPVTPFRQNCTLIWDDESGEAVLTDVGGDVPFLLQALANRKLTLTAIWLTHGHLD 62

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GG  ++ +   + ++GPH DD  ++  + +        ++   A  +RWL++G+TL +
Sbjct: 63  HAGGVVEMLKTHKVPVLGPHPDDEFLLQSLPQTTAQYGFPVSPAFAP-NRWLEEGETLTV 121

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G + F+V H PGH+PGH+++   E      GD LF  +IGRTD   G++  LIN+I NK+
Sbjct: 122 GRYAFQVLHIPGHTPGHIVFYCAEAELLIAGDVLFYETIGRTDFPRGNHADLINNIRNKL 181

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
             L + +  V GHG  ++IG E+R NPF 
Sbjct: 182 FTLPETVQVVAGHGRMTSIGHEKRHNPFF 210


>gi|240126613|ref|ZP_04739499.1| putative hydrolase [Neisseria gonorrhoeae SK-92-679]
 gi|268685193|ref|ZP_06152055.1| hydrolase [Neisseria gonorrhoeae SK-92-679]
 gi|268625477|gb|EEZ57877.1| hydrolase [Neisseria gonorrhoeae SK-92-679]
          Length = 210

 Score =  181 bits (459), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 81/209 (38%), Positives = 129/209 (61%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L + I  VTPF+QNCT ++D+ES EAV+ D GGD+  +   + +R   +  IW+THGH+D
Sbjct: 3   LRYEIFPVTPFRQNCTLIWDDESGEAVLTDVGGDVPFLLQALANRKLTLTAIWLTHGHLD 62

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GG  ++ +  ++ ++GPH++D  ++  + +        ++   A  +RWL++G+TL +
Sbjct: 63  HAGGVVEMLKTRNVPVLGPHREDEFLLQSLPQTTAQYGFPVSPAFAP-NRWLEEGETLTV 121

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G + F+V H PGH+PGHV++   E      GD LF  +IGRTD   G++  LIN+I NK+
Sbjct: 122 GRYAFQVLHIPGHTPGHVVFYCAEAELLIAGDVLFYETIGRTDFPRGNHADLINNIRNKL 181

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
               + +  V GHG  ++IG E+R NPF 
Sbjct: 182 FAFPETVQVVAGHGRMTSIGHEKRHNPFF 210


>gi|94676554|ref|YP_588849.1| metallo-beta-lactamase superfamily protein [Baumannia
           cicadellinicola str. Hc (Homalodisca coagulata)]
 gi|94219704|gb|ABF13863.1| metallo-beta-lactamase superfamily protein [Baumannia
           cicadellinicola str. Hc (Homalodisca coagulata)]
          Length = 209

 Score =  181 bits (459), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 85/203 (41%), Positives = 127/203 (62%), Gaps = 1/203 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + +HI+ VT F QNC+ ++ +++ +A ++DPGGD   +   I   N  + QI +THGH D
Sbjct: 1   MKYHIIPVTIFNQNCSLIWCDQTKDAALIDPGGDASRLCFEIDKFNVTITQILLTHGHFD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG   +L     + IIGPH DD  ++  + EQ ++  +     +   DRWL +GD +++
Sbjct: 61  HVGAVKKLARYYDVPIIGPHSDDKILLENLSEQCKIFGVP-PVDSFLPDRWLVNGDIIIV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   + V HCPGHSPGH++  N  + F H+GD LF+ +IGRTD+  G+   L+ SIN K+
Sbjct: 120 GLEKYYVLHCPGHSPGHIVLWNKVHRFIHMGDVLFKGAIGRTDLPGGNLTLLLRSINEKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRER 206
             L D+I+F+ GHGP STIG ER
Sbjct: 180 FSLEDDITFLPGHGPMSTIGNER 202


>gi|163803970|ref|ZP_02197794.1| glyoxylase II family protein [Vibrio sp. AND4]
 gi|159172221|gb|EDP57128.1| glyoxylase II family protein [Vibrio sp. AND4]
          Length = 218

 Score =  181 bits (458), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 86/214 (40%), Positives = 129/214 (60%), Gaps = 2/214 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L + +V VT F QNC+ ++ +E+++ +VVDPGGD   +  +I+     V  + +THGH+D
Sbjct: 3   LKYQVVPVTSFSQNCSIVWCDETMKGIVVDPGGDEKQLSMLIKELGVEVVNLVLTHGHLD 62

Query: 64  HVGGAAQLKEDLSLT-IIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLL 122
           HVGG   L   L  T I+GPHK D   +  ++ Q+++    +        +WL +GDT+ 
Sbjct: 63  HVGGTEPLSALLGGTEIVGPHKADNFWLQGLEGQSQMFGFPL-TEAFEPHQWLNEGDTVT 121

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
            G  +  V H PGH+PGHV+  + +   A +GD LF  S+GRTD   GD+  LI SI  K
Sbjct: 122 FGNQVLNVIHTPGHTPGHVVLYSEDARLAFVGDVLFNGSVGRTDFPQGDFNTLICSIKEK 181

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           + PLG++++FV GHGP ST G ER+ NPF+   +
Sbjct: 182 LWPLGNDVTFVPGHGPQSTFGHERKTNPFVADEM 215


>gi|262370033|ref|ZP_06063360.1| beta-lactamase domain-containing protein [Acinetobacter johnsonii
           SH046]
 gi|262315072|gb|EEY96112.1| beta-lactamase domain-containing protein [Acinetobacter johnsonii
           SH046]
          Length = 214

 Score =  181 bits (458), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 87/209 (41%), Positives = 128/209 (61%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L   IV VT F+QNC+ ++D +S EA+++D GG+ + +K  I++    VK +W+THGH+D
Sbjct: 2   LQVKIVPVTAFQQNCSIVWDSDSKEAILIDAGGEPEKLKAEIEALGLTVKALWLTHGHLD 61

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H G    LK+   + +IGPHK+DA  +  + E ++     +  +      WL+ G+ L L
Sbjct: 62  HAGAVGALKKLWDVPVIGPHKEDAFWLDMIQEVSQRYGFPIPEK-VDVTTWLEGGEVLKL 120

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   F+V   PGH+PGHV++ N        GD LF+ SIGRTD   G++QQLI+SI  + 
Sbjct: 121 GNEAFEVRFAPGHTPGHVMFYNKNYGLLWTGDVLFKGSIGRTDFPRGNHQQLIDSIQREC 180

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
             L DE  F+ GHGP STIG E++ NPF+
Sbjct: 181 FSLPDETQFISGHGPISTIGFEKQHNPFV 209


>gi|33519877|ref|NP_878709.1| hypothetical protein Bfl423 [Candidatus Blochmannia floridanus]
 gi|33504222|emb|CAD83485.1| Zn-dependent hydrolase [Candidatus Blochmannia floridanus]
          Length = 211

 Score =  181 bits (458), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 91/210 (43%), Positives = 131/210 (62%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + +HI+ VT F QNC+ ++ E++  A+VVDPGG+ + I   I      V +I +THGH+D
Sbjct: 1   MQYHIIPVTSFNQNCSIIWCEQTKNAIVVDPGGEKEKIYKAIDLLKVVVNKIVLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIR-MNARNASSDRWLQDGDTLL 122
           HVG A ++K    + I GP++ D  ++  +  Q ++L+++ M       D WL+DGD + 
Sbjct: 61  HVGDAMEIKRYYGVPIFGPNEQDRFLLNDLYLQCQILNVKPMLHITVKPDFWLKDGDQIQ 120

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
           +G   F V HCPGHSPGHV+  N    F  +GD LF+  IGR+D+  GDY  L++SI  K
Sbjct: 121 VGYEKFNVLHCPGHSPGHVVLWNKLQKFIIMGDVLFKKHIGRSDLPGGDYTVLMHSIRTK 180

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           +L L D+I F+ GHGP STIG ER  N FL
Sbjct: 181 LLSLSDDIVFLPGHGPISTIGYERSNNVFL 210


>gi|153835592|ref|ZP_01988259.1| glyoxylase II family protein [Vibrio harveyi HY01]
 gi|156974986|ref|YP_001445893.1| hypothetical protein VIBHAR_02708 [Vibrio harveyi ATCC BAA-1116]
 gi|269961713|ref|ZP_06176074.1| glyoxylase II family protein [Vibrio harveyi 1DA3]
 gi|148867809|gb|EDL67049.1| glyoxylase II family protein [Vibrio harveyi HY01]
 gi|156526580|gb|ABU71666.1| hypothetical protein VIBHAR_02708 [Vibrio harveyi ATCC BAA-1116]
 gi|269833578|gb|EEZ87676.1| glyoxylase II family protein [Vibrio harveyi 1DA3]
          Length = 218

 Score =  180 bits (457), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 86/214 (40%), Positives = 128/214 (59%), Gaps = 2/214 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L + +V VT F QNC+ ++ +E+++ +VVDPGGD   +  +I+     V  + +THGH+D
Sbjct: 3   LKYQVVPVTSFSQNCSIVWCDETMKGIVVDPGGDEKQLAMLIKELGVEVVNLVLTHGHLD 62

Query: 64  HVGGAAQLKEDLSLT-IIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLL 122
           HVGG   L   L  T I+GPHK D   +  ++ Q+++    +        +WL +GD + 
Sbjct: 63  HVGGTEPLSALLGGTEIVGPHKADNFWLQGLEGQSQMFGFPL-TEAFEPHQWLNEGDKVT 121

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
            G     V H PGH+PGHV+  + E   A +GD LF  S+GRTD   GD+  LI+SI  K
Sbjct: 122 FGNQTLNVIHTPGHTPGHVVLYSEEARLAFVGDVLFNGSVGRTDFPQGDFNTLISSIKEK 181

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           + PLG++++FV GHGP ST G ER+ NPF+   +
Sbjct: 182 LWPLGNDVTFVPGHGPQSTFGHERKTNPFVADEM 215


>gi|148827091|ref|YP_001291844.1| hypothetical protein CGSHiGG_02040 [Haemophilus influenzae PittGG]
 gi|148718333|gb|ABQ99460.1| hypothetical protein CGSHiGG_02040 [Haemophilus influenzae PittGG]
          Length = 212

 Score =  180 bits (456), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 89/212 (41%), Positives = 133/212 (62%), Gaps = 3/212 (1%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           ++  I+ VT F+QNC+ ++D+E   A ++DPGG+ + +   I+  + ++K I ITHGH+D
Sbjct: 1   MNIEIIPVTAFQQNCSLIWDDEK-NAAIIDPGGEAERLIQRIEELDLNLKVILITHGHLD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWL-QDGDTLL 122
           HVG A QLK+   + I G ++ D  +   + EQA+   +  N      DRW  Q+G+ L 
Sbjct: 60  HVGAAMQLKQHFGVEIWGSNEKDKFLFESLPEQAQRFGLP-NIDAFLPDRWFNQEGEILK 118

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
           L    F++ H PGH+PGH+ ++  E   A  GD LF+  IGRTD   GDY+ LI+SI  K
Sbjct: 119 LDGFNFEILHLPGHTPGHIGFIEHEKKVAFTGDVLFQGGIGRTDFPRGDYETLISSIRTK 178

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           +LPL D++  + GHGP +TIGRE++ NPFL S
Sbjct: 179 LLPLNDDLIIIAGHGPYTTIGREKQTNPFLNS 210


>gi|325135280|gb|EGC57901.1| metallo-beta-lactamase domain protein [Neisseria meningitidis
           M0579]
 gi|325143606|gb|EGC65926.1| metallo-beta-lactamase domain protein [Neisseria meningitidis
           M01-240013]
 gi|325201314|gb|ADY96768.1| metallo-beta-lactamase domain protein [Neisseria meningitidis
           M01-240149]
 gi|325208900|gb|ADZ04352.1| metallo-beta-lactamase domain protein [Neisseria meningitidis
           NZ-05/33]
          Length = 210

 Score =  180 bits (456), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 82/209 (39%), Positives = 128/209 (61%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L + I+ VTPF+QNCT ++D+ES EAV+ D GGD+  +   + +R   +  IW+THGH+D
Sbjct: 3   LRYEILSVTPFRQNCTLIWDDESGEAVLTDVGGDVPFLLQALANRKLTLTAIWLTHGHLD 62

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GG  ++ +   + ++GPH DD  ++  + +        ++   A  + WL++G+TL +
Sbjct: 63  HAGGVVEMLKTHKVPVLGPHPDDEFLLQSLPQTTAQYGFPVSPAFAP-NHWLEEGETLKV 121

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G + F+V H PGH+PGHV++   E      GD LF  +IGRTD   G++  LIN+I NK+
Sbjct: 122 GRYAFQVLHIPGHTPGHVVFYCAEAELLIAGDVLFYETIGRTDFPRGNHADLINNIRNKL 181

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
             L + +  V GHG  ++IG E+R NPF 
Sbjct: 182 FALPETVQVVAGHGRMTSIGHEKRHNPFF 210


>gi|59802341|ref|YP_209053.1| putative hydrolase [Neisseria gonorrhoeae FA 1090]
 gi|59719236|gb|AAW90641.1| putative hydrolase [Neisseria gonorrhoeae FA 1090]
          Length = 210

 Score =  180 bits (456), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 81/209 (38%), Positives = 128/209 (61%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L + I+ VTPF+QNCT ++D+ES EAV+ D GGD+  +   + +R   +  IW+THGH+D
Sbjct: 3   LRYEILPVTPFRQNCTLIWDDESGEAVLTDVGGDVPFLLQALANRKLTLTAIWLTHGHLD 62

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GG  ++ E   + ++GPH++D  ++  + +        ++   A  +RWL++G+TL +
Sbjct: 63  HAGGVVEMLETHKVPVLGPHREDEFLLQSLPQTTAQYGFPVSPAFAP-NRWLEEGETLTV 121

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G + F+V H PGH+PGHV++   E      GD LF  +IGRTD   G++  LIN+I NK+
Sbjct: 122 GRYAFQVLHIPGHTPGHVVFYCAEAELLIAGDVLFYETIGRTDFPRGNHADLINNIRNKL 181

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
               + +  V GH   ++IG E+R NPF 
Sbjct: 182 FAFPETVQVVAGHERMTSIGHEKRHNPFF 210


>gi|309379267|emb|CBX22040.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 210

 Score =  180 bits (456), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 81/209 (38%), Positives = 129/209 (61%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L + I  VTPF+QNCT ++D+ES +AV+ D GGD+  +   + +R   +  IW+THGH+D
Sbjct: 3   LRYEIFPVTPFRQNCTLIWDDESGKAVLTDVGGDVPFLLQALANRKLTLTAIWLTHGHLD 62

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GG  ++ +   + I+GPH++D  ++  + +        ++    S +RWL++G+TL +
Sbjct: 63  HAGGVVEMLKTHKVPILGPHREDEFLLQSLPQTTAQYGFPVSP-AFSPNRWLEEGETLAV 121

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G + F+V H PGH+PGH+++   E      GD LF  +IGRTD   G++  LIN+I NK+
Sbjct: 122 GRYAFQVLHIPGHTPGHIVFYCAEAELLIAGDVLFYETIGRTDFPRGNHADLINNIRNKL 181

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
             L + +  V GHG  ++IG E+R NPF 
Sbjct: 182 FTLPETVQVVAGHGRMTSIGHEKRHNPFF 210


>gi|261365036|ref|ZP_05977919.1| metallo-beta-lactamase domain protein [Neisseria mucosa ATCC 25996]
 gi|288566626|gb|EFC88186.1| metallo-beta-lactamase domain protein [Neisseria mucosa ATCC 25996]
          Length = 210

 Score =  180 bits (456), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 84/209 (40%), Positives = 126/209 (60%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L   I+ VTPF+QNCT L+D+E+ EAV+ D GGD+  +   + ++N  +  IW+THGH+D
Sbjct: 3   LQAEIIAVTPFRQNCTLLWDDETREAVLTDVGGDVSFLLQELDAKNLTLTAIWLTHGHLD 62

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GG  +L+E   + +IGPH DD  ++  + E        ++     + RWL +G+TL +
Sbjct: 63  HAGGVVELREHRPVPVIGPHADDEFLLQALPETTAQYGFPVSPAFEPT-RWLTEGETLKV 121

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G H F+V H PGH+PGHV++   E      GD LF  +IGRTD   G++  LI++I  K+
Sbjct: 122 GNHAFQVLHIPGHTPGHVVFYCAEAGLLIAGDVLFYETIGRTDFPRGNHADLIHNIRTKL 181

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
             L ++   + GHG  + IG E+R NPF 
Sbjct: 182 FVLPEDTRVIAGHGRMTDIGHEKRHNPFF 210


>gi|254449198|ref|ZP_05062647.1| beta-lactamase domain protein [gamma proteobacterium HTCC5015]
 gi|198261175|gb|EDY85471.1| beta-lactamase domain protein [gamma proteobacterium HTCC5015]
          Length = 206

 Score =  180 bits (456), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 87/202 (43%), Positives = 125/202 (61%), Gaps = 1/202 (0%)

Query: 11  VTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQ 70
           +TPF+QNC+ L+ + S  A VVDPGGD+D I+  I      V++I +THGH+DHVG  A+
Sbjct: 1   MTPFQQNCSLLWCDSSQRAAVVDPGGDVDKIQAAIDETGVIVEKILLTHGHLDHVGATAE 60

Query: 71  LKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFKV 130
           +     + I GP ++DA  +  +  QA++ +           RWL+ GD + +G    +V
Sbjct: 61  MARRFDVPIEGPQREDAFWIQGLPMQAQMFNFPA-VEIFEPQRWLEQGDKVTVGEIELEV 119

Query: 131 FHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEI 190
            HCPGH+PGHV++ + ++     GD LF+ SIGRTD   GD+  LI SI+ ++  L DE 
Sbjct: 120 RHCPGHTPGHVVFYSAQDGLLWAGDVLFQGSIGRTDFPKGDHATLIESIHRELFSLPDET 179

Query: 191 SFVCGHGPNSTIGRERRLNPFL 212
            F+ GHGP STIG ERR NPF+
Sbjct: 180 RFIPGHGPMSTIGAERRSNPFV 201


>gi|315633945|ref|ZP_07889234.1| metallo-beta-lactamase [Aggregatibacter segnis ATCC 33393]
 gi|315477195|gb|EFU67938.1| metallo-beta-lactamase [Aggregatibacter segnis ATCC 33393]
          Length = 213

 Score =  179 bits (455), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 82/213 (38%), Positives = 136/213 (63%), Gaps = 2/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           ++  I+ VT F+QNC+ ++D+E  +A ++DPGG+ + +   I+    +++ I +THGH+D
Sbjct: 1   MNIEIIPVTTFQQNCSLIWDDEK-KAAIIDPGGEAEKLIKRIEELGLNLQVILLTHGHLD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWL-QDGDTLL 122
           HVG A +LK+  ++ I G +  D      + +Q+    +         DRWL Q+G+TL 
Sbjct: 60  HVGAAEKLKQHFNVQIWGSNSQDDYWFKNLPQQSEKFGMLFEVSAFEPDRWLNQEGETLN 119

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
           +G   F+V H PGH+PGH+ ++  +   A  GD LF++ IGRTD   G Y+++++SI NK
Sbjct: 120 IGDFTFEVLHLPGHTPGHIGFIEHQKRIAFTGDVLFKNGIGRTDFPGGSYEEILSSIRNK 179

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFLKSN 215
           + PLGD++  V GHGP +TIG E+R NP++K++
Sbjct: 180 LYPLGDDMIVVPGHGPYTTIGEEKRTNPYVKAS 212


>gi|304388674|ref|ZP_07370734.1| metallo-beta-lactamase domain protein [Neisseria meningitidis ATCC
           13091]
 gi|304337341|gb|EFM03515.1| metallo-beta-lactamase domain protein [Neisseria meningitidis ATCC
           13091]
          Length = 210

 Score =  179 bits (454), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 81/209 (38%), Positives = 128/209 (61%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L + I+ VTPF+QNCT ++D+ES EAV+ D GGD+  +   + +R   +  IW+THGH+D
Sbjct: 3   LRYEILSVTPFRQNCTLIWDDESGEAVLTDVGGDVPFLLQALANRKLTLTAIWLTHGHLD 62

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GG  ++ +   + ++GPH DD  ++  + +        ++   A  +RWL++G+TL +
Sbjct: 63  HAGGVVEMLKTHKVPVLGPHPDDEFLLQSLPQTTAQYGFPVSPAFAP-NRWLEEGETLTV 121

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G + F+V H PGH+PGH+++   E      GD LF  +IGRTD   G++  LIN+I NK+
Sbjct: 122 GRYAFQVLHIPGHTPGHIVFYCAEAELLIAGDVLFYETIGRTDFPRGNHADLINNIRNKL 181

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
             L + +  V GHG  ++I  E+R NPF 
Sbjct: 182 FTLPETVQVVAGHGRMTSIRHEKRHNPFF 210


>gi|304321211|ref|YP_003854854.1| glyoxalase II family protein [Parvularcula bermudensis HTCC2503]
 gi|303300113|gb|ADM09712.1| glyoxalase II family protein [Parvularcula bermudensis HTCC2503]
          Length = 232

 Score =  179 bits (454), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 88/217 (40%), Positives = 126/217 (58%), Gaps = 3/217 (1%)

Query: 2   SKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGH 61
           +     IV VTPF+QNC+ +  ++   AV+ DPGG++D +   +++    V++IW+THGH
Sbjct: 5   APFDVKIVPVTPFQQNCSLVKAKDGACAVI-DPGGEIDRLLQEVEAWGGRVEKIWLTHGH 63

Query: 62  VDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARN--ASSDRWLQDGD 119
           +DH  GA ++K      I G H ++A  + ++  QA++L             DRWL DGD
Sbjct: 64  LDHAAGAMEMKTKTGAPIEGAHPEEAFWLDQMAAQAQMLGGGGGFGTDRVVPDRWLDDGD 123

Query: 120 TLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSI 179
            + L    F V   PGH+PGHV++ +     A +GD LF  SIGRTD   GD+  LI SI
Sbjct: 124 QVTLSNLAFDVLFTPGHTPGHVVFYHSGAKLAFVGDVLFHGSIGRTDFPRGDHATLIASI 183

Query: 180 NNKILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
             K+ PLG ++ FV GHGP ST G ERR NPF+   +
Sbjct: 184 TEKLWPLGPDVRFVPGHGPMSTFGEERRSNPFVADKV 220


>gi|298369756|ref|ZP_06981073.1| metallo-beta-lactamase domain protein [Neisseria sp. oral taxon 014
           str. F0314]
 gi|298282313|gb|EFI23801.1| metallo-beta-lactamase domain protein [Neisseria sp. oral taxon 014
           str. F0314]
          Length = 210

 Score =  179 bits (454), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 85/209 (40%), Positives = 128/209 (61%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L F I+ VTPF+QNCT L+D+E+ EAV+ D GGD+  + + + +R   VK+IW+THGH+D
Sbjct: 3   LQFEILAVTPFRQNCTLLWDDETREAVLTDMGGDVLFVLNEVAARRLDVKEIWLTHGHLD 62

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GG  +      + ++GPH+DD  ++  + +        ++     + RWL++GD L +
Sbjct: 63  HAGGVVEFLSHKDVPVVGPHRDDEFLLDSLPDITAQYGFPVSPPFKPT-RWLEEGDVLNV 121

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G + F V H PGH+PG V++   +      GD LF  SIGRTD   G++  LI++I  K+
Sbjct: 122 GRYRFDVLHIPGHTPGQVVFYCAQAGLLVAGDVLFYESIGRTDFPRGNHADLIDNIRRKL 181

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           L L D+   + GHG  +TIG E+R NPFL
Sbjct: 182 LVLPDDTQVIAGHGRMTTIGHEKRHNPFL 210


>gi|225025591|ref|ZP_03714783.1| hypothetical protein EIKCOROL_02493 [Eikenella corrodens ATCC
           23834]
 gi|224941629|gb|EEG22838.1| hypothetical protein EIKCOROL_02493 [Eikenella corrodens ATCC
           23834]
          Length = 212

 Score =  179 bits (453), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 87/210 (41%), Positives = 127/210 (60%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L+  +  VTPF+QNC+ L+DEES EAV +D GGD+  + +         K IW+THGH+D
Sbjct: 3   LNLTVFAVTPFRQNCSLLWDEESKEAVWIDVGGDVPQLLEEAAKLGVQPKAIWLTHGHLD 62

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GG  ++ +   L +IGPH+DD  ++  + E        ++A   S  RWL++GD L +
Sbjct: 63  HAGGVTEMIQHTQLPVIGPHRDDQWLLDNLPEITANFGFPVSA-PVSPSRWLEEGDELSV 121

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G + F+V H PGH+PGHV++   E N    GD LF  SIGRTD     +  L+ +I  K+
Sbjct: 122 GAYRFQVLHIPGHTPGHVVFYCAEQNLLIAGDVLFYESIGRTDFERSSHADLLRNIREKL 181

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           L L ++   + GHG ++TIG E+R NPFL+
Sbjct: 182 LVLPEDTIVLPGHGRSTTIGHEKRHNPFLQ 211


>gi|161869143|ref|YP_001598309.1| hydrolase [Neisseria meningitidis 053442]
 gi|161594696|gb|ABX72356.1| hydrolase [Neisseria meningitidis 053442]
          Length = 210

 Score =  179 bits (453), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 82/209 (39%), Positives = 127/209 (60%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L + I  VTPF+QNCT ++D+ES EAV+ D GGD+  +   + +R   +  IW+THGH+D
Sbjct: 3   LRYEIFPVTPFRQNCTLIWDDESGEAVLTDVGGDVPFLLQALANRKLTLTAIWLTHGHLD 62

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GG  ++ +   + ++GPH DD  ++  + +        ++   A  + WL++G+TL +
Sbjct: 63  HAGGVVEMLKTHKVPVLGPHPDDEFLLQSLPQTTAQYGFPVSPAFAP-NHWLEEGETLKV 121

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G + F+V H PGH+PGHV++   E      GD LF  +IGRTD   G++  LIN+I NK+
Sbjct: 122 GRYAFQVLHIPGHTPGHVVFYCAEAELLIAGDVLFYETIGRTDFPRGNHADLINNIRNKL 181

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
             L + +  V GHG  ++IG E+R NPF 
Sbjct: 182 FALPETVQVVAGHGRMTSIGHEKRHNPFF 210


>gi|148825796|ref|YP_001290549.1| carboxy-terminal protease [Haemophilus influenzae PittEE]
 gi|148715956|gb|ABQ98166.1| carboxy-terminal protease [Haemophilus influenzae PittEE]
          Length = 212

 Score =  179 bits (453), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 89/210 (42%), Positives = 132/210 (62%), Gaps = 3/210 (1%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           ++  I+ VT F+QNC+ ++D+E   A ++DPGG+ + +   I+  + ++K I ITHGH+D
Sbjct: 1   MNIEIIPVTAFQQNCSLIWDDEK-NAAIIDPGGEAERLIQRIEELDLNLKVILITHGHLD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWL-QDGDTLL 122
           HVG A QLK+   + I G H++D  +   + EQA+   +  N      DRW  Q+G+ L 
Sbjct: 60  HVGAAMQLKQHFGVEIWGSHEEDKFLFESLPEQAQRFGLP-NIDAFLPDRWFNQEGEILK 118

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
           L    F++ H PGH+PGH+ ++  E   A  GD LF+  IGRTD   GDY+ LI+SI  K
Sbjct: 119 LDGFNFEILHLPGHTPGHIGFIEHEKKVAFTGDVLFQGGIGRTDFPRGDYETLISSIRTK 178

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           +LPL D+I  + GHG  +TIG+E+R NPFL
Sbjct: 179 LLPLNDDIIIIAGHGSYTTIGQEKRSNPFL 208


>gi|332187046|ref|ZP_08388787.1| metallo-beta-lactamase superfamily protein [Sphingomonas sp. S17]
 gi|332013056|gb|EGI55120.1| metallo-beta-lactamase superfamily protein [Sphingomonas sp. S17]
          Length = 247

 Score =  178 bits (452), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 87/214 (40%), Positives = 131/214 (61%), Gaps = 2/214 (0%)

Query: 3   KLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHV 62
            L   IV VTP +QNC+ ++   +++A VVDPGGDL  I+D I      V++I +THGH+
Sbjct: 32  PLRAAIVPVTPLQQNCSIVWCTATMKAAVVDPGGDLPRIQDAITKTGVTVEKILLTHGHI 91

Query: 63  DHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLL 122
           DH GGA  L + L + + GP ++D   + ++DE  +   I   A+     RWL +GD + 
Sbjct: 92  DHAGGAKALSDALRVPVEGPQEEDRFWLARLDEDGQAYGI--PAQVLEPTRWLSEGDRVT 149

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
           +G     V+  PGH+ GHVI+ +  ++FA +GD LF+ S+GR+D+  GD+  LI SI  K
Sbjct: 150 IGELTLDVYETPGHTRGHVIFHHAPSHFALVGDVLFQGSVGRSDLPGGDHDTLIRSIVEK 209

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           + PLG+E +F+ GHG  ST G ER+ N F+   +
Sbjct: 210 LWPLGNETAFIPGHGQPSTFGHERQSNAFVADRV 243


>gi|251792221|ref|YP_003006942.1| carboxy- protease [Aggregatibacter aphrophilus NJ8700]
 gi|247533609|gb|ACS96855.1| carboxy- protease [Aggregatibacter aphrophilus NJ8700]
          Length = 212

 Score =  178 bits (451), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 82/213 (38%), Positives = 131/213 (61%), Gaps = 2/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           ++  I+ VT F+QNC+ ++DE +  A ++DPGG+ D +   I+    +++ I +THGH+D
Sbjct: 1   MNIEIIPVTAFQQNCSLIWDENN-NAAIIDPGGEADKLIKRIEELGLNLQVILLTHGHLD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWL-QDGDTLL 122
           HVG A +LK+  ++ I+G +  D      + +Q+              DRWL Q+G+ L 
Sbjct: 60  HVGAAEKLKQHFNVQILGSNSKDDYWFKSLPQQSEKFGTLFEVAAFEPDRWLDQEGEVLT 119

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
           +G   F+V H PGH+PGH+ ++  +   A  GD LF+S IGRTD   G Y+++I SI  K
Sbjct: 120 IGDFTFEVLHLPGHTPGHIGFIEHQKRIAFTGDVLFKSGIGRTDFPGGSYEEIIASIREK 179

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFLKSN 215
           + PLGD++  V GHGP +TIG E++ NP++K+ 
Sbjct: 180 LYPLGDDMIIVAGHGPYTTIGTEKQTNPYVKAE 212


>gi|313667623|ref|YP_004047907.1| hydrolase [Neisseria lactamica ST-640]
 gi|313005085|emb|CBN86517.1| putative hydrolase [Neisseria lactamica 020-06]
          Length = 210

 Score =  178 bits (451), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 81/209 (38%), Positives = 128/209 (61%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L + I  VTPF+QNCT ++D+ES EAV+ D GGD+  +   + +R   +  IW+THGH+D
Sbjct: 3   LRYEIFPVTPFRQNCTLIWDDESGEAVLTDVGGDVPFLLQELANRKLTLTAIWLTHGHLD 62

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GG  ++ +   + ++GPH++D  ++  + +        ++    S +RWL++ +TL +
Sbjct: 63  HAGGVVEMLKTHKVPVLGPHREDEFLLQSLPQTTAQYGFPVSP-AFSPNRWLEEDETLAV 121

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G + F+V H PGH+PGHV++   E      GD LF  +IGRTD   G++  LIN+I NK+
Sbjct: 122 GRYAFQVLHIPGHTPGHVVFYCAEAELLIAGDVLFYETIGRTDFPRGNHADLINNIRNKL 181

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
             L + +  V GHG  ++IG E+R NPF 
Sbjct: 182 FALPETVQVVAGHGRMTSIGHEKRHNPFF 210


>gi|254671207|emb|CBA08383.1| glyoxalase II family protein [Neisseria meningitidis alpha153]
          Length = 210

 Score =  178 bits (451), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 81/209 (38%), Positives = 128/209 (61%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L + I  VTPF+QNCT ++D+ES EAV+ D GGD+  +   + +R   +  IW+THGH+D
Sbjct: 3   LRYEIFPVTPFRQNCTLIWDDESGEAVLTDVGGDVPFLLQALANRKLTLTAIWLTHGHLD 62

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GG  ++ +   + ++G H++D  ++  + +        ++   A  +RWL++G+TL +
Sbjct: 63  HAGGVVEMLKTHKVPVLGSHREDEFLLQSLPQTTAQYGFPVSPAFAP-NRWLEEGETLKV 121

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G + F+V H PGH+PGHV++   E      GD LF  +IGRTD   G++  LIN+I NK+
Sbjct: 122 GRYAFQVLHIPGHTPGHVVFYCAEAELLIAGDVLFYETIGRTDFPRGNHADLINNIRNKL 181

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
             L + +  V GHG  ++IG E+R NPF 
Sbjct: 182 FALPETVQVVAGHGRMTSIGHEKRHNPFF 210


>gi|262375096|ref|ZP_06068330.1| metallo-beta-lactamase superfamily protein [Acinetobacter lwoffii
           SH145]
 gi|262310109|gb|EEY91238.1| metallo-beta-lactamase superfamily protein [Acinetobacter lwoffii
           SH145]
          Length = 214

 Score =  177 bits (450), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 84/209 (40%), Positives = 128/209 (61%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L   IV VT F+QNC+ ++D E+ EA+++D GG+ + +K  +++    VK +W+THGH+D
Sbjct: 2   LQVKIVPVTAFQQNCSIVWDTETKEAILIDAGGEPEKLKTEVEALGLTVKALWLTHGHLD 61

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H G    LK+   + +IGPHK+DA  +  + E +      +  +     +WL+ G+ L L
Sbjct: 62  HAGAVGALKKAWDVPVIGPHKEDAFWLDMIQEVSARYGFPIPEK-VEVTQWLEGGEVLKL 120

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   F+V   PGH+PGHV++ N   +    GD LF+ SIGRTD   G++QQL++SI  + 
Sbjct: 121 GNEEFEVRFAPGHTPGHVMFYNKNYDLLWTGDVLFKGSIGRTDFPRGNHQQLLDSIQREC 180

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
             L DE  F+ GHG  STIG E++ NPF+
Sbjct: 181 FSLPDETQFISGHGSISTIGFEKQHNPFV 209


>gi|239994602|ref|ZP_04715126.1| probable metallo-beta-lactamase [Alteromonas macleodii ATCC 27126]
          Length = 213

 Score =  177 bits (449), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 78/210 (37%), Positives = 128/210 (60%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +   ++ VTPF QNC+ ++D  + +   VDPGGD++ + +   ++   +++I +THGH+D
Sbjct: 1   MEIQVIPVTPFAQNCSLIWDSSTNKGAFVDPGGDVETLIEAATNKGVSIEKIILTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVGG   + E   + I+GPH  D   +  + +Q+++      A+  + + WL D DT+ +
Sbjct: 61  HVGGTVAIAEHYGVPIVGPHIGDKFWLDALMQQSQMFGFP-PAQPFAPNEWLNDNDTISV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGHV+ V   +N   +GD +F  SIGRTD   G++QQLI+SI  KI
Sbjct: 120 GNLTLEVLHCPGHTPGHVVLVERSSNRVIVGDVIFAGSIGRTDFPQGNHQQLIDSIKQKI 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           + L D ++   GHGP +T+  E+  NP++ 
Sbjct: 180 MVLPDNMTIYPGHGPTTTVATEKATNPYVS 209


>gi|119472424|ref|ZP_01614542.1| putative enzyme with metallo-hydrolase/oxidoreductase domain
           [Alteromonadales bacterium TW-7]
 gi|119444946|gb|EAW26244.1| putative enzyme with metallo-hydrolase/oxidoreductase domain
           [Alteromonadales bacterium TW-7]
          Length = 213

 Score =  177 bits (449), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 87/204 (42%), Positives = 120/204 (58%), Gaps = 1/204 (0%)

Query: 9   VQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGA 68
           + VTPF QNC  +  E + EA+VVDPGGD D I   + S +  +K +W+THGH+DHVG A
Sbjct: 6   IPVTPFAQNCRIIACESTQEAIVVDPGGDSDKIIATLTSNSLTLKAVWLTHGHLDHVGAA 65

Query: 69  AQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIF 128
             L+    + IIGPHKD+      +  QA++            D WL  GDTL LG   F
Sbjct: 66  DVLRRQFDIKIIGPHKDERFWFDNLPMQAQMFGFP-PIDPFYPDEWLSHGDTLSLGKLKF 124

Query: 129 KVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGD 188
            V HCPGH+PGH+++   +N    +GD +F+ S+GRTD   G+ QQLI SI   IL L  
Sbjct: 125 DVMHCPGHTPGHIVFYEQDNKCVIVGDVIFKGSVGRTDFPQGNSQQLIESIKANILTLPV 184

Query: 189 EISFVCGHGPNSTIGRERRLNPFL 212
           + + + GHG  +T+  E + NPF+
Sbjct: 185 KTAILSGHGSETTVEHEIKTNPFV 208


>gi|291616922|ref|YP_003519664.1| YcbL [Pantoea ananatis LMG 20103]
 gi|291151952|gb|ADD76536.1| YcbL [Pantoea ananatis LMG 20103]
          Length = 181

 Score =  177 bits (449), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 79/182 (43%), Positives = 119/182 (65%), Gaps = 1/182 (0%)

Query: 32  VDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLKEDLSLTIIGPHKDDAAMMG 91
           +DPGGD D I+  +   +    QI +THGH+DHVG AA+L     + ++GP K DA  + 
Sbjct: 1   MDPGGDADTIRQTLAQLDLKPAQILLTHGHLDHVGAAAELAAFWQVPLVGPQKQDAFWLE 60

Query: 92  KVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFKVFHCPGHSPGHVIYVNFENNFA 151
            +  Q+++  +   A   + DRWL++GDT+ +G     V HCPGH+PGH+++ + +    
Sbjct: 61  SLPTQSQMFGLEYCA-PLTPDRWLEEGDTVQVGQVTLDVLHCPGHTPGHIVFFDAKGRLL 119

Query: 152 HLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEISFVCGHGPNSTIGRERRLNPF 211
             GD +F   +GRTD   G++Q LI++INNK+LPLGD+++F+ GHGP ST+GRER  NPF
Sbjct: 120 VSGDVIFSGGVGRTDFPQGNHQHLIDAINNKLLPLGDDVTFLPGHGPVSTLGRERLTNPF 179

Query: 212 LK 213
           L+
Sbjct: 180 LQ 181


>gi|299533718|ref|ZP_07047090.1| beta-lactamase-like protein [Comamonas testosteroni S44]
 gi|298718267|gb|EFI59252.1| beta-lactamase-like protein [Comamonas testosteroni S44]
          Length = 188

 Score =  177 bits (448), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 81/189 (42%), Positives = 121/189 (64%), Gaps = 1/189 (0%)

Query: 27  LEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLKEDLSLTIIGPHKDD 86
           ++A V+DPGGDL+ I+  ++    ++K IWITH H+DH GG ++L     L IIGPH+ D
Sbjct: 1   MDAAVIDPGGDLEQIEWEVERLGLNLKAIWITHAHIDHAGGTSELAAKYELPIIGPHEGD 60

Query: 87  AAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFKVFHCPGHSPGHVIYVNF 146
              +  + +Q  +     +     + RWL DGDT+ +G     V HCPGH+PGHV++ + 
Sbjct: 61  QFWIDGLPQQGAMFGFPHSDPFVPT-RWLHDGDTVSIGQETLNVRHCPGHTPGHVVFHSP 119

Query: 147 ENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEISFVCGHGPNSTIGRER 206
           + + A +GD LF  SIGRTD   G++QQLI+SI  ++ P+GD+  F+ GHGP S+ GRER
Sbjct: 120 QIDRAFVGDVLFAGSIGRTDFPQGNHQQLIDSIVQRLWPMGDQTIFIPGHGPESSFGRER 179

Query: 207 RLNPFLKSN 215
           +LNP++   
Sbjct: 180 KLNPYVSGT 188


>gi|289812172|ref|ZP_06542801.1| hypothetical protein Salmonellaentericaenterica_50992 [Salmonella
           enterica subsp. enterica serovar Typhi str. AG3]
          Length = 202

 Score =  176 bits (446), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 78/200 (39%), Positives = 129/200 (64%), Gaps = 1/200 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++ I+ VT   QNC+ ++ E++  A +VDP GD + IK  + +    + QI +THGH+D
Sbjct: 1   MNYRIIPVTASSQNCSLIWCEQTRLAALVDPDGDAEKIKQEVDASGVTLMQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG A++L +   + +IGP K+D   +  +  Q+R+  +    +  + DRWL DGD + +
Sbjct: 61  HVGAASELAQHYGVPVIGPEKEDEFWLQGLPAQSRMFGLD-ECQPLTPDRWLNDGDRVSV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGHV++ + ++     GD +F+  +GR+D   GD+ QLI++I  K+
Sbjct: 120 GNVTLQVLHCPGHTPGHVVFFDEQSQLLISGDVIFKGGVGRSDFPRGDHTQLIDAIKRKL 179

Query: 184 LPLGDEISFVCGHGPNSTIG 203
           LPLGD+++F+ GHGP ST+G
Sbjct: 180 LPLGDDVTFIPGHGPLSTLG 199


>gi|264676392|ref|YP_003276298.1| beta-lactamase [Comamonas testosteroni CNB-2]
 gi|262206904|gb|ACY31002.1| beta-lactamase-like protein [Comamonas testosteroni CNB-2]
          Length = 188

 Score =  176 bits (445), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 80/189 (42%), Positives = 121/189 (64%), Gaps = 1/189 (0%)

Query: 27  LEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLKEDLSLTIIGPHKDD 86
           ++A V+DPGGD++ I+  ++    ++K IWITH H+DH GG ++L     L IIGPH+ D
Sbjct: 1   MDAAVIDPGGDIEQIEWEVERLGLNLKAIWITHAHIDHAGGTSELAAKYELPIIGPHEGD 60

Query: 87  AAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFKVFHCPGHSPGHVIYVNF 146
              +  + +Q  +     +     + RWL DGDT+ +G     V HCPGH+PGHV++ + 
Sbjct: 61  QFWIDGLPQQGAMFGFPHSDPFVPT-RWLHDGDTVSIGQETLNVRHCPGHTPGHVVFHSP 119

Query: 147 ENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEISFVCGHGPNSTIGRER 206
           + + A +GD LF  SIGRTD   G++QQLI+SI  ++ P+GD+  F+ GHGP S+ GRER
Sbjct: 120 QIDRAFVGDVLFAGSIGRTDFPQGNHQQLIDSIVQRLWPMGDQTIFIPGHGPESSFGRER 179

Query: 207 RLNPFLKSN 215
           +LNP++   
Sbjct: 180 KLNPYVSGT 188


>gi|260582631|ref|ZP_05850420.1| carboxy-terminal protease [Haemophilus influenzae NT127]
 gi|260094303|gb|EEW78202.1| carboxy-terminal protease [Haemophilus influenzae NT127]
          Length = 212

 Score =  176 bits (445), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 87/210 (41%), Positives = 131/210 (62%), Gaps = 3/210 (1%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           ++  I+ VT F+QNC+ ++D+E   A ++DPGG+ + +   I+  + ++K I ITHGH+D
Sbjct: 1   MNIEIIPVTAFQQNCSLIWDDEK-NAAIIDPGGEAERLIQRIEELDLNLKVILITHGHLD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWL-QDGDTLL 122
           HVG A QLK+   + I G  ++D  +   + EQA+   +  N      DRW  Q+G+ L 
Sbjct: 60  HVGAAMQLKQHFGVEIWGSQEEDKFLFESLPEQAQRFGLP-NIDAFLPDRWFNQEGEILK 118

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
           L    F++ H PGH+PGH+ ++  E   A  GD LF+  IGRTD   GDY+ LI+SI  K
Sbjct: 119 LDGFNFEILHLPGHTPGHIGFIEHEKKVAFTGDVLFQGGIGRTDFPRGDYETLISSIRTK 178

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           +LPL D++  + GHG  +TIG+E+R NPFL
Sbjct: 179 LLPLNDDLIIIAGHGSYTTIGQEKRSNPFL 208


>gi|309972942|gb|ADO96143.1| Conserved hypothetical protein [Haemophilus influenzae R2846]
          Length = 212

 Score =  175 bits (444), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 88/210 (41%), Positives = 131/210 (62%), Gaps = 3/210 (1%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           ++  I+ VT F+QNC+ ++D+E   A ++DPGG+ + +   I+  + ++K I ITHGH+D
Sbjct: 1   MNIEIIPVTAFQQNCSLIWDDEK-NAAIIDPGGEAERLIQRIEELDLNLKVILITHGHLD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWL-QDGDTLL 122
           HVG A QLK+   + I G ++ D  +   + EQA+   +  N      DRW  Q+G+ L 
Sbjct: 60  HVGAAMQLKQHFGVEIWGSNEKDKFLFESLPEQAQRFGLP-NIDAFLPDRWFNQEGEILK 118

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
           L    F++ H PGH+PGH+ ++  E   A  GD LF+  IGRTD   GDY+ LI+SI  K
Sbjct: 119 LDGFNFEILHLPGHTPGHIGFIEHEKKVAFTGDVLFQGGIGRTDFPRGDYETLISSIRTK 178

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           +LPL D+I  + GHG  +TIG+E+R NPFL
Sbjct: 179 LLPLNDDIIIIAGHGSYTTIGQEKRSNPFL 208


>gi|319896898|ref|YP_004135093.1| zn-dependent hydrolase-like protein, including glyoxylases
           [Haemophilus influenzae F3031]
 gi|317432402|emb|CBY80757.1| predicted Zn-dependent hydrolase-like protein,including glyoxylases
           [Haemophilus influenzae F3031]
          Length = 212

 Score =  175 bits (444), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 88/210 (41%), Positives = 131/210 (62%), Gaps = 3/210 (1%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           ++  I+ VT F+QNC+ ++D+E   A ++DPGG+ + +   I+  + ++K I ITHGH+D
Sbjct: 1   MNIEIIPVTAFQQNCSLIWDDEK-NATIIDPGGEAERLIQRIEELDLNLKVILITHGHLD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWL-QDGDTLL 122
           HVG A QLK+   + I G ++ D  +   + EQA+   +  N      DRW  Q+G+ L 
Sbjct: 60  HVGAAMQLKQHFGVEIWGSNEKDKFLFESLPEQAQRFGLP-NIDAFLPDRWFNQEGEILK 118

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
           L    F++ H PGH+PGH+ ++  E   A  GD LF+  IGRTD   GDY+ LI+SI  K
Sbjct: 119 LDGFNFEILHLPGHTPGHIGFIEHEKKVAFTGDVLFQGGIGRTDFPRGDYETLISSIRTK 178

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           +LPL D+I  + GHG  +TIG+E+R NPFL
Sbjct: 179 LLPLNDDIIIIAGHGSYTTIGQEKRSNPFL 208


>gi|68250265|ref|YP_249377.1| Zn-dependent hydrolase [Haemophilus influenzae 86-028NP]
 gi|68058464|gb|AAX88717.1| predicted Zn-dependent hydrolase-like protein, including
           glyoxylases [Haemophilus influenzae 86-028NP]
          Length = 212

 Score =  175 bits (444), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 87/212 (41%), Positives = 132/212 (62%), Gaps = 3/212 (1%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           ++  I+ VT F+QNC+ ++D++   A ++DPGG+ + +   I+  + ++K I ITHGH+D
Sbjct: 1   MNIEIIPVTAFQQNCSLIWDDDK-NAAIIDPGGEAERLIQRIEELDLNLKVILITHGHLD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWL-QDGDTLL 122
           HVG A QLK+   + I G ++ D  +   + EQA+   +  N      DRW  Q+G+ L 
Sbjct: 60  HVGAAMQLKQHFGVEIWGSNEKDKFLFESLPEQAQRFGLP-NIEAFLPDRWFNQEGEILK 118

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
           L    F++ H PGH+PGH+ ++  E   A  GD LF+  IGRTD   GDY+ LI+SI  K
Sbjct: 119 LDGFNFEILHLPGHTPGHIGFIEHEKKVAFTGDVLFQGGIGRTDFPRGDYETLISSIRTK 178

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           +LPL D++  + GHG  +TIG+E+R NPFL S
Sbjct: 179 LLPLNDDLIIIAGHGSYTTIGQEKRSNPFLNS 210


>gi|145639179|ref|ZP_01794786.1| predicted Zn-dependent hydrolase-like protein, including glyoxylase
           [Haemophilus influenzae PittII]
 gi|145271741|gb|EDK11651.1| predicted Zn-dependent hydrolase-like protein, including glyoxylase
           [Haemophilus influenzae PittII]
          Length = 212

 Score =  175 bits (444), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 86/210 (40%), Positives = 131/210 (62%), Gaps = 3/210 (1%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           ++  I+ VT F+QNC+ ++D++   A ++DPGG+ + +   I+  N ++K I ITHGH+D
Sbjct: 1   MNIEIIPVTAFQQNCSLIWDDDK-NAAIIDPGGEAERLIQRIEELNLNLKVILITHGHLD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWL-QDGDTLL 122
           HVG A QLK+   + I G  ++D  +   + EQA+   +  N      DRW  Q+G+ L 
Sbjct: 60  HVGAAMQLKQHFGVEIWGSQEEDKFLFESLPEQAQRFGLP-NIEAFLPDRWFNQEGEILK 118

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
           L    F++ H PGH+PGH+ ++  E   A  GD LF+  IGRTD   GDY+ LI+SI  K
Sbjct: 119 LDGFNFEILHLPGHTPGHIGFIEHEKKVAFTGDVLFQGGIGRTDFPRGDYETLISSIRTK 178

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           +LPL D++  + GHG  +TIG+E++ NPFL
Sbjct: 179 LLPLNDDLIIIAGHGSYTTIGQEKQTNPFL 208


>gi|145633340|ref|ZP_01789071.1| hypothetical protein CGSHi3655_03886 [Haemophilus influenzae 3655]
 gi|145634468|ref|ZP_01790178.1| hypothetical protein CGSHiAA_06744 [Haemophilus influenzae PittAA]
 gi|229846895|ref|ZP_04467002.1| carboxy-terminal protease [Haemophilus influenzae 7P49H1]
 gi|144986186|gb|EDJ92776.1| hypothetical protein CGSHi3655_03886 [Haemophilus influenzae 3655]
 gi|145268448|gb|EDK08442.1| hypothetical protein CGSHiAA_06744 [Haemophilus influenzae PittAA]
 gi|229810384|gb|EEP46103.1| carboxy-terminal protease [Haemophilus influenzae 7P49H1]
          Length = 212

 Score =  175 bits (443), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 87/210 (41%), Positives = 131/210 (62%), Gaps = 3/210 (1%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           ++  I+ VT F+QNC+ ++D+E   A ++DPGG+ + +   I+  + ++K I ITHGH+D
Sbjct: 1   MNIEIIPVTAFQQNCSLIWDDEK-NAAIIDPGGEAERLIQRIEELDLNLKVILITHGHLD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWL-QDGDTLL 122
           HVG A QLK+   + I G H++D  +   +  QA+   +  N      DRW  Q+G+ L 
Sbjct: 60  HVGAAMQLKQHFGVEIWGSHEEDKFLFESLPVQAQRFGLP-NIDAFLPDRWFNQEGEILK 118

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
           L    F++ H PGH+PGH+ ++  E   A  GD LF+  IGRTD   GDY+ LI+SI  K
Sbjct: 119 LDGFNFEILHLPGHTPGHIGFIEHEKKVAFTGDVLFQGGIGRTDFPRGDYETLISSIRTK 178

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           +LPL D++  + GHG  +TIG+E+R NPFL
Sbjct: 179 LLPLNDDLIIIAGHGSYTTIGQEKRSNPFL 208


>gi|218680002|ref|ZP_03527899.1| beta-lactamase domain protein [Rhizobium etli CIAT 894]
          Length = 146

 Score =  175 bits (443), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 79/143 (55%), Positives = 104/143 (72%), Gaps = 1/143 (0%)

Query: 72  KEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFKVF 131
           KE LS+ ++GPH+DD  ++ +++ QA    I    RN   DRWL+DGD +  G H F+V+
Sbjct: 1   KEALSIDVVGPHQDDLPLLQRIETQAEKYGI-SGLRNVLPDRWLKDGDKVSFGAHEFEVY 59

Query: 132 HCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEIS 191
           H PGH+PGHVIY N   NFAHLGD LF  SIGRTD+  G++QQL++SI +K+LPLGD++ 
Sbjct: 60  HAPGHAPGHVIYFNRAQNFAHLGDVLFNGSIGRTDLPGGNHQQLLDSIRDKVLPLGDDVG 119

Query: 192 FVCGHGPNSTIGRERRLNPFLKS 214
           F+CGHGP S IG ERR NPFL+ 
Sbjct: 120 FICGHGPGSRIGDERRSNPFLQE 142


>gi|145629247|ref|ZP_01785046.1| hypothetical protein CGSHi22121_10605 [Haemophilus influenzae
           22.1-21]
 gi|319776089|ref|YP_004138577.1| Zn-dependent hydrolase-like protein, including glyoxylases
           [Haemophilus influenzae F3047]
 gi|329123253|ref|ZP_08251821.1| metallo-beta-lactamase [Haemophilus aegyptius ATCC 11116]
 gi|144978750|gb|EDJ88473.1| hypothetical protein CGSHi22121_10605 [Haemophilus influenzae
           22.1-21]
 gi|309750759|gb|ADO80743.1| Conserved hypothetical protein [Haemophilus influenzae R2866]
 gi|317450680|emb|CBY86900.1| predicted Zn-dependent hydrolase-like protein, including
           glyoxylases [Haemophilus influenzae F3047]
 gi|327471462|gb|EGF16910.1| metallo-beta-lactamase [Haemophilus aegyptius ATCC 11116]
          Length = 212

 Score =  174 bits (442), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 87/210 (41%), Positives = 131/210 (62%), Gaps = 3/210 (1%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           ++  I+ VT F+QNC+ ++D+E   A ++DPGG+ + +   I+  + ++K I ITHGH+D
Sbjct: 1   MNIEIIPVTAFQQNCSLIWDDEK-NAAIIDPGGEAERLIQRIEELDLNLKVILITHGHLD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWL-QDGDTLL 122
           HVG A QLK+   + I G ++ D  +   + EQA+   +  N      DRW  Q+G+ L 
Sbjct: 60  HVGAAMQLKQHFGVEIWGSNEKDKFLFESLPEQAQRFGLP-NIDAFLPDRWFNQEGEILK 118

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
           L    F++ H PGH+PGH+ ++  E   A  GD LF+  IGRTD   GDY+ LI+SI  K
Sbjct: 119 LDGFNFEILHLPGHTPGHIGFIEHEKKVAFTGDVLFQGGIGRTDFPRGDYETLISSIRTK 178

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           +LPL D++  + GHG  +TIG+E+R NPFL
Sbjct: 179 LLPLNDDLIIIAGHGSYTTIGQEKRSNPFL 208


>gi|145631486|ref|ZP_01787255.1| predicted Zn-dependent hydrolase-like protein, including glyoxylase
           [Haemophilus influenzae R3021]
 gi|144982916|gb|EDJ90429.1| predicted Zn-dependent hydrolase-like protein, including glyoxylase
           [Haemophilus influenzae R3021]
          Length = 212

 Score =  174 bits (442), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 86/210 (40%), Positives = 131/210 (62%), Gaps = 3/210 (1%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           ++  I+ VT F+QNC+ ++D+E   A ++DPGG+ + +   I+  + ++K I ITHGH+D
Sbjct: 1   MNIEIIPVTAFQQNCSLIWDDEK-NATIIDPGGEAERLIQRIEELDLNLKVILITHGHLD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWL-QDGDTLL 122
           HVG A QLK+   + I G H++D  +   +  QA+   +  N      DRW  Q+G+ L 
Sbjct: 60  HVGAAMQLKQHFGVEIWGSHEEDKFLFESLPVQAQRFGLP-NIEAFLPDRWFNQEGEILK 118

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
           L    F++ H PGH+PGH+ ++  E   A  GD LF+  IGRTD   GDY+ LI+SI  K
Sbjct: 119 LDGFNFEILHLPGHTPGHIGFIEHEKKVAFTGDVLFQGGIGRTDFPRGDYETLISSIRTK 178

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           +LPL D++  + GHG  +TIG+E++ NPFL
Sbjct: 179 LLPLNDDLIIIAGHGSYTTIGQEKQTNPFL 208


>gi|289207721|ref|YP_003459787.1| beta-lactamase [Thioalkalivibrio sp. K90mix]
 gi|288943352|gb|ADC71051.1| beta-lactamase domain protein [Thioalkalivibrio sp. K90mix]
          Length = 226

 Score =  174 bits (441), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 83/202 (41%), Positives = 122/202 (60%), Gaps = 1/202 (0%)

Query: 11  VTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQ 70
           VT   QN T ++ +++  A  VDPG + D +  + + ++  +  I +THGH+DHVG AA+
Sbjct: 9   VTALAQNATLIWCDQTRVAAWVDPGAEPDTLIAIARQQDVRLDCILLTHGHLDHVGAAAE 68

Query: 71  LKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFKV 130
           +     + I+GP  +DA  + ++  Q ++            DRWLQDG+ L LG    +V
Sbjct: 69  MARRCDIPILGPQVEDAFWLDQLPMQCQMFGFP-ELPALVPDRWLQDGEQLPLGKVTLEV 127

Query: 131 FHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEI 190
            HCPGH+PGHV + + E+  A +GD LF  +IGR+D   G+  QLI SI  ++ PLGD++
Sbjct: 128 LHCPGHTPGHVAFFDRESRLALVGDVLFHGAIGRSDFPRGNGPQLIESITRRLWPLGDDV 187

Query: 191 SFVCGHGPNSTIGRERRLNPFL 212
            FV GHGP ST G ERR NPF+
Sbjct: 188 RFVPGHGPESTFGEERRSNPFV 209


>gi|301156056|emb|CBW15527.1| predicted metal-binding enzyme [Haemophilus parainfluenzae T3T1]
          Length = 209

 Score =  174 bits (441), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 80/211 (37%), Positives = 135/211 (63%), Gaps = 3/211 (1%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           ++  I+ VT F+QNC+ ++D+E   A ++DPGG+ + +   I+    ++K + +THGH+D
Sbjct: 1   MNIEIIPVTAFQQNCSLIWDDEK-NAAIIDPGGNAENLIQRIEELELNLKAVLLTHGHLD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWL-QDGDTLL 122
           HVG A  +++  ++ I G  ++D  +   + +Q++   +   +   + DRW  Q+G+ + 
Sbjct: 60  HVGAAEAIRDHFNIEIWGSQEEDRFLFESLPQQSQQFGLPYISA-FTPDRWFNQEGEKIQ 118

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
           +G   F++ H PGH+PGH+ ++  E N A  GD LF++SIGRTD   GD+  LI+SI NK
Sbjct: 119 IGAFTFEILHLPGHTPGHIGFIEHEKNIAFTGDVLFQNSIGRTDFPRGDFDTLISSIKNK 178

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           +  L D++  + GHGP +TIG+E+R NPFLK
Sbjct: 179 LFTLNDDMVVIAGHGPYTTIGQEKRSNPFLK 209


>gi|325578154|ref|ZP_08148289.1| metallo-beta-lactamase [Haemophilus parainfluenzae ATCC 33392]
 gi|325159890|gb|EGC72019.1| metallo-beta-lactamase [Haemophilus parainfluenzae ATCC 33392]
          Length = 209

 Score =  174 bits (440), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 81/211 (38%), Positives = 136/211 (64%), Gaps = 3/211 (1%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           ++  I+ VT F+QNC+ ++D+E   A ++DPGG+ + +   I+    ++K + +THGH+D
Sbjct: 1   MNIEIIPVTAFQQNCSLIWDDEK-NAAIIDPGGNAEKLIQRIEELELNLKAVLLTHGHLD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWL-QDGDTLL 122
           HVG A  +++  ++ I G  ++D  +   + +Q++   +   +   + DRW  Q+G+ + 
Sbjct: 60  HVGAAEVIRDHFNIEIWGSQEEDRFLFESLPQQSQQFGLPYISA-FTPDRWFNQEGEKIQ 118

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
           +GT  F++ H PGH+PGHV ++  E N A  GD LF++SIGRTD   G++  LI+SI NK
Sbjct: 119 IGTFTFEILHLPGHTPGHVGFIEHEKNIAFTGDVLFQNSIGRTDFPRGNFDTLISSIKNK 178

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           +  L D++  + GHGP +TIG+E+R NPFLK
Sbjct: 179 LFILNDDMVVIAGHGPYTTIGQEKRSNPFLK 209


>gi|332991609|gb|AEF01664.1| putative metallo-beta-lactamase [Alteromonas sp. SN2]
          Length = 213

 Score =  173 bits (439), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 82/205 (40%), Positives = 124/205 (60%), Gaps = 1/205 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           I+ VTPF QNC+ ++D  S +   VDPGGD+  +          +++I +THGH+DHVGG
Sbjct: 5   IIPVTPFAQNCSLIWDAGSKQGAFVDPGGDIQKLIGAASDNQVTIEKIILTHGHLDHVGG 64

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
             +L +   + IIGPH  D   +  + +Q+++      A     ++WL D DT+ +G   
Sbjct: 65  TVELAKHYDVPIIGPHLGDKFWLDALMQQSQMFGFP-PATPFVPNQWLNDKDTISVGELT 123

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
            +V HCPGH+PGHV+ V   +N   +GD +F  SIGRTD   G++QQLI+SIN  IL L 
Sbjct: 124 LEVLHCPGHTPGHVVLVERTSNKVIVGDVIFAGSIGRTDFPQGNHQQLIDSINANILTLP 183

Query: 188 DEISFVCGHGPNSTIGRERRLNPFL 212
           D++    GHGP +T+ +E+  NP++
Sbjct: 184 DDMEIYPGHGPTTTVAKEKASNPYV 208


>gi|145641088|ref|ZP_01796669.1| hypothetical protein CGSHiR3021_08461 [Haemophilus influenzae
           R3021]
 gi|145274249|gb|EDK14114.1| hypothetical protein CGSHiR3021_08461 [Haemophilus influenzae
           22.4-21]
          Length = 213

 Score =  173 bits (439), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 89/214 (41%), Positives = 132/214 (61%), Gaps = 4/214 (1%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           ++  I+ VT F+QNC+ ++D+E   A ++DPGG+ + +   I+  + ++K I ITHGH+D
Sbjct: 1   MNIEIIPVTAFQQNCSLIWDDEK-NAAIIDPGGEAERLIQRIEELDLNLKVILITHGHLD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWL-QDGDTLL 122
           HVG A QLK+   + I G  ++D  +   + EQA+   +  N      DRW  Q+G+ L 
Sbjct: 60  HVGAAMQLKQHFGVEIWGSQEEDKFLFESLPEQAQRFGLP-NIDAFLPDRWFNQEGEILK 118

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
           L    F++ H PGH+PGH+ ++  E   A  GD LF+  IGRTD   GDY+ LI+SI  K
Sbjct: 119 LDGFNFEILHLPGHTPGHIGFIEHEKKVAFTGDVLFQGGIGRTDFPRGDYETLISSIRTK 178

Query: 183 ILPLGDE-ISFVCGHGPNSTIGRERRLNPFLKSN 215
           +LPL D+ I  + GHG  +TIG+E+R NPFL S 
Sbjct: 179 LLPLNDDIIIIIAGHGSYTTIGQEKRSNPFLNSK 212


>gi|301170421|emb|CBW30027.1| predicted metal-binding enzyme [Haemophilus influenzae 10810]
          Length = 212

 Score =  172 bits (436), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 86/210 (40%), Positives = 130/210 (61%), Gaps = 3/210 (1%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           ++  I+ VT F+QNC+ ++D++   A ++DPGG+ + +   I+  + ++K I ITHGH+D
Sbjct: 1   MNIEIIPVTAFQQNCSLIWDDDK-NAAIIDPGGEAERLIQRIEELDLNLKVILITHGHLD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWL-QDGDTLL 122
           HVG A QLK+   + I G ++ D  +   + EQ +   +  N      DRW  Q+G+ L 
Sbjct: 60  HVGAAMQLKQHFGVEIWGSNEKDKFLFESLPEQTQRFGLP-NIDAFLPDRWFNQEGEILK 118

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
           L    F++ H PGH+PGH+ ++  E   A  GD LF+  IGRTD   GDY+ LI+SI  K
Sbjct: 119 LDGFNFEILHLPGHTPGHIGFIEHEKKVAFTGDVLFQGGIGRTDFPRGDYETLISSIRTK 178

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           +LPL D+I  + GHG  +TIG+E+R NPFL
Sbjct: 179 LLPLNDDIIIIAGHGSYTTIGQEKRSNPFL 208


>gi|315126518|ref|YP_004068521.1| enzyme with metallo-hydrolase/oxidoreductase domain
           [Pseudoalteromonas sp. SM9913]
 gi|315015032|gb|ADT68370.1| putative enzyme with metallo-hydrolase/oxidoreductase domain
           [Pseudoalteromonas sp. SM9913]
          Length = 213

 Score =  172 bits (435), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 82/204 (40%), Positives = 121/204 (59%), Gaps = 1/204 (0%)

Query: 9   VQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGA 68
           + VTPF QNC  +  E++ +AV VDPGGD + I   ++  N  +  IW+THGH+DHVG A
Sbjct: 6   IPVTPFMQNCRIIVCEQTQQAVAVDPGGDAEKINASLKQHNLSLAAIWLTHGHLDHVGAA 65

Query: 69  AQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIF 128
             L+E   + +IGPH+++      +  QA +   +    +   D WL  GD++ +G   F
Sbjct: 66  HNLREQHKVKMIGPHENERFWFDNLPMQATMFGFK-PINSFYPDEWLAHGDSIKVGQLEF 124

Query: 129 KVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGD 188
           KV HCPGH+PGHV++    +N   +GD +F+ SIGRTD   GD +QLI SI   I+ L  
Sbjct: 125 KVLHCPGHAPGHVVFYQQAHNTVIVGDVIFKGSIGRTDFPKGDSKQLIESIMQHIMTLPP 184

Query: 189 EISFVCGHGPNSTIGRERRLNPFL 212
             + + GHG N+ +  E+  NPF+
Sbjct: 185 NTAILSGHGDNTHVAHEQATNPFV 208


>gi|15602137|ref|NP_245209.1| hypothetical protein PM0272 [Pasteurella multocida subsp. multocida
           str. Pm70]
 gi|12720503|gb|AAK02356.1| unknown [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 209

 Score =  171 bits (434), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 82/211 (38%), Positives = 132/211 (62%), Gaps = 3/211 (1%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           ++  I+ VT F+QNC+ ++DE+   A ++DPGGD + +   I+  + +++ I +THGH+D
Sbjct: 1   MNIEIIPVTAFQQNCSLIWDEKR-NAAIIDPGGDAEKLIKRIEELDLNLQAILLTHGHLD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQ-DGDTLL 122
           HVG A +LK   ++ IIGP+  D      +  Q++   +       + DRWL  +G+ + 
Sbjct: 60  HVGAAPKLKAHFNVEIIGPNSQDEYWFNALPAQSQKFGL-FEIPAFTPDRWLNNEGEIIQ 118

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
           +G   F+V H PGH+PGH+ ++  E   A  GD LF+ SIGRTD   GD+  L++ I  K
Sbjct: 119 VGDMQFEVLHLPGHTPGHIGFIEHEKRIAFTGDVLFKQSIGRTDFQGGDHATLLSVIKEK 178

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           + PLGD++  V GHGP +TIG+E++ NPF++
Sbjct: 179 LYPLGDDMIIVAGHGPYTTIGQEKQHNPFVR 209


>gi|145637693|ref|ZP_01793346.1| predicted Zn-dependent hydrolase-like protein, including glyoxylase
           [Haemophilus influenzae PittHH]
 gi|145269095|gb|EDK09045.1| predicted Zn-dependent hydrolase-like protein, including glyoxylase
           [Haemophilus influenzae PittHH]
          Length = 210

 Score =  171 bits (432), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 85/210 (40%), Positives = 130/210 (61%), Gaps = 3/210 (1%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           ++  I+ VT F+QNC+ ++D++   A ++DPGG+ + +   I+  + ++K I ITHGH+D
Sbjct: 1   MNIEIIPVTAFQQNCSLIWDDDK-NAAIIDPGGEAERLIQRIEELHLNLKVILITHGHLD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWL-QDGDTLL 122
           HVG A QLK+   + I G  ++D  +   + EQA+   +  N      DRW  Q+G+ L 
Sbjct: 60  HVGAAMQLKQHFGVEIWGSQEEDKFLFESLPEQAQRFGLP-NIDAFLPDRWFNQEGEILK 118

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
           L    F++ H PGH+PGH+ ++  E   A  GD LF+  IGRTD   GDY  LI+SI  K
Sbjct: 119 LDGFNFEILHLPGHTPGHIGFIEHEKKVAFTGDVLFQGGIGRTDFPRGDYDALISSIRTK 178

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           +L L D++  + GHGP +TIG+E++ NPFL
Sbjct: 179 LLSLNDDLIIIAGHGPYTTIGQEKQTNPFL 208


>gi|58039612|ref|YP_191576.1| metallo-beta-lactamase superfamily protein [Gluconobacter oxydans
           621H]
 gi|58002026|gb|AAW60920.1| Metallo-beta-lactamase superfamily protein [Gluconobacter oxydans
           621H]
          Length = 245

 Score =  170 bits (431), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 93/221 (42%), Positives = 132/221 (59%), Gaps = 12/221 (5%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRN-FHVKQIWITH 59
           ++ L    V VTP +QNCT L ++E   AVVVDPGGD   + D++Q  +   V+ I +TH
Sbjct: 30  VTPLYAKRVPVTPLRQNCTILSNDEG-RAVVVDPGGD---VGDILQHLDGMTVEAILLTH 85

Query: 60  GHVDHVGGAAQLKEDLS------LTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDR 113
           GH+DH GGAA LK  L       + ++GP + D  ++  + +QA    I     N + DR
Sbjct: 86  GHLDHAGGAAALKRALEKQQGQPVPVLGPDRRDEFLLQSITKQAAAFGI-PGMENVAPDR 144

Query: 114 WLQDGDTLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQ 173
           +++ G+ L L      V H PGH+PGHV++V+ +N     GDTLFR ++GRTD  +GD Q
Sbjct: 145 FVEGGEVLHLLGQDLHVAHVPGHTPGHVVFVDHDNRRVLAGDTLFRGTVGRTDFAYGDSQ 204

Query: 174 QLINSINNKILPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
            L++ I   +L L D+   +CGHG  +TIG ERR NPFL S
Sbjct: 205 ALVDGIRRHLLTLSDDTVVLCGHGMPTTIGEERRTNPFLIS 245


>gi|90407611|ref|ZP_01215792.1| putative metallo-beta-lactamase family protein [Psychromonas sp.
           CNPT3]
 gi|90311314|gb|EAS39418.1| putative metallo-beta-lactamase family protein [Psychromonas sp.
           CNPT3]
          Length = 209

 Score =  169 bits (429), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 77/206 (37%), Positives = 134/206 (65%), Gaps = 1/206 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           ++ VTPF+QNC+ +  E++ +A +VDPGGD+  I DV++ +N  + ++ +THGH+DHVGG
Sbjct: 5   VIPVTPFEQNCSLIICEQTNKAAIVDPGGDVQRILDVVKQQNVIIDKVILTHGHLDHVGG 64

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           A ++   L ++IIGP K+D   +  ++EQ++     M+  +   ++WL++G+ + +G   
Sbjct: 65  AQRIANKLKVSIIGPEKEDLFWLESLEEQSQHFGFPMHT-SFLPEKWLEEGEIVNVGNIK 123

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
            +V H PGH+PGH+  ++ ++    +GD LF  ++GR+D   GD+ QLI  I +K+L L 
Sbjct: 124 LQVLHIPGHTPGHIALLDEQSQQVIVGDILFCGAVGRSDFPRGDHNQLIRGIKSKLLTLP 183

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLK 213
                  GHGP ++I +E+R NP+L+
Sbjct: 184 GATLVYPGHGPITSIAKEKRSNPYLR 209


>gi|262165526|ref|ZP_06033263.1| hydroxyacylglutathione hydrolase [Vibrio mimicus VM223]
 gi|262025242|gb|EEY43910.1| hydroxyacylglutathione hydrolase [Vibrio mimicus VM223]
          Length = 193

 Score =  169 bits (429), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 82/191 (42%), Positives = 114/191 (59%), Gaps = 2/191 (1%)

Query: 27  LEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLKEDLS-LTIIGPHKD 85
           +E VVVDPGGD+  +  +I      V Q+ +THGH+DHVGG   L E L    I+GPHK 
Sbjct: 1   MEGVVVDPGGDVKQLAMLIAELGVKVTQLVLTHGHLDHVGGTEPLAEALGGARIVGPHKA 60

Query: 86  DAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFKVFHCPGHSPGHVIYVN 145
           D   +  ++ Q+++    +       D+WL DGD +  G    +V H PGH+PGHV+  +
Sbjct: 61  DNFWLQGLEGQSKMFGFPLT-EAFEPDQWLNDGDVVTFGKQTLQVLHTPGHTPGHVVLFS 119

Query: 146 FENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEISFVCGHGPNSTIGRE 205
                A +GD LF  SIGRTD   GD+  LI SI NK+ PLG++++F+ GHGP ST GRE
Sbjct: 120 DSARLAFVGDVLFNGSIGRTDFPQGDFNTLIASIKNKLWPLGNDVTFIPGHGPKSTFGRE 179

Query: 206 RRLNPFLKSNI 216
           R  NP++   +
Sbjct: 180 RANNPYVADEM 190


>gi|294788692|ref|ZP_06753934.1| metallo-beta-lactamase domain protein [Simonsiella muelleri ATCC
           29453]
 gi|294483569|gb|EFG31254.1| metallo-beta-lactamase domain protein [Simonsiella muelleri ATCC
           29453]
          Length = 216

 Score =  169 bits (429), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 82/213 (38%), Positives = 128/213 (60%), Gaps = 2/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L+  I+ VTP++QNCT L+D+E+ EAV+ D GG+   I  +IQ ++ ++K+IW+THGH+D
Sbjct: 3   LNIKIIPVTPYEQNCTLLWDDETNEAVLTDLGGNAAEIWHIIQKKHLNLKEIWLTHGHLD 62

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIR--MNARNASSDRWLQDGDTL 121
           HVGG   ++E     +IGPH DD  ++  +  + R  +      + N    RWL +G+ L
Sbjct: 63  HVGGVVAMRELTDTPVIGPHCDDLFLLEDLSNKTREYAKYGFEFSTNFLPTRWLNEGEVL 122

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
            +G + F V H PGH+PGHV++          GD LF+ SIGRTD   G+ Q L + I  
Sbjct: 123 SVGQYEFSVLHIPGHTPGHVVFYCEREKLLIAGDVLFKESIGRTDFPRGNTQDLHHGIRT 182

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           K+  L + +  + GH   +TIG E+  NP++++
Sbjct: 183 KLYRLPENVVVIPGHRETTTIGHEKIYNPYVRA 215


>gi|260914199|ref|ZP_05920672.1| metallo-beta-lactamase [Pasteurella dagmatis ATCC 43325]
 gi|260631832|gb|EEX50010.1| metallo-beta-lactamase [Pasteurella dagmatis ATCC 43325]
          Length = 210

 Score =  169 bits (429), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 80/212 (37%), Positives = 134/212 (63%), Gaps = 3/212 (1%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           ++  I+ VT F+QNC+ ++D+E   A ++DPGG+ + +   I+  + ++K I +THGH+D
Sbjct: 1   MNIEIIPVTAFQQNCSLIWDDEK-NAAIIDPGGEAEKLIKRIEELDLNLKVILLTHGHLD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWL-QDGDTLL 122
           HVG A +LK+  ++ +IGP+  D     ++ +Q++   +         DRWL ++G+ + 
Sbjct: 60  HVGAAPKLKQHFNVEMIGPNSLDDYWFQQLPQQSQKFGL-FEIDAFEPDRWLNEEGEIIE 118

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
           +G   F+V H PGH+PGH+ ++      A  GD LF+ S+GRTD   GD+Q L+  I  K
Sbjct: 119 IGDMRFEVLHLPGHTPGHIGFIEHNKRIAFTGDVLFKQSVGRTDFPGGDHQALLRVIREK 178

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           + PLGD++  V GHGP +TIG+E++ NPF++ 
Sbjct: 179 LYPLGDDMIIVAGHGPYTTIGQEKQNNPFVRE 210


>gi|238021583|ref|ZP_04602009.1| hypothetical protein GCWU000324_01483 [Kingella oralis ATCC 51147]
 gi|237866197|gb|EEP67239.1| hypothetical protein GCWU000324_01483 [Kingella oralis ATCC 51147]
          Length = 214

 Score =  169 bits (429), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 82/209 (39%), Positives = 124/209 (59%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L   I+ VT F+QNC+ L+D+E+ +AV+VD GGD + +   +  R+  +  IW+THGH+D
Sbjct: 3   LQIQIMPVTAFRQNCSLLWDDETRDAVLVDVGGDAEHLLAEVNKRSLKLNAIWLTHGHLD 62

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GG   L E  ++ +IGPH DD  ++  + E        +    A + RWL DGDTL +
Sbjct: 63  HAGGVPMLLERQNVPVIGPHPDDQFLLDALPETTASYGFPVCPVFAPT-RWLHDGDTLSV 121

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   F+V H PGH+PG V++          GD LF  SIGRTD   G++Q L+++I NK+
Sbjct: 122 GQFTFQVLHIPGHTPGQVVFYCAAAKLLLAGDVLFYESIGRTDFPRGNHQDLLDNIRNKL 181

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
             L ++   + GH   +TIG E++ NP++
Sbjct: 182 FRLPNDTLVIPGHARTTTIGHEKQFNPYV 210


>gi|52424879|ref|YP_088016.1| GloB protein [Mannheimia succiniciproducens MBEL55E]
 gi|52306931|gb|AAU37431.1| GloB protein [Mannheimia succiniciproducens MBEL55E]
          Length = 209

 Score =  169 bits (429), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 85/211 (40%), Positives = 127/211 (60%), Gaps = 3/211 (1%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           ++  I+ VT F+QNC+ ++D+    A ++DPGG+   + + I+     +K I +THGH+D
Sbjct: 1   MNIDIIPVTSFQQNCSLIWDDRK-NAAIIDPGGEPKKLIEKIEENGLDLKMILLTHGHLD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWL-QDGDTLL 122
           H+G A  LK    + IIGPH+DD      + +Q+    +   A     D WL ++ + L 
Sbjct: 60  HIGAAPALKAHFGVDIIGPHEDDVFWFENLPQQSAQFGL-FEANAFLPDMWLNRENEVLE 118

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
           +G+   +V H PGH+PGHV +   +N  A  GD LFR+SIGRTD   G Y  LI+SI  K
Sbjct: 119 VGSLKLEVLHLPGHTPGHVGFFEHQNIVAFTGDVLFRNSIGRTDFPGGSYDDLISSIKEK 178

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           + PLGD+   + GHGP +TIG E++ NP+LK
Sbjct: 179 LFPLGDDWIIIPGHGPYTTIGAEKKTNPYLK 209


>gi|325267543|ref|ZP_08134195.1| metallo-beta-lactamase domain protein [Kingella denitrificans ATCC
           33394]
 gi|324980893|gb|EGC16553.1| metallo-beta-lactamase domain protein [Kingella denitrificans ATCC
           33394]
          Length = 213

 Score =  169 bits (428), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 81/212 (38%), Positives = 129/212 (60%), Gaps = 1/212 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L + I  VTPF+QNCT L+D+ + +AV+ D GGD   +   ++ +  +++ +W+THGH+D
Sbjct: 3   LQYRIFPVTPFRQNCTLLWDDATNDAVLTDVGGDSGFLWQHVRQQGLNLRAVWLTHGHLD 62

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GG   L +     I+GPH++D  ++  + +        +    A + R+L +GDTL +
Sbjct: 63  HAGGVPFLLQQHETEILGPHREDEFLLQSLPQTTAEYGFPVCPAFAPT-RYLNEGDTLTV 121

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   F V H  GH+PGHV++ + +N     GD LFR SIGRTD   G++Q L+N+I  K+
Sbjct: 122 GQQRFDVLHIDGHTPGHVVFHSPDNKLLIAGDVLFRESIGRTDFPRGNHQALLNNIRRKL 181

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSN 215
             L D+   + GHG  +TIG E+R NPF++++
Sbjct: 182 YTLPDDTLVIPGHGRTTTIGHEKRHNPFVRAD 213


>gi|16273550|ref|NP_439805.1| hypothetical protein HI1663 [Haemophilus influenzae Rd KW20]
 gi|260581258|ref|ZP_05849076.1| Zn-dependent hydrolase [Haemophilus influenzae RdAW]
 gi|2494857|sp|Q57544|Y1663_HAEIN RecName: Full=Uncharacterized protein HI_1663
 gi|1574513|gb|AAC23309.1| conserved hypothetical protein [Haemophilus influenzae Rd KW20]
 gi|260092085|gb|EEW76030.1| Zn-dependent hydrolase [Haemophilus influenzae RdAW]
          Length = 212

 Score =  169 bits (427), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 87/212 (41%), Positives = 132/212 (62%), Gaps = 3/212 (1%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           ++  I+ VT F+QNC+ ++D+E   A ++DPGG+ + +   I+  + ++K + +THGH+D
Sbjct: 1   MNIEIIPVTAFQQNCSLIWDDEK-NAAIIDPGGEAERLIQRIEELDLNLKVLLLTHGHLD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWL-QDGDTLL 122
           HVG A QLK+   + I G ++ D  +   + EQA+   +  N      DRW  Q+G+ L 
Sbjct: 60  HVGAAMQLKQHFGVEIWGSNEKDKFLFESLPEQAQRFGLP-NIDAFLPDRWFNQEGEILK 118

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
           L    F++ H PGH+PGH+ ++  E   A  GD LF+  IGRTD   GDY+ LI+SI  K
Sbjct: 119 LDGFNFEILHLPGHTPGHIGFIEHEKKVAFTGDVLFQGGIGRTDFPRGDYETLISSIRTK 178

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           +LPL D+I  + GHG  +TIG+E+R NPFL S
Sbjct: 179 LLPLNDDIIIIAGHGSYTTIGQEKRSNPFLNS 210


>gi|77360344|ref|YP_339919.1| metallo-hydrolase/oxidoreductase domain-containing protein
           [Pseudoalteromonas haloplanktis TAC125]
 gi|76875255|emb|CAI86476.1| putative enzyme with metallo-hydrolase/oxidoreductase domain
           [Pseudoalteromonas haloplanktis TAC125]
          Length = 213

 Score =  168 bits (426), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 82/204 (40%), Positives = 118/204 (57%), Gaps = 1/204 (0%)

Query: 9   VQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGA 68
           + VT F QNC  +   +S +AVVVDPGGD + I   ++  +  +  IW+THGH+DHVG A
Sbjct: 6   IPVTAFAQNCRIIACSQSKQAVVVDPGGDYNKIVAALKQHDLTLTAIWLTHGHLDHVGAA 65

Query: 69  AQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIF 128
             L+   S+ IIGPHKD+      +  QA++            D WL   D + +G   F
Sbjct: 66  DALRNTYSVKIIGPHKDEHFWFENLPMQAQMFGFAA-VTAFYPDEWLAHDDIIRVGELSF 124

Query: 129 KVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGD 188
            V HCPGH+PGHV++   +     +GD +F+ S+GRTD   GD QQLI SI  +I+ L D
Sbjct: 125 IVRHCPGHTPGHVVFYQPQQQCVIVGDVIFKGSVGRTDFPKGDAQQLITSIKTQIMTLPD 184

Query: 189 EISFVCGHGPNSTIGRERRLNPFL 212
               + GHG ++ +G E++ NPF+
Sbjct: 185 NTRILAGHGSDTNVGYEKQNNPFI 208


>gi|53804971|ref|YP_113173.1| metallo-beta-lactamase family protein [Methylococcus capsulatus
           str. Bath]
 gi|53758732|gb|AAU93023.1| metallo-beta-lactamase family protein [Methylococcus capsulatus
           str. Bath]
          Length = 234

 Score =  168 bits (425), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 94/208 (45%), Positives = 126/208 (60%), Gaps = 1/208 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           I+ VT F+QNCT L  E +    VVDPGG+LD I        F + +I +TH H DH  G
Sbjct: 25  IIPVTAFQQNCTILGCETTGLGAVVDPGGELDRIMAAAGDAGFTLSKILLTHAHADHAAG 84

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           AA L   L + I GP +DDA  +  + +Q R+  +       + DRWL+ GDT+  G   
Sbjct: 85  AAGLAAQLGIPIEGPQRDDAFWIETLPQQCRMFGLP-GTTVFTPDRWLEHGDTVSFGAET 143

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
            +V HCPGH+PGHV++ +     A +GD LF+ SIGRTD   GDY  LI SI  ++ PLG
Sbjct: 144 LEVLHCPGHTPGHVVFFHRGQRLALVGDVLFKGSIGRTDFPRGDYDILIRSIRERLFPLG 203

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLKSN 215
           D+++F+ GHGP ST G ERR NPFL++ 
Sbjct: 204 DDVTFIPGHGPTSTFGDERRSNPFLRNG 231


>gi|229845071|ref|ZP_04465207.1| predicted Zn-dependent hydrolase-like protein [Haemophilus
           influenzae 6P18H1]
 gi|229812043|gb|EEP47736.1| predicted Zn-dependent hydrolase-like protein [Haemophilus
           influenzae 6P18H1]
          Length = 212

 Score =  168 bits (425), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 84/210 (40%), Positives = 129/210 (61%), Gaps = 3/210 (1%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           ++  I+ VT F+QNC+ ++D++   A ++DPGG+ + +   I+  + ++K I ITHGH+D
Sbjct: 1   MNIEIIPVTAFQQNCSLIWDDDK-NAAIIDPGGEAERLIQRIEELHLNLKVILITHGHLD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWL-QDGDTLL 122
           HVG A QLK+   + I G  ++D  +   + EQA+   +  N      DRW  Q+G+ L 
Sbjct: 60  HVGAAMQLKQHFGVEIWGSQEEDKFLFESLPEQAQRFGLP-NIEAFLPDRWFNQEGEILK 118

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
           L    F++ H PGH+PGH+ ++  E   A  GD LF+  IGRTD   GDY  LI+SI  K
Sbjct: 119 LDGFNFEILHLPGHTPGHIGFIEHEKKVAFTGDVLFQGGIGRTDFPRGDYDVLISSIRTK 178

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           +L L D++  + GHG  +TIG+E++ NPFL
Sbjct: 179 LLSLNDDLIIIAGHGSYTTIGQEKQTNPFL 208


>gi|294668357|ref|ZP_06733460.1| hypothetical protein NEIELOOT_00269 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
 gi|291309675|gb|EFE50918.1| hypothetical protein NEIELOOT_00269 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
          Length = 211

 Score =  168 bits (425), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 79/210 (37%), Positives = 127/210 (60%), Gaps = 2/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L   I+ VT F+QNCT ++D+E+ EAV  D GG++  + +  + R  HVK IW+THGH+D
Sbjct: 3   LHVEIIAVTLFRQNCTLMWDDETNEAVFTDVGGNVPRLLEEAEKRGLHVKAIWLTHGHLD 62

Query: 64  HVGGAAQLKE-DLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLL 122
           H+GG A++   +  + ++GPH+ D  ++  + E  +  +     +     RWL++GD L 
Sbjct: 63  HIGGVAEMTAGNPKIEVLGPHEADRFLLANLTEITKQYNFP-PTKPFIPTRWLEEGDELK 121

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
           +G + FKV H PGH+PGH+++   E +    GD +F  S+GRTD    ++  LI +I  K
Sbjct: 122 VGQYAFKVLHIPGHTPGHIVFYCAEADLLVAGDVIFYESVGRTDFERSNHDDLIRNIREK 181

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           I  L ++   V GHG  +T+G E++ NP+L
Sbjct: 182 IFTLPEDTQIVTGHGRMTTVGYEKQHNPYL 211


>gi|332968630|gb|EGK07684.1| metallo-beta-lactamase domain protein [Kingella kingae ATCC 23330]
          Length = 212

 Score =  168 bits (425), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 77/211 (36%), Positives = 126/211 (59%), Gaps = 1/211 (0%)

Query: 3   KLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHV 62
            L + I  VTPF+QNCT L+D+++ +A + D GGD D +   +Q R+  +++IW+THGH+
Sbjct: 2   ALQYQIFPVTPFRQNCTLLWDDQTGDAALTDVGGDTDYLIHALQQRDLTLREIWLTHGHL 61

Query: 63  DHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLL 122
           DH GG   L +  ++ ++GPH DD  ++  + +        +     +  RWL + D++ 
Sbjct: 62  DHAGGVPFLLQTHNVPVLGPHADDEFLLQSLPDTTASYGFPV-CPAFTPTRWLNEDDSVN 120

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
           +G + F+V H  GH+PGHV++   +      GD LF  SIGRTD   G++Q L+N+I  K
Sbjct: 121 VGAYTFQVLHIDGHTPGHVVFYCEQAKLLIAGDVLFYESIGRTDFPRGNHQALLNNIAQK 180

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           +  L D+   + GH   +TIG E++ NPF++
Sbjct: 181 LYVLPDDTLVIAGHARTTTIGHEKQYNPFVR 211


>gi|152978759|ref|YP_001344388.1| beta-lactamase domain-containing protein [Actinobacillus
           succinogenes 130Z]
 gi|150840482|gb|ABR74453.1| beta-lactamase domain protein [Actinobacillus succinogenes 130Z]
          Length = 210

 Score =  167 bits (422), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 81/211 (38%), Positives = 126/211 (59%), Gaps = 2/211 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +   I+ VT F+QNC+ ++DE+ + A ++DPGGD   +   I+    + K I +THGH+D
Sbjct: 1   MKLDIIPVTSFQQNCSIIWDEKDMSAAIIDPGGDASKLIKRIEELRLNPKMILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWL-QDGDTLL 122
           HVG A +LK      I+GP++ D      + +Q+R   +         DRWL ++G+ + 
Sbjct: 61  HVGAAIKLKASFDCEILGPNQLDEYWFQMLPQQSRQFGL-FEVEAFLPDRWLNREGEVIR 119

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
           LG   F+V H PGH+PGH+ +++  ++ A  GD LF  SIGRTD   GD+  L+ SI  K
Sbjct: 120 LGELSFEVLHLPGHTPGHIGFIDHAHHIAFTGDVLFNQSIGRTDFPGGDHTDLMRSIKEK 179

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           +  L D+   + GHGP +TIGRE+  NP+++
Sbjct: 180 LFALPDDTVVIAGHGPYTTIGREKIHNPYVR 210


>gi|149907596|ref|ZP_01896343.1| glyoxylase II family protein [Moritella sp. PE36]
 gi|149809266|gb|EDM69195.1| glyoxylase II family protein [Moritella sp. PE36]
          Length = 209

 Score =  166 bits (421), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 79/210 (37%), Positives = 118/210 (56%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +   ++ VTPF+QNC+ L   E+ +A +VDPGGD+D I   ++     V++I++TH H+D
Sbjct: 1   MQVKVIPVTPFEQNCSLLICPETNKAAIVDPGGDIDKIISQVKQHGVEVEKIFLTHAHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVGG   L   L++TI GPH  D   + K+  Q ++             RWL+ GD +  
Sbjct: 61  HVGGTEALAAALNVTIEGPHIADKFWLDKLPMQGQMFGFP-EVPPFEPQRWLEHGDIITF 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G       H PGH+PGHV++ +       +GD LF  S+GRTD   G +  L+ +I  ++
Sbjct: 120 GNQQLTALHTPGHTPGHVVFNHVATKQVIVGDVLFNGSVGRTDFPQGCFNTLMTAIKGQL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
             L +E  F  GHGP STIG E+R NP ++
Sbjct: 180 WTLPEETVFFPGHGPTSTIGHEKRTNPHVR 209


>gi|261868416|ref|YP_003256338.1| carboxy- protease [Aggregatibacter actinomycetemcomitans D11S-1]
 gi|261413748|gb|ACX83119.1| carboxy- protease [Aggregatibacter actinomycetemcomitans D11S-1]
          Length = 212

 Score =  165 bits (418), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 77/213 (36%), Positives = 128/213 (60%), Gaps = 2/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           ++  I+ VT F+QNC+ ++D++   A ++DPGG+ D +   I+    +++ I +THGH+D
Sbjct: 1   MNIEIIPVTAFQQNCSLIWDDKK-NAAIIDPGGEADKLIKRIEELGLNLQAILLTHGHLD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWL-QDGDTLL 122
           HVG A ++K+  ++ I+G +  D      + +Q+    +         DRWL ++G+ L 
Sbjct: 60  HVGAAEKVKQQFNVPILGSNSKDDYWFKGLPQQSEKFGMLFEVATFEPDRWLDKEGEILT 119

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
           +G   F+V H PGH+PGH+ ++  +   A  GD LF+S IGRTD   G Y ++I SI  K
Sbjct: 120 IGDFTFEVLHLPGHTPGHIGFIEHQKRVAFTGDVLFKSGIGRTDFPGGSYDEIIASIREK 179

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFLKSN 215
           +  L D++  V GHGP +TIG E++ NP++K  
Sbjct: 180 LYRLDDDMIIVPGHGPYTTIGIEKQTNPYVKQE 212


>gi|312883638|ref|ZP_07743363.1| glyoxylase II family protein [Vibrio caribbenthicus ATCC BAA-2122]
 gi|309368861|gb|EFP96388.1| glyoxylase II family protein [Vibrio caribbenthicus ATCC BAA-2122]
          Length = 188

 Score =  165 bits (418), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 81/187 (43%), Positives = 122/187 (65%), Gaps = 2/187 (1%)

Query: 27  LEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLKEDLS-LTIIGPHKD 85
           +EA+V+DPGGD++ ++ +I + N +V  + +THGH+DHVGG  +L E L  + IIGPH +
Sbjct: 1   MEAIVIDPGGDIEQLEALIDNLNVNVVNLVLTHGHLDHVGGTEKLSEALGGIAIIGPHHE 60

Query: 86  DAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFKVFHCPGHSPGHVIYVN 145
           D   +  +++Q+++    +      S +WL +GD++  G  I +V H PGH+PGHV+   
Sbjct: 61  DLFWLEGLEKQSQMFGFPITKAFKPS-KWLSEGDSVRFGNQIMEVLHTPGHTPGHVVLFC 119

Query: 146 FENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEISFVCGHGPNSTIGRE 205
            +   A +GD LF  S+GRTD   GD+  LI SI  K+ PLG+++ FV GHGP STIG E
Sbjct: 120 RDAKLAFVGDVLFNGSVGRTDFPKGDFDTLIESIKTKLWPLGNDVKFVPGHGPESTIGHE 179

Query: 206 RRLNPFL 212
           R+ NPF+
Sbjct: 180 RKTNPFV 186


>gi|218515630|ref|ZP_03512470.1| putative hydrolase protein [Rhizobium etli 8C-3]
          Length = 152

 Score =  165 bits (418), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 76/136 (55%), Positives = 98/136 (72%), Gaps = 1/136 (0%)

Query: 79  IIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFKVFHCPGHSP 138
           I+GPH+DD  ++ +++ QA    I    RN   D WL+DGD +  G H F+V+H PGH+P
Sbjct: 2   IVGPHQDDLPLLQRIEAQAANYGI-SGLRNVLPDCWLKDGDRVSFGAHEFEVYHAPGHAP 60

Query: 139 GHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEISFVCGHGP 198
           GHVIY N   NFAHLGD LF  SIGRTD+  G++QQL++SI +K+LPLGDE+ F+CGHGP
Sbjct: 61  GHVIYFNRAQNFAHLGDVLFNGSIGRTDLPGGNHQQLLDSIRDKVLPLGDEVGFICGHGP 120

Query: 199 NSTIGRERRLNPFLKS 214
            S IG ERR NPFL+ 
Sbjct: 121 GSRIGDERRSNPFLQE 136


>gi|329119138|ref|ZP_08247829.1| metallo-beta-lactamase domain protein [Neisseria bacilliformis ATCC
           BAA-1200]
 gi|327464769|gb|EGF11063.1| metallo-beta-lactamase domain protein [Neisseria bacilliformis ATCC
           BAA-1200]
          Length = 227

 Score =  165 bits (417), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 80/210 (38%), Positives = 123/210 (58%), Gaps = 2/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L   I+ VT F+QNCT ++D+E+ EAV  D GG +  + +  + R   VK +W+THGH+D
Sbjct: 19  LHVEIIPVTLFRQNCTLMWDDETNEAVFTDVGGKVPQLMEEAEKRGLTVKAVWLTHGHLD 78

Query: 64  HVGGAAQLKE-DLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLL 122
           HV G ++L      L ++GPH+ D  ++  + E  +       A+     RWL++GDTL 
Sbjct: 79  HVSGVSELTALRPDLEVLGPHEADRFLLANLAEITKQYDFP-PAKPFIPTRWLEEGDTLS 137

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
           +G + F+V H PGH+PGH+++   E      GD +F  SIGRTD    ++  LI +I  K
Sbjct: 138 VGKYRFQVLHVPGHTPGHIVFYCAEAGLLIAGDVIFYESIGRTDFERSNHDDLIKNIREK 197

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           I  L D+   + GHG  +T+G E++ NP+L
Sbjct: 198 IFTLPDDTEIITGHGRTTTVGYEKQHNPYL 227


>gi|293392041|ref|ZP_06636375.1| carboxy- protease [Aggregatibacter actinomycetemcomitans D7S-1]
 gi|290952575|gb|EFE02694.1| carboxy- protease [Aggregatibacter actinomycetemcomitans D7S-1]
          Length = 212

 Score =  163 bits (413), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 76/210 (36%), Positives = 127/210 (60%), Gaps = 2/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           ++  I+ VT F+QNC+ ++D++   A ++DPGG+ D +   I+    +++ I +THGH+D
Sbjct: 1   MNIEIIPVTAFQQNCSLIWDDKK-NAAIIDPGGEADKLIKRIEELGLNLQAILLTHGHLD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWL-QDGDTLL 122
           HVG A ++K+  ++ I+G +  D      + +Q+    +         DRWL ++G+ L 
Sbjct: 60  HVGAAEKVKKQFNVPILGSNSKDDYWFKGLPQQSEKFGMLFEVAAFEPDRWLDKEGEILT 119

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
           +G   F+V H PGH+PGH+ ++  +   A  GD LF+S IGRTD   G Y ++I SI  K
Sbjct: 120 IGDFTFEVLHLPGHTPGHIGFIEHQKRVAFTGDVLFKSGIGRTDFPGGSYDEIIASIREK 179

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           +  L D++  V GHGP +TIG E++ NP++
Sbjct: 180 LYRLDDDMIIVPGHGPYTTIGTEKQTNPYV 209


>gi|119944001|ref|YP_941681.1| beta-lactamase domain-containing protein [Psychromonas ingrahamii
           37]
 gi|119862605|gb|ABM02082.1| beta-lactamase domain protein [Psychromonas ingrahamii 37]
          Length = 215

 Score =  163 bits (413), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 77/206 (37%), Positives = 124/206 (60%), Gaps = 1/206 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           ++ VTP++QNC+ +  EE+  A +VDPGGD   I ++++ +   V +I +THGH+DHVGG
Sbjct: 10  VIPVTPYQQNCSLIICEETKIAAIVDPGGDPLRILNIVEKQGVKVDKIILTHGHLDHVGG 69

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
              +   L++ +IGP K+D   + +++ Q+R   +     + S +RWL +G+ L +G   
Sbjct: 70  TQAVAGKLNVPVIGPEKEDLFWLEQLEAQSRRFGLP-TTESFSPNRWLTEGEVLEVGKIK 128

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
            KV   PGH+PGH+   + ++    +GD LF   IGR D   G+   L++ I  K+L L 
Sbjct: 129 LKVLRIPGHTPGHIALYDKQSKQVIVGDILFNGGIGRFDFPRGNRSLLVSGIKEKLLTLP 188

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLK 213
            E +   GHGP +TIG+E+  NPFL+
Sbjct: 189 PETTVYPGHGPTTTIGKEKASNPFLR 214


>gi|88859302|ref|ZP_01133942.1| putative enzyme with metallo-hydrolase/oxidoreductase domain
           [Pseudoalteromonas tunicata D2]
 gi|88818319|gb|EAR28134.1| putative enzyme with metallo-hydrolase/oxidoreductase domain
           [Pseudoalteromonas tunicata D2]
          Length = 213

 Score =  163 bits (413), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 84/205 (40%), Positives = 118/205 (57%), Gaps = 1/205 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           I  VT F QNC+ L  E+S +AV++DPGGD   +  +   +   V +I +THGH+DHVG 
Sbjct: 5   IEPVTAFAQNCSLLICEQSAQAVMIDPGGDPQQLIALTTKQGCKVVKIILTHGHLDHVGA 64

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           A +L E   + IIGPH DD   +  + +QA++      A       WL     +  G   
Sbjct: 65  AKELAEYFQVDIIGPHHDDQFWLDALPQQAQMFGFNA-AEPFLPTSWLVHQQRVHFGEQE 123

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
            +V HCPGH+PGHV+ ++ ++ F   GD LF+ SIGRTD   G+  QL++SI  ++  L 
Sbjct: 124 LEVRHCPGHTPGHVVLISHQDKFVIAGDVLFKGSIGRTDFPKGNQAQLVSSIKQQLFDLP 183

Query: 188 DEISFVCGHGPNSTIGRERRLNPFL 212
           D      GHGP +TIG E+R NPFL
Sbjct: 184 DGYVVYPGHGPITTIGDEKRHNPFL 208


>gi|254363169|ref|ZP_04979218.1| zinc (Zn2+)-dependent hydrolase [Mannheimia haemolytica PHL213]
 gi|261493952|ref|ZP_05990460.1| glyoxalase II family protein [Mannheimia haemolytica serotype A2
           str. BOVINE]
 gi|261494763|ref|ZP_05991242.1| glyoxalase II family protein [Mannheimia haemolytica serotype A2
           str. OVINE]
 gi|153095063|gb|EDN75614.1| zinc (Zn2+)-dependent hydrolase [Mannheimia haemolytica PHL213]
 gi|261309580|gb|EEY10804.1| glyoxalase II family protein [Mannheimia haemolytica serotype A2
           str. OVINE]
 gi|261310384|gb|EEY11579.1| glyoxalase II family protein [Mannheimia haemolytica serotype A2
           str. BOVINE]
          Length = 209

 Score =  163 bits (412), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 77/210 (36%), Positives = 128/210 (60%), Gaps = 2/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
            +  I+ V+PF+QNCT ++DE    A ++D G + + I   ++S+   V+++ ITHGH+D
Sbjct: 2   FNLQIIPVSPFQQNCTVIWDENK-NAAIIDGGDNAEGIIQFVESQQLKVQKLLITHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+    +L+E   + + G H  D  +  ++ E  +   +         D WL++GD + +
Sbjct: 61  HIMAVEKLREHFQVEVFGSHLADKPLFERLPEMCQQFGLP-PVNGFLPDHWLEEGDRVEV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   + V H PGH+PGH+ + +F+N  A  GD LF++SIGRTD+  G++ QL+ +I  K+
Sbjct: 120 GELSYTVRHLPGHAPGHIGFFDFDNRIAFSGDVLFQNSIGRTDLYLGNHSQLLETIREKM 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
             L D+   + GHGP++TIGRE++ NPFLK
Sbjct: 180 FDLDDDFIIIPGHGPHTTIGREKQTNPFLK 209


>gi|307249327|ref|ZP_07531321.1| hypothetical protein appser4_1410 [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
 gi|306858621|gb|EFM90683.1| hypothetical protein appser4_1410 [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
          Length = 219

 Score =  162 bits (411), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 77/210 (36%), Positives = 126/210 (60%), Gaps = 2/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
            +  I+ V+ F+QNC+ ++D+    A ++D G D D I   ++S+N  V+++ +THGH+D
Sbjct: 12  FNLQIIPVSAFQQNCSVIWDDNK-NAAIIDAGDDADKIIQFVESQNLKVQKLLLTHGHLD 70

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+    ++++   + + G H DD  +  ++ +   +  I    +    D WL + D + +
Sbjct: 71  HIMAVEKVRDHFGVEVYGSHIDDKPLFEQLPQMCEMFGIP-PVKAFLPDHWLSENDRVEV 129

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   F V H PGH+PGH+ + +FEN  A  GD LF+ SIGRTD+  G+   L+N+I  K+
Sbjct: 130 GALRFSVRHLPGHAPGHIGFFDFENKIAFSGDVLFKDSIGRTDLYLGNLDVLLNTIRTKM 189

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
             L D+   V GHGP++TIGRE++ NPFLK
Sbjct: 190 FDLDDDFIVVAGHGPHTTIGREKQHNPFLK 219


>gi|332534265|ref|ZP_08410109.1| hypothetical metal-binding enzyme [Pseudoalteromonas haloplanktis
           ANT/505]
 gi|332036261|gb|EGI72733.1| hypothetical metal-binding enzyme [Pseudoalteromonas haloplanktis
           ANT/505]
          Length = 213

 Score =  162 bits (411), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 80/204 (39%), Positives = 117/204 (57%), Gaps = 1/204 (0%)

Query: 9   VQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGA 68
           + VT F QN   ++  E+  AVV+DPGGD D I   +      +  IW+THGH+DHVGGA
Sbjct: 6   IPVTAFAQNSRIIWCSETKHAVVIDPGGDTDKIVAALNEHKLVLSAIWLTHGHLDHVGGA 65

Query: 69  AQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIF 128
             L+   ++ IIGP KD+      +  QA++   +        D WL   DT+ +G   F
Sbjct: 66  DILRNQFNVQIIGPQKDEYFWFENLSMQAQMFEFK-PIEPFYPDIWLNHNDTVSVGKLSF 124

Query: 129 KVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGD 188
            V HCPGH+PGH+++   +     +GD +F+ S+GRTD   G+ +QLI SI   IL L D
Sbjct: 125 LVKHCPGHTPGHIVFYQPDYECVIVGDVIFKGSVGRTDFPKGNSEQLIESIKAHILTLPD 184

Query: 189 EISFVCGHGPNSTIGRERRLNPFL 212
               + GHG ++T+G E++ NPF+
Sbjct: 185 NTKILAGHGSDTTVGFEKKTNPFV 208


>gi|307247106|ref|ZP_07529158.1| hypothetical protein appser2_1050 [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
 gi|307251650|ref|ZP_07533555.1| hypothetical protein appser6_1720 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|307262710|ref|ZP_07544338.1| hypothetical protein appser13_1370 [Actinobacillus pleuropneumoniae
           serovar 13 str. N273]
 gi|306856355|gb|EFM88506.1| hypothetical protein appser2_1050 [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
 gi|306860847|gb|EFM92855.1| hypothetical protein appser6_1720 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|306871965|gb|EFN03681.1| hypothetical protein appser13_1370 [Actinobacillus pleuropneumoniae
           serovar 13 str. N273]
          Length = 219

 Score =  162 bits (410), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 77/210 (36%), Positives = 126/210 (60%), Gaps = 2/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
            +  I+ V+ F+QNC+ ++D+    A ++D G D D I   ++S+N  V+++ +THGH+D
Sbjct: 12  FNLQIIPVSAFQQNCSVIWDDNK-NAAIIDAGDDADKIIQFVESQNLKVQKLLLTHGHLD 70

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+    ++++   + + G H DD  +  ++ +   +  I    +    D WL + D + +
Sbjct: 71  HIMAVEKVRDHFGVEVYGSHIDDKPLFEQLPQMCEMFGIP-PVKAFLPDHWLSEDDRVEV 129

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   F V H PGH+PGH+ + +FEN  A  GD LF+ SIGRTD+  G+   L+N+I  K+
Sbjct: 130 GALRFSVRHLPGHAPGHIGFFDFENKIAFSGDVLFKDSIGRTDLYLGNLDVLLNTIRTKM 189

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
             L D+   V GHGP++TIGRE++ NPFLK
Sbjct: 190 FDLDDDFIVVAGHGPHTTIGREKQHNPFLK 219


>gi|32034590|ref|ZP_00134746.1| COG0491: Zn-dependent hydrolases, including glyoxylases
           [Actinobacillus pleuropneumoniae serovar 1 str. 4074]
 gi|126207611|ref|YP_001052836.1| glyoxalase II family protein [Actinobacillus pleuropneumoniae L20]
 gi|190149394|ref|YP_001967919.1| glyoxalase II family protein [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
 gi|303249827|ref|ZP_07336031.1| glyoxalase II family protein [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|303251947|ref|ZP_07338118.1| glyoxalase II family protein [Actinobacillus pleuropneumoniae
           serovar 2 str. 4226]
 gi|307244931|ref|ZP_07527028.1| hypothetical protein appser1_1430 [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|307253885|ref|ZP_07535737.1| hypothetical protein appser9_1430 [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|307256148|ref|ZP_07537935.1| hypothetical protein appser10_1530 [Actinobacillus pleuropneumoniae
           serovar 10 str. D13039]
 gi|307258339|ref|ZP_07540080.1| hypothetical protein appser11_1420 [Actinobacillus pleuropneumoniae
           serovar 11 str. 56153]
 gi|307260580|ref|ZP_07542272.1| hypothetical protein appser12_1550 [Actinobacillus pleuropneumoniae
           serovar 12 str. 1096]
 gi|126096403|gb|ABN73231.1| glyoxalase II family protein [Actinobacillus pleuropneumoniae
           serovar 5b str. L20]
 gi|189914525|gb|ACE60777.1| glyoxalase II family protein [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
 gi|302649377|gb|EFL79562.1| glyoxalase II family protein [Actinobacillus pleuropneumoniae
           serovar 2 str. 4226]
 gi|302651394|gb|EFL81546.1| glyoxalase II family protein [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|306854096|gb|EFM86304.1| hypothetical protein appser1_1430 [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|306863089|gb|EFM95031.1| hypothetical protein appser9_1430 [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|306865329|gb|EFM97225.1| hypothetical protein appser10_1530 [Actinobacillus pleuropneumoniae
           serovar 10 str. D13039]
 gi|306867523|gb|EFM99370.1| hypothetical protein appser11_1420 [Actinobacillus pleuropneumoniae
           serovar 11 str. 56153]
 gi|306869657|gb|EFN01442.1| hypothetical protein appser12_1550 [Actinobacillus pleuropneumoniae
           serovar 12 str. 1096]
          Length = 209

 Score =  162 bits (410), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 77/210 (36%), Positives = 126/210 (60%), Gaps = 2/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
            +  I+ V+ F+QNC+ ++D+    A ++D G D D I   ++S+N  V+++ +THGH+D
Sbjct: 2   FNLQIIPVSAFQQNCSVIWDDNK-NAAIIDAGDDADKIIQFVESQNLKVQKLLLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+    ++++   + + G H DD  +  ++ +   +  I    +    D WL + D + +
Sbjct: 61  HIMAVEKVRDHFGVEVYGSHIDDKPLFEQLPQMCEMFGIP-PVKAFLPDHWLSEDDRVEV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   F V H PGH+PGH+ + +FEN  A  GD LF+ SIGRTD+  G+   L+N+I  K+
Sbjct: 120 GALRFSVRHLPGHAPGHIGFFDFENKIAFSGDVLFKDSIGRTDLYLGNLDVLLNTIRTKM 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
             L D+   V GHGP++TIGRE++ NPFLK
Sbjct: 180 FDLDDDFIVVAGHGPHTTIGREKQHNPFLK 209


>gi|165975579|ref|YP_001651172.1| glyoxalase II family protein [Actinobacillus pleuropneumoniae
           serovar 3 str. JL03]
 gi|165875680|gb|ABY68728.1| glyoxalase II family protein [Actinobacillus pleuropneumoniae
           serovar 3 str. JL03]
          Length = 209

 Score =  161 bits (408), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 77/210 (36%), Positives = 126/210 (60%), Gaps = 2/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
            +  I+ V+ F+QNC+ ++D+    A ++D G D D I   ++S+N  V+++ +THGH+D
Sbjct: 2   FNLQIIPVSAFQQNCSVIWDDNK-NAAIIDAGDDADKIIQFVESQNLKVQKLLLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+    ++++   + + G H DD  +  ++ +   +  I    +    D WL + D + +
Sbjct: 61  HIMAVEKVRDHFGVEVYGSHIDDKPLFEQLPQMCEMFGIP-PVKAFLPDHWLSEDDRVEV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   F V H PGH+PGH+ + +FEN  A  GD LF+ SIGRTD+  G+   L+N+I  K+
Sbjct: 120 GALRFSVRHLPGHAPGHIGFFDFENKIAFSGDVLFKDSIGRTDLYLGNLDVLLNTICTKM 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
             L D+   V GHGP++TIGRE++ NPFLK
Sbjct: 180 FDLDDDFIVVAGHGPHTTIGREKQHNPFLK 209


>gi|167855602|ref|ZP_02478362.1| glyoxalase II family protein [Haemophilus parasuis 29755]
 gi|167853293|gb|EDS24547.1| glyoxalase II family protein [Haemophilus parasuis 29755]
          Length = 209

 Score =  161 bits (407), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 79/211 (37%), Positives = 130/211 (61%), Gaps = 4/211 (1%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
            +  I+ V+ F+QNC+ ++D E   AV++D G D D I   ++ +  +V+++ ITHGH+D
Sbjct: 2   FNLQIIPVSVFQQNCSVVWDNEK-NAVIIDAGDDADKIIRFVEEQQLNVQKLLITHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNAS-SDRWLQDGDTLL 122
           H+    QL++  ++ + G H++D  +  ++    +  S  + A  A   D WL  GD + 
Sbjct: 61  HIMAVDQLRKHFNVDVFGSHQNDQPLFEQLPNICQ--SYGLPASPAFLPDHWLNAGDKIQ 118

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
           +G   F + H PGHSPGH+ + +FEN  A  GD LF+ SIGRTD+  G+++QLI +I  +
Sbjct: 119 IGALTFHIRHLPGHSPGHIGFFDFENKIAFSGDVLFKDSIGRTDLYQGNFEQLIYTIKTQ 178

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           +  L D+   + GHG ++T+GRE++ NPFLK
Sbjct: 179 LFDLEDDFIIIPGHGSHTTVGREKQHNPFLK 209


>gi|126640460|ref|YP_001083444.1| hypothetical protein A1S_0383 [Acinetobacter baumannii ATCC 17978]
          Length = 186

 Score =  159 bits (403), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 72/185 (38%), Positives = 111/185 (60%), Gaps = 1/185 (0%)

Query: 31  VVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLKEDLSLTIIGPHKDDAAMM 90
           ++D GGD  ++K  +++    VK +W+THGH+DH G   +L ++ S+ ++GPHK+D   +
Sbjct: 1   MIDAGGDAAVLKKEVEALGLKVKALWLTHGHLDHAGAVGELAKEWSVPVVGPHKEDQFWL 60

Query: 91  GKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFKVFHCPGHSPGHVIYVNFENNF 150
             + E +      +  +    D+WL+ G+ L LG   F+V   PGH+PGHV++ N  +  
Sbjct: 61  DMIQEVSARYGFPI-PQPVKVDQWLEGGEVLKLGEDEFEVRFAPGHTPGHVMFYNKNHGL 119

Query: 151 AHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEISFVCGHGPNSTIGRERRLNP 210
              GD LF+ SIGRTD   G+++QLI SI  +   L DE  F+ GHGP STIG E++ NP
Sbjct: 120 LWTGDVLFKGSIGRTDFPRGNHEQLIESIQRECFSLPDETQFISGHGPMSTIGYEKQFNP 179

Query: 211 FLKSN 215
           F+   
Sbjct: 180 FVAGK 184


>gi|240948091|ref|ZP_04752501.1| glyoxalase II family protein [Actinobacillus minor NM305]
 gi|240297571|gb|EER48063.1| glyoxalase II family protein [Actinobacillus minor NM305]
          Length = 209

 Score =  158 bits (400), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 74/210 (35%), Positives = 124/210 (59%), Gaps = 2/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
            +  I+ V+PF+QNC+ ++D+    A ++D G + D I   ++ +  HV+++ ITH H+D
Sbjct: 2   FNLQIIPVSPFQQNCSVIWDDNK-NAAIIDAGDNADRIIQFVEQQELHVEKLLITHAHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+     +++     + G H  D  +  ++ +      +    +    D WL +GD + +
Sbjct: 61  HIMAVETVRDHFGAQVYGSHLADKPLFEQLPQMCEKFGLP-PVQGFLPDHWLTEGDEVTV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           GT  F + H PGH+PGH+ + +FEN  A  GD LF+ SIGRTD+  G+++QLI++I  K+
Sbjct: 120 GTLKFNIRHLPGHAPGHIGFFDFENKIAFSGDVLFKDSIGRTDLYLGNFEQLIDTIKTKM 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
             L D+   + GHG ++TIGRE+  NPFLK
Sbjct: 180 FDLEDDFIIIPGHGAHTTIGREKAHNPFLK 209


>gi|219872272|ref|YP_002476647.1| glyoxalase II family protein [Haemophilus parasuis SH0165]
 gi|219692476|gb|ACL33699.1| glyoxalase II family protein [Haemophilus parasuis SH0165]
          Length = 209

 Score =  157 bits (398), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 77/211 (36%), Positives = 130/211 (61%), Gaps = 4/211 (1%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
            +  I+ V+ F+QNC+ ++D E   AV++D G D D I   ++ +  +V+++ ITHGH+D
Sbjct: 2   FNLQIIPVSVFQQNCSVVWDNEK-NAVIIDAGDDADKIIRFVEEQQLNVQKLLITHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNAS-SDRWLQDGDTLL 122
           H+    +L++  ++ + G H++D  +  ++    +  S  + A  A   D WL  GD + 
Sbjct: 61  HIMAVDRLRKHFNVDVFGSHQNDQPLFEQLPNICQ--SYGLPASPAFLPDHWLNAGDKIQ 118

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
           +G   F + + PGHSPGH+ + +FEN  A  GD LF+ SIGRTD+  G+++QLI +I  +
Sbjct: 119 IGALTFHIRYLPGHSPGHIGFFDFENKIAFSGDVLFKDSIGRTDLYQGNFEQLIYTIKTQ 178

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           +  L D+   + GHG ++T+GRE++ NPFLK
Sbjct: 179 LFDLEDDFIIIPGHGSHTTVGREKQHNPFLK 209


>gi|218781796|ref|YP_002433114.1| beta-lactamase domain protein [Desulfatibacillum alkenivorans
           AK-01]
 gi|218763180|gb|ACL05646.1| beta-lactamase domain protein [Desulfatibacillum alkenivorans
           AK-01]
          Length = 206

 Score =  157 bits (397), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 83/205 (40%), Positives = 118/205 (57%), Gaps = 4/205 (1%)

Query: 9   VQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGA 68
           + V P + NC  +  E++ +AVV+DPGG+ D I   + +    +  I  THGH DHV G 
Sbjct: 6   LAVGPLQANCFIVGCEKTNQAVVIDPGGEADKILMSLANHKLTLTAILNTHGHFDHVEGN 65

Query: 69  AQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIF 128
             LK+     I   H++DA M+  V   A    ++M   +  +D++L++GD + +G    
Sbjct: 66  KGLKDATGCDIY-IHEEDAPMLQMVSSLASSFGLQMQ-NSPPADKFLKEGDVITVGEESL 123

Query: 129 KVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGD 188
           KV H PGHSPG V +    +    +GDTLF  SIGRTD+  G Y QLI S+ +KI PLGD
Sbjct: 124 KVLHTPGHSPGGVSFC--ADGVVFVGDTLFAGSIGRTDLPGGSYNQLIASVKDKIFPLGD 181

Query: 189 EISFVCGHGPNSTIGRERRLNPFLK 213
           E     GHGP +T+GRE+  NPF +
Sbjct: 182 ECVVCAGHGPETTVGREKMYNPFFQ 206


>gi|322515094|ref|ZP_08068101.1| metallo-beta-lactamase [Actinobacillus ureae ATCC 25976]
 gi|322118900|gb|EFX91082.1| metallo-beta-lactamase [Actinobacillus ureae ATCC 25976]
          Length = 209

 Score =  157 bits (396), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 74/210 (35%), Positives = 123/210 (58%), Gaps = 2/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
            +  I+ V+ F+QNC+ ++D+    A ++D G   D I   ++ +N  V+++ +THGH+D
Sbjct: 2   FNLQIIPVSAFQQNCSIIWDDNK-NAAIIDAGDSADKIIQFVELQNLKVRKLLLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+    ++++   + + G H DD  +  ++ +   +  +    +    D WL +GD + +
Sbjct: 61  HIMAVEKVRDHFGVEVYGSHIDDKPLFEQLPQMCEMFGLP-PVKAFLPDHWLNEGDVVEV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   F V H PGH+PGH+ + +FEN  A  GD LF+ SIGRTD+  G    L+++I  K+
Sbjct: 120 GALRFSVRHLPGHAPGHIGFFDFENKIAFSGDVLFKDSIGRTDLYLGSLDVLLDTIRTKM 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
             L D+   V GHGP++TIGRE+  NPFLK
Sbjct: 180 FDLYDDFIVVAGHGPHTTIGREKLHNPFLK 209


>gi|33152156|ref|NP_873509.1| glyoxalase II family protein [Haemophilus ducreyi 35000HP]
 gi|33148378|gb|AAP95898.1| glyoxalase II family protein [Haemophilus ducreyi 35000HP]
          Length = 209

 Score =  156 bits (394), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 72/210 (34%), Positives = 126/210 (60%), Gaps = 2/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
            +  I+ V+PF+QNC  ++D++   AV++D G +   I   ++S++  ++++ ITH H+D
Sbjct: 2   FNLQIIPVSPFQQNCCVIWDKDK-NAVIIDAGDEAGKIIQFVESQDLKLQKLLITHAHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+    ++++   + + G H DD  +  ++ +   +  + +  ++   D WL DGD + +
Sbjct: 61  HIMAVEKVRDHFGVEVYGSHIDDKPLFEQLPQMCEMFGM-LPVKSFLPDHWLADGDVVQV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   F V H PGH+PGHV + +F+N     GD LF+ SIGRTD+  G+   L+ SI +KI
Sbjct: 120 GALTFNVRHLPGHAPGHVGFFDFDNKIIFSGDVLFKDSIGRTDLYMGNLAVLLASIRSKI 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
             L D+   V GHG ++T+GRE+  +PF+K
Sbjct: 180 FDLPDDFIIVAGHGSHTTVGREKMYHPFVK 209


>gi|257465086|ref|ZP_05629457.1| glyoxalase II family protein [Actinobacillus minor 202]
 gi|257450746|gb|EEV24789.1| glyoxalase II family protein [Actinobacillus minor 202]
          Length = 209

 Score =  153 bits (387), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 71/210 (33%), Positives = 124/210 (59%), Gaps = 2/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
            +  I+ V+PF+QNC+ ++D+    A ++D G + + I   ++ +  +V+++ ITH H+D
Sbjct: 2   FNLQIIPVSPFQQNCSVIWDDNK-NAAIIDAGDNAERIIQFVEQQELNVEKLLITHAHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+     +++   + + G H  D  +  ++ +      +    +    D WL +GD + +
Sbjct: 61  HIMAVESVRDHFGVPVYGSHLADKPLFEQLPQMCEKFGLP-PVKGFLPDHWLTEGDEVTV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   F + H PGH+PGH+ + +FEN  A  GD LF+ SIGRTD+  G+++QLI++I  K+
Sbjct: 120 GALKFNIRHLPGHAPGHIGFFDFENKIAFSGDVLFKDSIGRTDLYLGNFEQLIDTIKTKM 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
             L D+   + GHG ++TIGRE+  NPFLK
Sbjct: 180 FDLEDDFIIIPGHGAHTTIGREKVHNPFLK 209


>gi|317052051|ref|YP_004113167.1| beta-lactamase domain-containing protein [Desulfurispirillum
           indicum S5]
 gi|316947135|gb|ADU66611.1| beta-lactamase domain protein [Desulfurispirillum indicum S5]
          Length = 244

 Score =  153 bits (387), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 80/210 (38%), Positives = 115/210 (54%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L +H+  V P + NC  LF+  S +AVV+DPGGD + I   +   +   +    THGH D
Sbjct: 34  LQYHVFAVGPLEANCAVLFESPSGDAVVIDPGGDANTITRFLDEHHLTPRYFLHTHGHFD 93

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG  + LK+         H+ D  +    D+ A+L  ++     A+ D +L    +L L
Sbjct: 94  HVGALSALKKKYPDATYLIHQQDETLAMHADKTAQLYGLQALPATAA-DAYLSAETSLQL 152

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V   PGH+PG V +   E N    GDTLF+ SIGRTD+  G+Y QLI+SI  K+
Sbjct: 153 GASQITVIETPGHTPGGVCFYLNEENLLFSGDTLFQGSIGRTDLPGGNYDQLIHSIRTKL 212

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
             L DE+  + GHGP ++IG E++ NPF +
Sbjct: 213 FGLPDEVVVIPGHGPRTSIGAEKKHNPFFR 242


>gi|213420564|ref|ZP_03353630.1| hypothetical protein Salmonentericaenterica_23585 [Salmonella
           enterica subsp. enterica serovar Typhi str. E01-6750]
          Length = 167

 Score =  152 bits (385), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 68/165 (41%), Positives = 108/165 (65%), Gaps = 1/165 (0%)

Query: 52  VKQIWITHGHVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASS 111
           + QI +THGH+DHVG A++L +   + +IGP K+D   +  +  Q+R+  +    +  + 
Sbjct: 1   MMQILLTHGHLDHVGAASELAQHYGVPVIGPEKEDEFWLQGLPAQSRMFGLD-ECQPLTP 59

Query: 112 DRWLQDGDTLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGD 171
           DRWL DGD + +G    +V HCPGH+PGHV++ + ++     GD +F+  +GR+D   GD
Sbjct: 60  DRWLNDGDRVSVGNVTLQVLHCPGHTPGHVVFFDEQSQLLISGDVIFKGGVGRSDFPRGD 119

Query: 172 YQQLINSINNKILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           + QLI++I  K+LPLGD+++F+ GHGP ST+G ER  N FL+  +
Sbjct: 120 HTQLIDAIKRKLLPLGDDVTFIPGHGPLSTLGYERLHNSFLQDEM 164


>gi|158522083|ref|YP_001529953.1| beta-lactamase domain-containing protein [Desulfococcus oleovorans
           Hxd3]
 gi|158510909|gb|ABW67876.1| beta-lactamase domain protein [Desulfococcus oleovorans Hxd3]
          Length = 210

 Score =  152 bits (383), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 82/203 (40%), Positives = 115/203 (56%), Gaps = 4/203 (1%)

Query: 9   VQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGA 68
           ++V     NC  +  +++ +AVV+DPG + D I   +      VK I  THGH DHVG  
Sbjct: 8   LEVGMIMANCFIVGCDQTKQAVVIDPGDEADRILYHLAENKLSVKYIINTHGHFDHVGAN 67

Query: 69  AQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIF 128
            +LK+     ++  H  DA M+  + + A    I     +   DR +++GD +  GT   
Sbjct: 68  KELKKATGAELL-IHAADAPMLSGLSQMASAFGIAAE-NSPPPDRTVKEGDVISFGTIEM 125

Query: 129 KVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGD 188
           KV H PGHSPG +  V  +  F  +GDTLF  SIGRTD   GD+  LI++I  K+ PLGD
Sbjct: 126 KVLHTPGHSPGGISLVTDKKAF--VGDTLFAGSIGRTDFPGGDFDTLISAIQTKLFPLGD 183

Query: 189 EISFVCGHGPNSTIGRERRLNPF 211
           +++  CGHGP +TIG ERR NPF
Sbjct: 184 DVTVYCGHGPETTIGMERRTNPF 206


>gi|32490874|ref|NP_871128.1| hypothetical protein WGLp125 [Wigglesworthia glossinidia
           endosymbiont of Glossina brevipalpis]
 gi|25166080|dbj|BAC24271.1| ycbL [Wigglesworthia glossinidia endosymbiont of Glossina
           brevipalpis]
          Length = 214

 Score =  151 bits (382), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 82/212 (38%), Positives = 122/212 (57%), Gaps = 2/212 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L+F    VT FK+NC  ++   +  A++ DPGGD   I++ ++  N  +K+I ITHGH+D
Sbjct: 3   LNFKSEIVTSFKENCYIIWSSNNRNAILCDPGGDPKKIENSVKKLNVLIKKIIITHGHID 62

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG A  L +   + I+GPH  D  ++  +  Q+ + ++    ++   + W+ DGD + L
Sbjct: 63  HVGAAFILSKLYKVPILGPHIFDNFLIENLSHQSYMFNVFPEIKSFKPNVWVNDGDIIKL 122

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
            +H FKV HCPGHSPGHV + N   N    GD LF + IGR D+  GD  ++I SI NKI
Sbjct: 123 DSHEFKVIHCPGHSPGHVAFWNKNQNILLSGDILFNNGIGRIDLPGGDKNKIIGSIKNKI 182

Query: 184 LPLGDE-ISFVCGHGPNSTIGRERRLNPFLKS 214
           L L  + I  + GHG  S     + +N  LK+
Sbjct: 183 LKLCKKNIMLLPGHG-ESFFVNPKNINVLLKN 213


>gi|251778952|ref|ZP_04821872.1| metallo-beta-lactamase family protein [Clostridium botulinum E1
           str. 'BoNT E Beluga']
 gi|243083267|gb|EES49157.1| metallo-beta-lactamase family protein [Clostridium botulinum E1
           str. 'BoNT E Beluga']
          Length = 200

 Score =  151 bits (381), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 81/208 (38%), Positives = 120/208 (57%), Gaps = 14/208 (6%)

Query: 8   IVQVTP---FKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDH 64
           I++  P   ++ NC  + DE + E  ++DPGGD   +K +I S N  VK I +THGH+DH
Sbjct: 2   IIKTIPAGMYEANCYLVIDENTKECGIIDPGGDAKRLKSIIDSLNVDVKYILLTHGHMDH 61

Query: 65  VGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLG 124
           VGG  +L E   +            + K+DE+       +      +  +LQ+GDT+ LG
Sbjct: 62  VGGVVELSEAFKIPF---------YISKIDEEYMEKDNFVFGTLPKASGYLQEGDTIKLG 112

Query: 125 THIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKIL 184
              FKV   PGH+ G + ++  +  F   GDTLF++SIGRTD + G+++++I SI  K+L
Sbjct: 113 NKEFKVIETPGHTKGGLCFLIEDKLFT--GDTLFQASIGRTDFVGGNFEEIIKSIKEKLL 170

Query: 185 PLGDEISFVCGHGPNSTIGRERRLNPFL 212
            LGD+I    GHGP STIG E++ N FL
Sbjct: 171 ILGDDIEVYPGHGPMSTIGYEKKKNSFL 198


>gi|113461217|ref|YP_719286.1| glyoxalase II family protein [Haemophilus somnus 129PT]
 gi|112823260|gb|ABI25349.1| conserved hypothetical protein [Haemophilus somnus 129PT]
          Length = 210

 Score =  151 bits (381), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 75/211 (35%), Positives = 128/211 (60%), Gaps = 2/211 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           ++  IV VT F+QNC+ ++D     A ++DPGG+   +   I+    +++ I +THGH+D
Sbjct: 1   MNIEIVPVTAFQQNCSIIWDNNK-NAAIIDPGGEATKLIKRIEELCLNLELILLTHGHID 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWL-QDGDTLL 122
           HVG A +LK+  ++ I G ++ D  +   + +Q+    +         DRWL Q+ + + 
Sbjct: 60  HVGAALKLKQYFNVEIWGSNEKDDFLFNSLPQQSEQFGLLFETEVFKPDRWLNQEYEIVR 119

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
           +G   F+V H PGH+PGHV ++ +    A  GD LF++SIGRTD   G++ +LI SI +K
Sbjct: 120 IGEMNFEVLHLPGHTPGHVGFIEYSKKIAFTGDVLFQNSIGRTDFPRGNHAELIQSIRDK 179

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           +  L D++  + GHG  +TIG+E++ NP+++
Sbjct: 180 LWKLDDDMIIIAGHGNYTTIGKEKKYNPYIR 210


>gi|170717817|ref|YP_001784879.1| beta-lactamase domain-containing protein [Haemophilus somnus 2336]
 gi|168825946|gb|ACA31317.1| beta-lactamase domain protein [Haemophilus somnus 2336]
          Length = 210

 Score =  150 bits (380), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 75/211 (35%), Positives = 128/211 (60%), Gaps = 2/211 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           ++  IV VT F+QNC+ ++D     A ++DPGG+   +   I+    +++ I +THGH+D
Sbjct: 1   MNIEIVPVTAFQQNCSIIWDNNK-SAAIIDPGGEATKLIKRIEELGLNLELILLTHGHID 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWL-QDGDTLL 122
           HVG A +LK+  ++ I G ++ D  +   + +Q+    +         DRWL Q+ + + 
Sbjct: 60  HVGAALKLKQYFNVEIWGSNEKDDFLFNSLPQQSEQFGLLFETEVFKPDRWLNQEYEIVR 119

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
           +G   F+V H PGH+PGHV ++ +    A  GD LF++SIGRTD   G++ +LI SI +K
Sbjct: 120 IGEMNFEVLHLPGHTPGHVGFIEYSKKIAFTGDVLFQNSIGRTDFPRGNHTELIQSIRDK 179

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           +  L D++  + GHG  +TIG+E++ NP+++
Sbjct: 180 LWKLDDDMIIISGHGNYTTIGKEKKYNPYIR 210


>gi|328953986|ref|YP_004371320.1| beta-lactamase domain protein [Desulfobacca acetoxidans DSM 11109]
 gi|328454310|gb|AEB10139.1| beta-lactamase domain protein [Desulfobacca acetoxidans DSM 11109]
          Length = 207

 Score =  150 bits (380), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 86/205 (41%), Positives = 112/205 (54%), Gaps = 2/205 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           ++ V   + NC  L DE + EAVV+DPGGD   I  V+Q  N  +K I  THGH DHVG 
Sbjct: 5   VMSVGMLESNCYILGDELTREAVVIDPGGDGPDILAVLQQENLKLKIIINTHGHFDHVGA 64

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
             +LKE     I   H  DA M+ +   +A L       R + +D  L++ D L  G + 
Sbjct: 65  NQELKEATGAPI-AIHTADADMLNQPSAEA-LFFTGGRLRPSQADILLKEDDILEFGEYQ 122

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
            KV H PGH+ G +  V       ++GDTLF  SIGRTD   G Y  LI S+  KI PLG
Sbjct: 123 LKVLHTPGHTVGGICLVLQNEPIVYVGDTLFAGSIGRTDFPGGSYNDLIASVRTKIFPLG 182

Query: 188 DEISFVCGHGPNSTIGRERRLNPFL 212
           D    + GHGP +T+G+ER+ NPF 
Sbjct: 183 DHYLVMPGHGPATTVGQERQYNPFF 207


>gi|225872105|ref|YP_002753560.1| metallo-beta-lactamase family protein [Acidobacterium capsulatum
           ATCC 51196]
 gi|225791351|gb|ACO31441.1| metallo-beta-lactamase family protein [Acidobacterium capsulatum
           ATCC 51196]
          Length = 208

 Score =  150 bits (380), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 81/200 (40%), Positives = 119/200 (59%), Gaps = 2/200 (1%)

Query: 14  FKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLKE 73
            + NCT + DE S EA+V+DPG ++  I   +++    +KQI +TH H+DHVGGA  LK 
Sbjct: 11  LQCNCTLIGDETSHEAMVIDPGDNIPQILARLKAHGLVLKQIVVTHAHIDHVGGALALKR 70

Query: 74  DLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFKVFHC 133
                I+  + +D  ++  +D QA  L I      A  D   + G  + L  H  +V H 
Sbjct: 71  ATGAPILL-NANDLPLLKMMDVQAGWLGIE-PPEVAPPDASAEHGMIVGLAAHPAEVLHT 128

Query: 134 PGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEISFV 193
           PGH+PG +  +  ++N    GDTLF  SIGRTD+  GD +Q++ SI++++LPL D++  V
Sbjct: 129 PGHTPGSICLLFKKDNLLLAGDTLFAGSIGRTDLPGGDSEQILRSIHDRLLPLPDDLRVV 188

Query: 194 CGHGPNSTIGRERRLNPFLK 213
            GHGP +TIG ER  NPFL+
Sbjct: 189 PGHGPVTTIGEERESNPFLR 208


>gi|188590675|ref|YP_001920362.1| metallo-beta-lactamase family protein [Clostridium botulinum E3
           str. Alaska E43]
 gi|188500956|gb|ACD54092.1| metallo-beta-lactamase family protein [Clostridium botulinum E3
           str. Alaska E43]
          Length = 200

 Score =  150 bits (379), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 81/208 (38%), Positives = 119/208 (57%), Gaps = 14/208 (6%)

Query: 8   IVQVTP---FKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDH 64
           I++  P   ++ NC  + DE + E  ++DPGGD + +K +I S N  VK I +THGH+DH
Sbjct: 2   IIKTIPAGMYEANCYLVIDENTKECGIIDPGGDAERLKSIIDSLNVDVKYILLTHGHMDH 61

Query: 65  VGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLG 124
           VGG  +L E   +            + K+DE+       +      +  +LQ+GDT+ LG
Sbjct: 62  VGGVVELSEAFKIPF---------YINKIDEEYMEKDNFVFGTLPKASGYLQEGDTIKLG 112

Query: 125 THIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKIL 184
              FKV   PGH+ G + +  F  +    GDTLF++SIGRTD   G+++++I SI  K+L
Sbjct: 113 NKEFKVIETPGHTKGGLCF--FIEDKLFTGDTLFQASIGRTDFAGGNFEEIIKSIKEKLL 170

Query: 185 PLGDEISFVCGHGPNSTIGRERRLNPFL 212
            LGD+I    GHGP STIG E++ N FL
Sbjct: 171 ILGDDIEVYPGHGPMSTIGYEKKRNSFL 198


>gi|308272929|emb|CBX29533.1| Uncharacterized protein aq_2135 [uncultured Desulfobacterium sp.]
          Length = 208

 Score =  149 bits (376), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 83/203 (40%), Positives = 114/203 (56%), Gaps = 4/203 (1%)

Query: 11  VTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQ 70
           V P   NC  +  E + EAVV+DPG + D I  VI      VK I  THGHVDHVGG  +
Sbjct: 8   VGPIMSNCFVVGCENTKEAVVIDPGDEPDKILMVIAKHKLKVKYIINTHGHVDHVGGNKK 67

Query: 71  LKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFKV 130
           LKE     ++  H  DA M+ ++        + +   +   D+ L+DGD +  G    KV
Sbjct: 68  LKEATGADLL-IHSLDAPMLSRIAATGAAWGLNVE-DSPPPDQMLKDGDEVKFGDITLKV 125

Query: 131 FHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEI 190
            H PGHSPG +    + ++   +GDTLF  SIGRTD   GDY  +I+SI NK+  LGD++
Sbjct: 126 IHTPGHSPGGISL--YTDDCVFVGDTLFAGSIGRTDFPGGDYDTIISSIRNKLFVLGDDV 183

Query: 191 SFVCGHGPNSTIGRERRLNPFLK 213
             + GHGP ++I  E++ NPF K
Sbjct: 184 RVLAGHGPETSIAIEKKYNPFAK 206


>gi|326390130|ref|ZP_08211691.1| beta-lactamase domain-containing protein [Thermoanaerobacter
           ethanolicus JW 200]
 gi|325993778|gb|EGD52209.1| beta-lactamase domain-containing protein [Thermoanaerobacter
           ethanolicus JW 200]
          Length = 210

 Score =  147 bits (372), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 83/201 (41%), Positives = 119/201 (59%), Gaps = 6/201 (2%)

Query: 14  FKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLKE 73
           +  NC  + DEE  EA+V+DPG     I+D I + N +VK I +THGH DH+GG  +LK+
Sbjct: 11  YGANCYIVSDEEEREAIVIDPGEYSSEIQDYIITNNLNVKYILLTHGHFDHIGGVEELKK 70

Query: 74  DLSLTIIGPHKDDAAMMGKVDEQARLLS-IRMNARNASSDRWLQDGDTLLLGTHIFKVFH 132
            L+   +   K+DA M+  +D    L   +        +D  L DGDTL  G +  +V +
Sbjct: 71  -LTQARVAISKEDAPML--LDPSLNLSEMVYKKILCNPADILLSDGDTLTFGKYSVEVIY 127

Query: 133 CPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEISF 192
            PGH+ G V +    NN    GD LF+ SIGR D   GD+  L++SI NK+L LG++++ 
Sbjct: 128 TPGHTKGGVCFKI--NNVCFTGDILFKGSIGRYDFPGGDFSTLMDSIKNKLLVLGNDVTI 185

Query: 193 VCGHGPNSTIGRERRLNPFLK 213
             GHG +STIG+E+RLN FL+
Sbjct: 186 YPGHGDSSTIGKEKRLNMFLR 206


>gi|197118053|ref|YP_002138480.1| zinc-dependent hydrolase YcbL, metallo-beta-lactamase superfamily
           [Geobacter bemidjiensis Bem]
 gi|197087413|gb|ACH38684.1| zinc-dependent hydrolase YcbL, metallo-beta-lactamase superfamily
           [Geobacter bemidjiensis Bem]
          Length = 209

 Score =  147 bits (371), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 80/207 (38%), Positives = 114/207 (55%), Gaps = 2/207 (0%)

Query: 6   FHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHV 65
           F  + V     NC  L D++S E VVVDPG D ++I D I      VK I  THGH DHV
Sbjct: 3   FETIVVGALGVNCFILGDKQSNEGVVVDPGADFELIADAIARFGIKVKYIINTHGHFDHV 62

Query: 66  GGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGT 125
           G    ++E     ++  H+ D  ++    + A+   ++  A  A + R+L+DG  L  G 
Sbjct: 63  GCNRSVQEKTGAELL-IHQGDQTLLELAAKSAQKYGLKAEASPAPT-RFLEDGMKLEFGK 120

Query: 126 HIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILP 185
              +V H PGH+ G    +         GDTLF  S+GRTD+  G ++QL+ SI  K++P
Sbjct: 121 RTIEVLHTPGHTQGGCCLLLAHEKLVITGDTLFADSVGRTDLPGGSHEQLMASIKAKLMP 180

Query: 186 LGDEISFVCGHGPNSTIGRERRLNPFL 212
           L D+ +   GHGP+STIGRERR NP++
Sbjct: 181 LPDDTTVWPGHGPSSTIGRERRSNPYI 207


>gi|307266553|ref|ZP_07548085.1| beta-lactamase domain-containing protein [Thermoanaerobacter
           wiegelii Rt8.B1]
 gi|306918407|gb|EFN48649.1| beta-lactamase domain-containing protein [Thermoanaerobacter
           wiegelii Rt8.B1]
          Length = 210

 Score =  147 bits (371), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 83/201 (41%), Positives = 119/201 (59%), Gaps = 6/201 (2%)

Query: 14  FKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLKE 73
           +  NC  + DEE  EA+V+DPG     I+D I + N +VK I +THGH DH+GG  +LK+
Sbjct: 11  YGANCYIVSDEEESEAIVIDPGEYSSEIQDYIITNNLNVKYILLTHGHFDHIGGVEELKK 70

Query: 74  DLSLTIIGPHKDDAAMMGKVDEQARLLS-IRMNARNASSDRWLQDGDTLLLGTHIFKVFH 132
            L+   +   K+DA M+  +D    L   +        +D  L DGDTL  G +  +V +
Sbjct: 71  -LTQARVAISKEDAPML--LDPSLNLSEMVYKRILCNPADILLSDGDTLTFGKYSVEVIY 127

Query: 133 CPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEISF 192
            PGH+ G V +    NN    GD LF+ SIGR D   GD+  L++SI NK+L LG++++ 
Sbjct: 128 TPGHTKGGVCFKI--NNVCFTGDILFKGSIGRYDFPGGDFSTLMDSIKNKLLVLGNDVTI 185

Query: 193 VCGHGPNSTIGRERRLNPFLK 213
             GHG +STIG+E+RLN FL+
Sbjct: 186 YPGHGDSSTIGKEKRLNMFLR 206


>gi|167040108|ref|YP_001663093.1| beta-lactamase domain-containing protein [Thermoanaerobacter sp.
           X514]
 gi|300914193|ref|ZP_07131509.1| beta-lactamase domain-containing protein [Thermoanaerobacter sp.
           X561]
 gi|307724572|ref|YP_003904323.1| beta-lactamase domain-containing protein [Thermoanaerobacter sp.
           X513]
 gi|166854348|gb|ABY92757.1| beta-lactamase domain protein [Thermoanaerobacter sp. X514]
 gi|300889128|gb|EFK84274.1| beta-lactamase domain-containing protein [Thermoanaerobacter sp.
           X561]
 gi|307581633|gb|ADN55032.1| beta-lactamase domain protein [Thermoanaerobacter sp. X513]
          Length = 210

 Score =  147 bits (370), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 83/201 (41%), Positives = 119/201 (59%), Gaps = 6/201 (2%)

Query: 14  FKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLKE 73
           +  NC  + DEE  EA+V+DPG     I+D I + N +VK I +THGH DH+GG  +LK+
Sbjct: 11  YGANCYIVSDEEEREAIVIDPGEYSSEIQDYIVTNNLNVKYILLTHGHFDHIGGVEELKK 70

Query: 74  DLSLTIIGPHKDDAAMMGKVDEQARLLS-IRMNARNASSDRWLQDGDTLLLGTHIFKVFH 132
            L+   +   K+DA M+  +D    L   +        +D  L DGDTL  G +  ++ H
Sbjct: 71  -LTQASVAISKEDAPML--LDPSLNLSEMVYKKILCNPADILLSDGDTLYFGKYKVEILH 127

Query: 133 CPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEISF 192
            PGH+ G V +    +N    GDTLF+ SIGR D   GD+  L +SI NK+L LG++++ 
Sbjct: 128 TPGHTKGGVCFKI--DNVCFTGDTLFKDSIGRHDFPGGDFSTLRDSIKNKLLVLGNDVTI 185

Query: 193 VCGHGPNSTIGRERRLNPFLK 213
             GHG +STIG+E+RLN FL+
Sbjct: 186 YPGHGDSSTIGKEKRLNLFLR 206


>gi|134298603|ref|YP_001112099.1| beta-lactamase domain-containing protein [Desulfotomaculum reducens
           MI-1]
 gi|134051303|gb|ABO49274.1| beta-lactamase domain protein [Desulfotomaculum reducens MI-1]
          Length = 205

 Score =  147 bits (370), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 84/211 (39%), Positives = 121/211 (57%), Gaps = 8/211 (3%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +    + V  ++ NC  +  EE+ +AVVVDPG + + I++ ++  NF V+ I +THGH D
Sbjct: 1   MYIETLPVGSYEANCYIIGCEETRKAVVVDPGDEAERIQERLKKLNFKVEAIVLTHGHSD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNA--SSDRWLQDGDTL 121
           H+G    L+   +  ++  HKDDA M+      A+ LS  M        +DR L DGDT+
Sbjct: 61  HIGAVGDLQRATAAQVL-IHKDDAEML---INPAKNLSTWMGEHMVFNPADRLLVDGDTI 116

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
            +G    +V H PGH+PG +     ++ F+  GDTLF  SIGR+D   G +  LI SI +
Sbjct: 117 QIGNITLEVLHTPGHTPGGICLKAGKDLFS--GDTLFAQSIGRSDFPGGSHSTLIGSIKS 174

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           K+L L DE     GHGP STIG+E+R NPF 
Sbjct: 175 KLLVLSDETKVYPGHGPASTIGQEKRHNPFF 205


>gi|256752953|ref|ZP_05493780.1| beta-lactamase domain protein [Thermoanaerobacter ethanolicus
           CCSD1]
 gi|256748161|gb|EEU61238.1| beta-lactamase domain protein [Thermoanaerobacter ethanolicus
           CCSD1]
          Length = 210

 Score =  147 bits (370), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 83/201 (41%), Positives = 119/201 (59%), Gaps = 6/201 (2%)

Query: 14  FKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLKE 73
           +  NC  + DEE  EA+V+DPG     I+D I + N +VK I +THGH DH+GG  +LK+
Sbjct: 11  YGANCYIVSDEEEREAIVIDPGEYSSEIQDYIVTNNLNVKYILLTHGHFDHIGGVEELKK 70

Query: 74  DLSLTIIGPHKDDAAMMGKVDEQARLLS-IRMNARNASSDRWLQDGDTLLLGTHIFKVFH 132
            L+   +   K+DA M+  +D    L   +        +D  L DGDTL  G +  ++ H
Sbjct: 71  -LTQARVAISKEDAPML--LDPSLNLSEMVYKKILCNPADILLSDGDTLYFGKYKVEILH 127

Query: 133 CPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEISF 192
            PGH+ G V +    +N    GDTLF+ SIGR D   GD+  L +SI NK+L LG++++ 
Sbjct: 128 TPGHTKGGVCFKI--DNVCFTGDTLFKGSIGRHDFPGGDFSTLRDSIKNKLLVLGNDVTI 185

Query: 193 VCGHGPNSTIGRERRLNPFLK 213
             GHG +STIG+E+RLN FL+
Sbjct: 186 YPGHGDSSTIGKEKRLNLFLR 206


>gi|187934431|ref|YP_001885232.1| metallo-beta-lactamase family protein [Clostridium botulinum B str.
           Eklund 17B]
 gi|187722584|gb|ACD23805.1| metallo-beta-lactamase family protein [Clostridium botulinum B str.
           Eklund 17B]
          Length = 200

 Score =  146 bits (369), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 80/208 (38%), Positives = 117/208 (56%), Gaps = 14/208 (6%)

Query: 8   IVQVTP---FKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDH 64
           I++  P   ++ NC  + D+ + E  ++DPGGD + +K +I S    VK I +THGH+DH
Sbjct: 2   IIKTIPAGIYEANCYLVIDDNTKECGIIDPGGDAERLKSIINSLKVDVKYILLTHGHMDH 61

Query: 65  VGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLG 124
           VGG  +L E   +            + K+DE+       +      +  +LQ+GDT+ LG
Sbjct: 62  VGGVVELSEAFKVPF---------YINKIDEEYMEKDNFVFGTLPKASGYLQEGDTIKLG 112

Query: 125 THIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKIL 184
              FKV   PGH+ G + +  F  +    GDTLF+ SIGRTD   G+++++I SI  K+L
Sbjct: 113 DKEFKVIETPGHTKGGLCF--FIEDKLFTGDTLFQGSIGRTDFAGGNFEEIIKSIKEKLL 170

Query: 185 PLGDEISFVCGHGPNSTIGRERRLNPFL 212
            LGD+I    GHGP STIG E+R N FL
Sbjct: 171 ILGDDIEVYPGHGPVSTIGYEKRKNSFL 198


>gi|255526673|ref|ZP_05393578.1| beta-lactamase domain protein [Clostridium carboxidivorans P7]
 gi|296187178|ref|ZP_06855575.1| metallo-beta-lactamase domain protein [Clostridium carboxidivorans
           P7]
 gi|255509653|gb|EET85988.1| beta-lactamase domain protein [Clostridium carboxidivorans P7]
 gi|296048213|gb|EFG87650.1| metallo-beta-lactamase domain protein [Clostridium carboxidivorans
           P7]
          Length = 201

 Score =  146 bits (369), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 76/205 (37%), Positives = 117/205 (57%), Gaps = 22/205 (10%)

Query: 14  FKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLKE 73
           +  NC  + D+E+ + +V+DPGGD + +  +I+  N  VK I +THGH+DH G A  LK+
Sbjct: 13  YAANCYIVIDQETKDCIVMDPGGDEEDLIKIIKEENVQVKYILLTHGHLDHTGAAVSLKK 72

Query: 74  DLSLTIIGPHKD------DAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           +    I   ++D       A+M G +D                 D+++++GD   +G+  
Sbjct: 73  EFKAPICISNEDYKMISKGASMYGDIDNNV--------------DQFIKEGDIFKVGSME 118

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
            K  H PGH+PG + ++  ++ F   GDTLF  SIGRTD+  GD+  ++ +I  K++ L 
Sbjct: 119 IKCIHTPGHTPGSLCFLMGDSIFT--GDTLFAGSIGRTDLEAGDFNAIVKNIKEKLMILD 176

Query: 188 DEISFVCGHGPNSTIGRERRLNPFL 212
           DEI  + GHGP STIGRE+  NPFL
Sbjct: 177 DEIQVLPGHGPESTIGREKVHNPFL 201


>gi|323144699|ref|ZP_08079281.1| metallo-beta-lactamase domain protein [Succinatimonas hippei YIT
           12066]
 gi|322415516|gb|EFY06268.1| metallo-beta-lactamase domain protein [Succinatimonas hippei YIT
           12066]
          Length = 214

 Score =  146 bits (368), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 80/210 (38%), Positives = 115/210 (54%), Gaps = 3/210 (1%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L    +  T F QN   + DE    AVV DPGG+   +  ++ +    +K I +THGH+D
Sbjct: 2   LKIATIPTTAFAQNTRIIADENKHIAVVSDPGGNASDLYKILNTHELTLKVIILTHGHLD 61

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL-L 122
           HVGGAA+L       IIGP  +D+ ++  ++ QA L  +  +     S  +++D D L L
Sbjct: 62  HVGGAAELSRLTGAKIIGPSNEDSFLIESLNSQAELFGLSSSGDFTPS--YVKDNDVLKL 119

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
              + FKV   PGH+PG V Y   +  F   GD+LF  SIGR D    +   L+ S+  K
Sbjct: 120 FDDYEFKVITTPGHTPGGVCYFCEKAGFLLAGDSLFAGSIGRCDFPRSNMDDLLTSLKEK 179

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           IL L D+   + GHGP++TIGRE+  NP+L
Sbjct: 180 ILILPDDTKVLSGHGPDTTIGREKTDNPYL 209


>gi|110800702|ref|YP_696615.1| metallo-beta-lactamase family protein [Clostridium perfringens ATCC
           13124]
 gi|110675349|gb|ABG84336.1| metallo-beta-lactamase family protein [Clostridium perfringens ATCC
           13124]
          Length = 206

 Score =  145 bits (367), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 80/208 (38%), Positives = 119/208 (57%), Gaps = 12/208 (5%)

Query: 9   VQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGA 68
           + V  ++ NC  + DEE+ + ++VDPG +   I+ VI+S +   K I +THGH DHVG  
Sbjct: 6   IPVGMYQANCYVVIDEETKDCIIVDPGEEASRIESVIESLDAKPKMILLTHGHFDHVGAV 65

Query: 69  AQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLG-THI 127
            +L E   +      KD+  +   VD   +L           +D +L+DGDTL     + 
Sbjct: 66  QKLAEKYKIPFYIDKKDEDMIERNVDVFGKL---------PKADGYLKDGDTLKFSDNYE 116

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
            K    PGH+PG + ++   +N    GDTLFR SIGR+D   G++  L+ SIN+K++PLG
Sbjct: 117 IKCLETPGHTPGGLCFLI--DNCLFTGDTLFRESIGRSDFEGGNHSTLLKSINDKLVPLG 174

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLKSN 215
           D+I+   GHGP+STI  ER+ NPFL  +
Sbjct: 175 DDIAVYPGHGPSSTIKHERQRNPFLAGD 202


>gi|168204881|ref|ZP_02630886.1| metallo-beta-lactamase family protein [Clostridium perfringens E
           str. JGS1987]
 gi|170663698|gb|EDT16381.1| metallo-beta-lactamase family protein [Clostridium perfringens E
           str. JGS1987]
          Length = 206

 Score =  145 bits (366), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 80/208 (38%), Positives = 119/208 (57%), Gaps = 12/208 (5%)

Query: 9   VQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGA 68
           + V  ++ NC  + DEE+ + ++VDPG +   I+ VI+S +   K I +THGH DHVG  
Sbjct: 6   IPVGMYQANCYVVIDEETKDCIIVDPGEEASRIESVIESLDAKPKMILLTHGHFDHVGAV 65

Query: 69  AQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLG-THI 127
            +L E   +      KD+  +   VD   +L           +D +L+DGDTL     + 
Sbjct: 66  QKLAEKYKIPFYIDKKDEDMIERNVDVFGKL---------PKADGYLKDGDTLKFSDNYE 116

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
            K    PGH+PG + ++   +N    GDTLFR SIGR+D   G++  L+ SIN+K++PLG
Sbjct: 117 IKCLETPGHTPGGLCFLI--DNCLFTGDTLFRESIGRSDFEGGNHATLLKSINDKLVPLG 174

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLKSN 215
           D+I+   GHGP+STI  ER+ NPFL  +
Sbjct: 175 DDIAVYPGHGPSSTIKHERQRNPFLAGD 202


>gi|169343636|ref|ZP_02864635.1| metallo-beta-lactamase family protein [Clostridium perfringens C
           str. JGS1495]
 gi|169298196|gb|EDS80286.1| metallo-beta-lactamase family protein [Clostridium perfringens C
           str. JGS1495]
          Length = 206

 Score =  145 bits (366), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 80/208 (38%), Positives = 120/208 (57%), Gaps = 12/208 (5%)

Query: 9   VQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGA 68
           + V  ++ NC  + DEE+ + ++VDPG +   I++VI+S +   K I +THGH DHVG  
Sbjct: 6   IPVGMYQANCYVVIDEETKDCIMVDPGEEASRIENVIESLDAKPKMILLTHGHFDHVGAV 65

Query: 69  AQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLG-THI 127
            +L E   +      KD+  +   VD   +L           +D +L+DGDTL     + 
Sbjct: 66  QKLAEKYKIPFYIDKKDEDMIERNVDVFGKL---------PKADGYLKDGDTLKFSDNYE 116

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
            K    PGH+PG + ++   +N    GDTLFR SIGR+D   G++  L+ SIN+K++PLG
Sbjct: 117 IKCLETPGHTPGGLCFLI--DNCLFTGDTLFRESIGRSDFEGGNHATLLKSINDKLVPLG 174

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLKSN 215
           D+I+   GHGP+STI  ER+ NPFL  +
Sbjct: 175 DDIAVYPGHGPSSTIKHERQRNPFLAGD 202


>gi|322435146|ref|YP_004217358.1| beta-lactamase-like protein [Acidobacterium sp. MP5ACTX9]
 gi|321162873|gb|ADW68578.1| beta-lactamase-like protein [Acidobacterium sp. MP5ACTX9]
          Length = 209

 Score =  145 bits (366), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 84/207 (40%), Positives = 119/207 (57%), Gaps = 2/207 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           I+ V P + NC+ L DE S EA+VVDPG D+  I  ++   N  VKQI ITH H+DH+ G
Sbjct: 5   ILAVGPLRCNCSILGDEISREAIVVDPGDDISRIMALVAKHNLTVKQILITHAHIDHIAG 64

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           A +LK  L+   I  ++ D  ++  +D QA  + ++     A+ D+ L DG    +    
Sbjct: 65  AQELKR-LTGAPILYNQRDLPLVAMMDVQAGWVGMK-TPEVAAPDQDLADGYVFSIAGLN 122

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
               H PGH+ G V     E      GDTLF+ SIGRTD+  GD + L+ S++NK+L L 
Sbjct: 123 GIAHHTPGHTEGSVCLHLPEQTLLLAGDTLFQGSIGRTDLPGGDLKTLLRSVHNKLLTLP 182

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLKS 214
           DE   + GHG ++TIG ER  NPFL++
Sbjct: 183 DETLVIPGHGDSTTIGEERESNPFLQT 209


>gi|94968928|ref|YP_590976.1| beta-lactamase-like [Candidatus Koribacter versatilis Ellin345]
 gi|94550978|gb|ABF40902.1| beta-lactamase-like protein [Candidatus Koribacter versatilis
           Ellin345]
          Length = 209

 Score =  145 bits (365), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 77/206 (37%), Positives = 119/206 (57%), Gaps = 2/206 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           I  V P + NC+ + DE + EA+V+DPG +++++  +++     V QI +TH H+DHVGG
Sbjct: 5   IFPVGPLQCNCSVIGDETTHEAIVIDPGDEVEVVVAILEKHQLRVTQIVVTHAHIDHVGG 64

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           A +LK      ++    DD  ++  +D QA  L ++ +      D  L DGD++  GT  
Sbjct: 65  AMKLKALTGAPLLLNENDDQ-LLKLLDVQASWLGMK-DPGKVVVDESLADGDSVKFGTIE 122

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
             V H PGH+ G +  +         GDTLF+ SIGRTD+  G Y++++ SI+ K+L L 
Sbjct: 123 GSVIHTPGHTQGSICLLLKSEKTLIAGDTLFQGSIGRTDLPGGSYEKIMKSIHGKLLVLP 182

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLK 213
            E   + GHGP++TI  ER  NPFL+
Sbjct: 183 GETIVIPGHGPSTTIEEERERNPFLR 208


>gi|168214144|ref|ZP_02639769.1| metallo-beta-lactamase family protein [Clostridium perfringens CPE
           str. F4969]
 gi|168215561|ref|ZP_02641186.1| metallo-beta-lactamase family protein [Clostridium perfringens NCTC
           8239]
 gi|170714347|gb|EDT26529.1| metallo-beta-lactamase family protein [Clostridium perfringens CPE
           str. F4969]
 gi|182382085|gb|EDT79564.1| metallo-beta-lactamase family protein [Clostridium perfringens NCTC
           8239]
          Length = 206

 Score =  145 bits (365), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 80/208 (38%), Positives = 118/208 (56%), Gaps = 12/208 (5%)

Query: 9   VQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGA 68
           + V  ++ NC  + DEE+ + ++VDPG +   I+ VI+S +   K I +THGH DHVG  
Sbjct: 6   IPVGMYQANCYVVIDEETKDCIIVDPGEEASRIESVIESLDAKPKMILLTHGHFDHVGAV 65

Query: 69  AQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLG-THI 127
            +L E   +      KD+  +   VD   +L           +D +L+DGD L     + 
Sbjct: 66  QKLSEKYKIPFYIDKKDEDMIERNVDVFGKL---------PKADGYLKDGDMLKFSDNYE 116

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
            K    PGH+PG V ++   +N    GDTLFR SIGR+D   G++  L+ SIN+K++PLG
Sbjct: 117 IKCLETPGHTPGGVCFLI--DNCLFTGDTLFRESIGRSDFEGGNHATLLKSINDKLVPLG 174

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLKSN 215
           D+I+   GHGP+STI  ER+ NPFL  +
Sbjct: 175 DDIAVYPGHGPSSTIKHERQRNPFLAGD 202


>gi|110801728|ref|YP_699212.1| metallo-beta-lactamase family protein [Clostridium perfringens
           SM101]
 gi|110682229|gb|ABG85599.1| metallo-beta-lactamase family protein [Clostridium perfringens
           SM101]
          Length = 206

 Score =  144 bits (364), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 80/208 (38%), Positives = 119/208 (57%), Gaps = 12/208 (5%)

Query: 9   VQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGA 68
           + V  ++ NC  + DEE+ + ++VDPG +   I++VI+S +   K I +THGH DHVG  
Sbjct: 6   IPVGMYQANCYVVIDEETKDCIIVDPGEEASRIENVIESLDAKPKMILLTHGHFDHVGAV 65

Query: 69  AQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLG-THI 127
            +L E   +      KD+  +   VD   +L           +D +L+DGDTL     + 
Sbjct: 66  QKLAEKYKIPFYIDKKDEDMIERNVDVFGKL---------PKADGYLKDGDTLKFSDNYE 116

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
            K    PGH+PG + ++   +N    GDTLFR SIGR+D   G++  L+ SIN+K++PLG
Sbjct: 117 IKCLETPGHTPGGLCFLI--DNCLFTGDTLFRESIGRSDFEGGNHATLLKSINDKLVPLG 174

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLKSN 215
           D+I    GHGP+STI  ER+ NPFL  +
Sbjct: 175 DDIVVYPGHGPSSTIKHERQRNPFLAGD 202


>gi|253701157|ref|YP_003022346.1| beta-lactamase [Geobacter sp. M21]
 gi|251776007|gb|ACT18588.1| beta-lactamase domain protein [Geobacter sp. M21]
          Length = 209

 Score =  144 bits (364), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 79/207 (38%), Positives = 114/207 (55%), Gaps = 2/207 (0%)

Query: 6   FHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHV 65
           F  + V     NC  L D++S E VVVDPG D ++I D +      +K I  THGH DHV
Sbjct: 3   FETIVVGALGVNCFILGDKQSNEGVVVDPGADCELILDAVTRFGIKLKYIINTHGHFDHV 62

Query: 66  GGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGT 125
           G    LKE     ++  H+ D  ++    + A+   ++     A + R+L+DG  L  G 
Sbjct: 63  GCNRSLKEKSGAELL-IHQGDRTLLELAAKSAQKYGLKAEDSPAPT-RFLEDGMRLEFGK 120

Query: 126 HIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILP 185
            + +V H PGH+ G    +         GDTLF  S+GRTD+  G ++QL+ SI  K++P
Sbjct: 121 RVIEVLHTPGHTQGGCCLLLAHEKLVITGDTLFADSVGRTDLPGGSHEQLMASIKAKLMP 180

Query: 186 LGDEISFVCGHGPNSTIGRERRLNPFL 212
           L D+ +   GHGP+STIGRERR NP++
Sbjct: 181 LPDDTTVWPGHGPSSTIGRERRSNPYI 207


>gi|150390119|ref|YP_001320168.1| beta-lactamase domain-containing protein [Alkaliphilus
           metalliredigens QYMF]
 gi|149949981|gb|ABR48509.1| beta-lactamase domain protein [Alkaliphilus metalliredigens QYMF]
          Length = 206

 Score =  144 bits (364), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 82/202 (40%), Positives = 116/202 (57%), Gaps = 8/202 (3%)

Query: 14  FKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLKE 73
           F  NC  + D+E+ +A VVDPGGD D I ++I+   F +  I +THGH DH+G   +L E
Sbjct: 11  FGVNCYVISDDETGKAAVVDPGGDADKILELIKDNQFELTHILLTHGHGDHIGAVNELHE 70

Query: 74  DLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNAS--SDRWLQDGDTLLLGTHIFKVF 131
                +   H+DD  ++   +      S RM     +  +D +L+DG+ L +G     V 
Sbjct: 71  KTKAPVY-VHEDDLYILKDANIN---YSARMGGPVVTIDTDVFLKDGEVLTIGNLKLHVL 126

Query: 132 HCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEIS 191
           H PGHSPG V            GDTLF +SIGR+D+  G+Y QLI SI +K++ L DE++
Sbjct: 127 HTPGHSPGGVCIRG--EGVVFTGDTLFANSIGRSDLEGGNYDQLIASIQSKLMTLDDELT 184

Query: 192 FVCGHGPNSTIGRERRLNPFLK 213
            + GHGP STIG ER  NP++K
Sbjct: 185 VLPGHGPASTIGIERMTNPYIK 206


>gi|18310918|ref|NP_562852.1| metallo-beta-lactamase family protein [Clostridium perfringens str.
           13]
 gi|18145600|dbj|BAB81642.1| conserved hypothetical protein [Clostridium perfringens str. 13]
          Length = 206

 Score =  144 bits (363), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 80/208 (38%), Positives = 119/208 (57%), Gaps = 12/208 (5%)

Query: 9   VQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGA 68
           + V  ++ NC  + DEE+ + ++VDPG +   I++VI+S +   K I +THGH DHVG  
Sbjct: 6   IPVGMYQANCYVVIDEETKDCIMVDPGEEASRIENVIESLDAKPKMILLTHGHFDHVGAV 65

Query: 69  AQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLG-THI 127
            +L E   +      KD+  +   VD   +L           +D +L+DGDTL     + 
Sbjct: 66  QKLAEKYKIPFYIDKKDEDMIERNVDVFGKL---------PKADGYLKDGDTLKFSDNYE 116

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
            K    PGH+PG + ++   +N    GDTLFR SIGR+D   G++  L+ SIN+K++PLG
Sbjct: 117 IKCLETPGHTPGGLCFLI--DNCLFTGDTLFRESIGRSDFEGGNHATLLKSINDKLVPLG 174

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLKSN 215
           D+I    GHGP+STI  ER+ NPFL  +
Sbjct: 175 DDIVVYPGHGPSSTIKHERQRNPFLAGD 202


>gi|322419018|ref|YP_004198241.1| beta-lactamase domain-containing protein [Geobacter sp. M18]
 gi|320125405|gb|ADW12965.1| beta-lactamase domain protein [Geobacter sp. M18]
          Length = 209

 Score =  144 bits (362), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 82/207 (39%), Positives = 111/207 (53%), Gaps = 2/207 (0%)

Query: 6   FHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHV 65
           F  + V P   NC  L D+ S E +VVDPG D D+I   + +    +K I  THGH DHV
Sbjct: 3   FETIVVGPLGVNCFILGDKHSNEGMVVDPGADCDMILATVANFGVEIKYIVNTHGHFDHV 62

Query: 66  GGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGT 125
           G   QLKE     ++  H++D   +      A+   + +   +   D +L DG  L LG 
Sbjct: 63  GCNRQLKERTGAQLLA-HQEDLPFLLNAGRSAQKYGLSVE-DSPQPDLFLTDGMRLELGR 120

Query: 126 HIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILP 185
              +V H PGH+ G              GDTLF  S+GRTD+  G++ QLI +I  K+LP
Sbjct: 121 RSIEVLHTPGHTQGGCCLYLANEKLVITGDTLFADSVGRTDLPGGNHSQLIAAIKTKLLP 180

Query: 186 LGDEISFVCGHGPNSTIGRERRLNPFL 212
           L D+     GHGP+STIG+ERRLNP+L
Sbjct: 181 LPDDTIVWPGHGPSSTIGQERRLNPYL 207


>gi|182624403|ref|ZP_02952187.1| metallo-beta-lactamase family protein [Clostridium perfringens D
           str. JGS1721]
 gi|177910406|gb|EDT72783.1| metallo-beta-lactamase family protein [Clostridium perfringens D
           str. JGS1721]
          Length = 206

 Score =  143 bits (361), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 79/208 (37%), Positives = 118/208 (56%), Gaps = 12/208 (5%)

Query: 9   VQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGA 68
           + V  ++ NC  + DEE+ + ++VDPG +   I+ VI+S +   K I +THGH DHVG  
Sbjct: 6   IPVGMYQANCYVVIDEETKDCIIVDPGEEASRIESVIESLDAKPKMILLTHGHFDHVGAV 65

Query: 69  AQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLG-THI 127
            +L E   +      KD+  +   VD   +L           +D +L+DGD L     + 
Sbjct: 66  QKLSEKYKIPFYIDKKDEDMIERNVDVFGKL---------PKADGYLKDGDMLKFSDNYE 116

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
            K    PGH+PG + ++   +N    GDTLFR SIGR+D   G++  L+ SIN+K++PLG
Sbjct: 117 IKCLETPGHTPGGLCFLI--DNCLFTGDTLFRESIGRSDFEGGNHATLLKSINDKLVPLG 174

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLKSN 215
           D+I+   GHGP+STI  ER+ NPFL  +
Sbjct: 175 DDIAVYPGHGPSSTIKHERQRNPFLAGD 202


>gi|302389919|ref|YP_003825740.1| beta-lactamase domain protein [Thermosediminibacter oceani DSM
           16646]
 gi|302200547|gb|ADL08117.1| beta-lactamase domain protein [Thermosediminibacter oceani DSM
           16646]
          Length = 206

 Score =  143 bits (361), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 79/207 (38%), Positives = 114/207 (55%), Gaps = 8/207 (3%)

Query: 9   VQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGA 68
           +QV P   NC  L DE   +A ++DPG + +II +V+    F V  I +THGH DH+G  
Sbjct: 6   LQVGPLASNCYVLADEHCKKAAIIDPGANPEIILEVVNKEGFEVDYIILTHGHADHIGAV 65

Query: 69  AQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNA--RNASSDRWLQDGDTLLLGTH 126
            ++K+    + +  H+ DA M+   +E    LS  M       ++D  L+  + L +G  
Sbjct: 66  REIKQSTG-SKVAIHEKDAKMLLSPEEN---LSSYMGCGFTQPAADVELRGDENLQIGDI 121

Query: 127 IFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPL 186
           I +V   PGH+PG +       N    GDTLF  S+GRTD   G Y++L+NSI  K+L  
Sbjct: 122 ILEVIWTPGHTPGSICVK--AGNLLFTGDTLFAGSVGRTDFPGGSYRELLNSIKTKLLVF 179

Query: 187 GDEISFVCGHGPNSTIGRERRLNPFLK 213
            D++  + GHGP STIG ER  NPFL+
Sbjct: 180 DDDVRVLPGHGPESTIGGERATNPFLR 206


>gi|121535599|ref|ZP_01667406.1| beta-lactamase domain protein [Thermosinus carboxydivorans Nor1]
 gi|121305839|gb|EAX46774.1| beta-lactamase domain protein [Thermosinus carboxydivorans Nor1]
          Length = 206

 Score =  143 bits (361), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 79/205 (38%), Positives = 117/205 (57%), Gaps = 4/205 (1%)

Query: 9   VQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGA 68
           ++V     NC  ++ E++  A V+DPGG+ + I  VI   N  V+ I  THGH DH+   
Sbjct: 6   LEVGSLGTNCYIVYCEKTRAAAVIDPGGNAEEILAVINGENLKVECIINTHGHADHIQAN 65

Query: 69  AQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIF 128
           A++K+     I   H++DA M+  +     +  I    +   +DR LQDGD + +G    
Sbjct: 66  AKIKQATCAPIF-IHREDADMLTSIHRNLSVF-IGGGIKCEPADRLLQDGDIIRIGEIAL 123

Query: 129 KVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGD 188
            V H PGH+PG +  +  +  F+  GDTLF  SIGRTD   G Y+QLI+SI  K++ L D
Sbjct: 124 TVIHTPGHTPGGICLLGGDVLFS--GDTLFAESIGRTDFPGGSYRQLIHSIKEKLMVLDD 181

Query: 189 EISFVCGHGPNSTIGRERRLNPFLK 213
            +  + GHGP +TIG ER+ NPF++
Sbjct: 182 NVRVLPGHGPETTIGWERQHNPFIQ 206


>gi|167037443|ref|YP_001665021.1| beta-lactamase domain-containing protein [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|320115856|ref|YP_004186015.1| beta-lactamase domain-containing protein [Thermoanaerobacter
           brockii subsp. finnii Ako-1]
 gi|166856277|gb|ABY94685.1| beta-lactamase domain protein [Thermoanaerobacter pseudethanolicus
           ATCC 33223]
 gi|319928947|gb|ADV79632.1| beta-lactamase domain-containing protein [Thermoanaerobacter
           brockii subsp. finnii Ako-1]
          Length = 207

 Score =  143 bits (360), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 78/202 (38%), Positives = 118/202 (58%), Gaps = 6/202 (2%)

Query: 14  FKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLKE 73
           +K NC  + DEE+ E +V+DPG  L  I+D I      VK I +THGH DH+GG  +L++
Sbjct: 11  YKANCYIVSDEETRETIVIDPGEYLSEIQDYIGVNKLRVKYILLTHGHFDHIGGVEELRK 70

Query: 74  DLSLTIIGPHKDDAAMMGKVDEQARLLS-IRMNARNASSDRWLQDGDTLLLGTHIFKVFH 132
            ++   +   K+DA M+  +D    L   +    + +++D  L  GD L  G +  +V H
Sbjct: 71  -VTQAEVAISKEDAPML--LDPSLNLSKMVYKKIQCSAADILLNGGDILYFGKYAIEVLH 127

Query: 133 CPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEISF 192
            PGH+ G V +    +N    GDT+F+ SIGR D   GD+  L++SI NK+L L D++  
Sbjct: 128 TPGHTKGGVCFKI--DNVCFTGDTVFKGSIGRYDFPGGDFDTLMDSIKNKLLVLEDDVVI 185

Query: 193 VCGHGPNSTIGRERRLNPFLKS 214
             GHG +STIG+E+R+N FL+ 
Sbjct: 186 YPGHGESSTIGKEKRINLFLRE 207


>gi|312130193|ref|YP_003997533.1| beta-lactamase domain protein [Leadbetterella byssophila DSM 17132]
 gi|311906739|gb|ADQ17180.1| beta-lactamase domain protein [Leadbetterella byssophila DSM 17132]
          Length = 209

 Score =  142 bits (357), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 76/207 (36%), Positives = 121/207 (58%), Gaps = 9/207 (4%)

Query: 12  TPFKQNCTFLFDEESLEAVVVDPG----GDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           +PF++N T++  + S E +VVDPG     + + +K+ ++  N  VK I +TH H+DH+ G
Sbjct: 8   SPFQEN-TYVLTDPSGETIVVDPGCYTQAEKEQLKEFLKPLN--VKAILLTHAHLDHIFG 64

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
            A LK    + +   HK D  ++   + + ++  I   A +  ++++L++GD    G   
Sbjct: 65  VAYLKRHYDVPVYM-HKLDLPILADFEMRCKMWGIP-GAESFEAEKFLEEGDVFTFGQTQ 122

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
            +V H PGH+PGH+++V+ EN     GD LFR SIGRTD+  GD+  LINSI  K+  L 
Sbjct: 123 LEVLHVPGHAPGHIVFVSHENEMIIGGDCLFRRSIGRTDLPMGDHDTLINSIKTKLFSLP 182

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLKS 214
           D  +   GH   +TIG E++ NPFL+ 
Sbjct: 183 DHYTVYPGHMEPTTIGEEKQFNPFLRQ 209


>gi|297616956|ref|YP_003702115.1| beta-lactamase [Syntrophothermus lipocalidus DSM 12680]
 gi|297144793|gb|ADI01550.1| beta-lactamase-like protein [Syntrophothermus lipocalidus DSM
           12680]
          Length = 206

 Score =  142 bits (357), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 83/205 (40%), Positives = 116/205 (56%), Gaps = 5/205 (2%)

Query: 9   VQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGA 68
           ++V     NC  +  EE+ E  V+DPGG+   I  VI+S    +K I  THGH+DH+G  
Sbjct: 6   LEVGSIGANCYIIGCEETREGAVIDPGGNGPSIVQVIESLKLKIKYIINTHGHIDHIGAN 65

Query: 69  AQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI- 127
            Q+KE     I+  H++DA M+        +   R N  +  +DR+++DGD + +G  I 
Sbjct: 66  RQVKEATGAEIL-IHEEDAGMLTNPVSNFSMFMGR-NITSPPADRFIKDGDIIKIGNTIE 123

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
            +V H PGH+ G V     +  FA  GDTLF  SIGRTD   G ++ LI SINNKI+   
Sbjct: 124 LEVIHTPGHTRGGVCLKTGDIIFA--GDTLFAGSIGRTDFPGGSFKTLIESINNKIMCYE 181

Query: 188 DEISFVCGHGPNSTIGRERRLNPFL 212
           D +    GHGP +T+G ER+ NPFL
Sbjct: 182 DHVKVYPGHGPATTVGFERKHNPFL 206


>gi|78223870|ref|YP_385617.1| Beta-lactamase-like [Geobacter metallireducens GS-15]
 gi|78195125|gb|ABB32892.1| Beta-lactamase-like protein [Geobacter metallireducens GS-15]
          Length = 209

 Score =  141 bits (355), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 82/208 (39%), Positives = 111/208 (53%), Gaps = 4/208 (1%)

Query: 6   FHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHV 65
           F IV V P   NC  L  EE+ E VVVDPG D   I D +++    ++ +  THGH DH+
Sbjct: 3   FEIVVVGPMGVNCFILGCEETKEGVVVDPGADAGRILDRVRALGLTIRTVINTHGHFDHI 62

Query: 66  GGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGT 125
           GG   + E     ++  H+DD   + +  + A    +   A +   D  L+DG T+  G 
Sbjct: 63  GGNKAVLEATGGRLM-IHRDDVHFLSRAADVAANYGLS-TANSPPPDELLEDGMTVTFGK 120

Query: 126 HIFKVFHCPGHSPGHV-IYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKIL 184
              KVFH PGH+PG   +Y+  E      GDTLF  S+GRTD     ++ LI SI  K+L
Sbjct: 121 CAMKVFHTPGHTPGGCCLYLEGEGKVI-TGDTLFAESVGRTDFPGSSHEALITSIRTKLL 179

Query: 185 PLGDEISFVCGHGPNSTIGRERRLNPFL 212
           PL DE     GHG  S+IGRE+  NP+L
Sbjct: 180 PLPDETQVFPGHGEASSIGREKLYNPYL 207


>gi|116626952|ref|YP_829108.1| beta-lactamase domain-containing protein [Candidatus Solibacter
           usitatus Ellin6076]
 gi|116230114|gb|ABJ88823.1| beta-lactamase domain protein [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 214

 Score =  140 bits (354), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 81/207 (39%), Positives = 120/207 (57%), Gaps = 4/207 (1%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           I+ V   + NC+   DE + EA+VVDPG +++ I  ++      VK I ITH H+DH+ G
Sbjct: 5   ILPVGMLQCNCSIFGDEGTREAIVVDPGDEIESILAIVTRHGLTVKAIVITHAHIDHIAG 64

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           A QLK+     +   +++D  +   +D QA  L +    +    D   +DGDTLLLG+  
Sbjct: 65  AQQLKKATGAPVYM-NQNDTELQRMLDVQATWLGMP-TPQAVEIDVAAKDGDTLLLGSTE 122

Query: 128 FKVFHCPGHSPGHV-IYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPL 186
             V H PGH+ G + +++  E      GDTLFR SIGRTD+  GD +Q++ SI++K+LPL
Sbjct: 123 LHVLHTPGHTQGSICLWMPGEGKLV-AGDTLFRESIGRTDLPGGDGRQILQSIHDKLLPL 181

Query: 187 GDEISFVCGHGPNSTIGRERRLNPFLK 213
             E   + GHG  +T+  ER+ N FLK
Sbjct: 182 PGETEVIPGHGDLTTLAHERQFNYFLK 208


>gi|289578228|ref|YP_003476855.1| beta-lactamase [Thermoanaerobacter italicus Ab9]
 gi|289527941|gb|ADD02293.1| beta-lactamase domain protein [Thermoanaerobacter italicus Ab9]
          Length = 207

 Score =  140 bits (353), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 77/202 (38%), Positives = 117/202 (57%), Gaps = 6/202 (2%)

Query: 14  FKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLKE 73
           +K NC  + DEE+ E +V+DPG     I+D I      VK I +THGH DH+GG  +L++
Sbjct: 11  YKANCYIVSDEETRETIVIDPGEYSSEIQDYIGINKLRVKYILLTHGHFDHIGGVEELRK 70

Query: 74  DLSLTIIGPHKDDAAMMGKVDEQARLLS-IRMNARNASSDRWLQDGDTLLLGTHIFKVFH 132
            ++   +   K+DA M+  +D    L   +    + +++D  L  GD L  G +  +V H
Sbjct: 71  -VTQAEVAISKEDAPML--LDPSLNLSKMVYKKIQCSAADILLNGGDILYFGKYTIEVLH 127

Query: 133 CPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEISF 192
            PGH+ G V +    +N    GDT+F+ SIGR D   GD+  L++SI NK+L L D++  
Sbjct: 128 TPGHTKGGVCFKI--DNVCFTGDTVFKGSIGRYDFPGGDFDTLMDSIKNKLLVLEDDVVI 185

Query: 193 VCGHGPNSTIGRERRLNPFLKS 214
             GHG +STIG+E+R+N FL+ 
Sbjct: 186 YPGHGESSTIGKEKRINLFLRE 207


>gi|168208636|ref|ZP_02634261.1| metallo-beta-lactamase family protein [Clostridium perfringens B
           str. ATCC 3626]
 gi|170713182|gb|EDT25364.1| metallo-beta-lactamase family protein [Clostridium perfringens B
           str. ATCC 3626]
          Length = 206

 Score =  140 bits (352), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 77/208 (37%), Positives = 118/208 (56%), Gaps = 12/208 (5%)

Query: 9   VQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGA 68
           + V  ++ NC  + DEE+ + ++VDPG +   I+ VI+S +   + + +THGH DHVG  
Sbjct: 6   IPVGMYQANCYVVIDEETKDCIIVDPGEEASRIESVIESLDAKPRMVLLTHGHFDHVGAV 65

Query: 69  AQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLG-THI 127
            +L E   +      KD+  +   VD   +L           +D +L+DGDTL     + 
Sbjct: 66  QKLAEKYKIPFYIDKKDEDMIERNVDVFGKL---------PKADGYLKDGDTLKFSDNYE 116

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
            K    PGH+PG + ++   +N    GDTLFR SIGR+D   G++  L+ SIN+K++PLG
Sbjct: 117 IKCLETPGHTPGGLCFLI--DNCLFTGDTLFRESIGRSDFEGGNHATLLKSINDKLVPLG 174

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLKSN 215
           D+I+   GHG +STI  ER+ NPFL  +
Sbjct: 175 DDIAVYPGHGLSSTIKHERQRNPFLAGD 202


>gi|162454293|ref|YP_001616660.1| hypothetical protein sce6016 [Sorangium cellulosum 'So ce 56']
 gi|161164875|emb|CAN96180.1| unnamed protein product [Sorangium cellulosum 'So ce 56']
          Length = 217

 Score =  139 bits (351), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 84/207 (40%), Positives = 109/207 (52%), Gaps = 4/207 (1%)

Query: 10  QVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAA 69
            V P   NC+ L D  S  AVV+DPGGD D I+  ++     V  I  TH H+DHVG  A
Sbjct: 13  SVGPLGCNCSILVDPVSKGAVVIDPGGDFDEIRARVEQAGAKVAAIVHTHTHIDHVGATA 72

Query: 70  QLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFK 129
            L+   S      H+ D  +   +  QA +L I +  R    D  L DG  +  G     
Sbjct: 73  PLQR-WSGAAARIHEADRFLYDMLPVQAAMLGIALPER-CEVDGDLNDGAVVKAGGLDLH 130

Query: 130 VFHCPGHSPGHVIYVNFENN--FAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
           V H PGH+PG V ++        A  GDTLFR SIGRTD+  GD + +++SI  K+L L 
Sbjct: 131 VLHTPGHTPGSVSFLVLAETGAVAFTGDTLFRRSIGRTDLWGGDSRAIVSSIRGKLLTLD 190

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLKS 214
                V GHGP++TIG ER  NPFL+S
Sbjct: 191 PSTRVVTGHGPSTTIGEERDRNPFLRS 217


>gi|297544509|ref|YP_003676811.1| beta-lactamase domain-containing protein [Thermoanaerobacter
           mathranii subsp. mathranii str. A3]
 gi|296842284|gb|ADH60800.1| beta-lactamase domain protein [Thermoanaerobacter mathranii subsp.
           mathranii str. A3]
          Length = 207

 Score =  139 bits (349), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 76/202 (37%), Positives = 117/202 (57%), Gaps = 6/202 (2%)

Query: 14  FKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLKE 73
           +K NC  + DEE+ E +V+DPG     I+D I      VK I +THGH DH+GG  +L++
Sbjct: 11  YKANCYIVSDEETRETIVIDPGEYSSEIQDYIGINKLRVKYILLTHGHFDHIGGVEELRK 70

Query: 74  DLSLTIIGPHKDDAAMMGKVDEQARLLS-IRMNARNASSDRWLQDGDTLLLGTHIFKVFH 132
            ++   +   K+DA ++  +D    L   +    + +++D  L  GD L  G +  +V H
Sbjct: 71  -VTQAEVAISKEDAPLL--LDPSLNLSKMVYKKIQCSAADILLNGGDILYFGKYTIEVLH 127

Query: 133 CPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEISF 192
            PGH+ G V +    +N    GDT+F+ SIGR D   GD+  L++SI NK+L L D++  
Sbjct: 128 TPGHTKGGVCFKI--DNVCFTGDTVFKGSIGRYDFPGGDFDTLMDSIKNKLLVLEDDVVI 185

Query: 193 VCGHGPNSTIGRERRLNPFLKS 214
             GHG +STIG+E+R+N FL+ 
Sbjct: 186 YPGHGESSTIGKEKRINLFLRE 207


>gi|39996225|ref|NP_952176.1| metallo-beta-lactamase family protein [Geobacter sulfurreducens
           PCA]
 gi|39982990|gb|AAR34449.1| metallo-beta-lactamase family protein [Geobacter sulfurreducens
           PCA]
 gi|298505237|gb|ADI83960.1| zinc-dependent hydrolase YcbL [Geobacter sulfurreducens KN400]
          Length = 209

 Score =  138 bits (347), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 78/207 (37%), Positives = 108/207 (52%), Gaps = 2/207 (0%)

Query: 6   FHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHV 65
           F  V V P   NC  L  E+S E V+VDPG +   I + +      V  +  THGH DHV
Sbjct: 3   FETVVVGPLGVNCFILGCEQSREGVIVDPGAESGRILERVGELGLKVGMVINTHGHFDHV 62

Query: 66  GGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGT 125
           GG  ++ E     ++  H+DD   + +  + A +  +     + + D  L+DG TL +GT
Sbjct: 63  GGNRKVLEATGAKLL-VHRDDVHFLDRAADVAAMYGLDTE-NSPAPDSLLEDGMTLSVGT 120

Query: 126 HIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILP 185
              +V H PGH+PG    +         GDTLF  S+GRTD     ++ LI SI  K+L 
Sbjct: 121 LSLRVLHTPGHTPGGCCLLLEGEGKVLTGDTLFEESVGRTDFPGSSHEALITSIREKLLT 180

Query: 186 LGDEISFVCGHGPNSTIGRERRLNPFL 212
           L DE     GHGP ++IGRERR NP+L
Sbjct: 181 LPDETEVYPGHGPATSIGRERRYNPYL 207


>gi|323142305|ref|ZP_08077137.1| metallo-beta-lactamase domain protein [Phascolarctobacterium sp.
           YIT 12067]
 gi|322413189|gb|EFY04076.1| metallo-beta-lactamase domain protein [Phascolarctobacterium sp.
           YIT 12067]
          Length = 208

 Score =  138 bits (347), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 77/211 (36%), Positives = 110/211 (52%), Gaps = 4/211 (1%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +  + V+      NC F  +E   E V+ DPGGD   I  +I+     V  I +THGH D
Sbjct: 1   MKIYHVEAGMLATNCYFAVNEAIGEGVIFDPGGDCPTILRMIEQAKAKVVAIVLTHGHSD 60

Query: 64  HVGGAAQLKEDLSLTI-IGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLL 122
           H+G  A+L++     + IG  +DDA  + + +       I    +N  +D  + DGD L 
Sbjct: 61  HIGALAELRKATGAPVYIG--EDDADCLTQPNRNLSFF-IGEELKNEPADHLVHDGDVLE 117

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
           L    F+ F  PGH+ G   Y          GDT+F  SIGRTD+  G Y+ LI SI  K
Sbjct: 118 LAGMKFEAFATPGHTKGGFCYYYAPGKVVFAGDTIFCESIGRTDLPGGSYRALIQSIKTK 177

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           ++ L D++  + GHGP +T+G ERR NPFL+
Sbjct: 178 LMVLDDDVKLLPGHGPTTTVGWERRRNPFLQ 208


>gi|315426584|dbj|BAJ48213.1| beta-lactamase domain protein [Candidatus Caldiarchaeum
           subterraneum]
          Length = 218

 Score =  138 bits (347), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 78/204 (38%), Positives = 110/204 (53%), Gaps = 5/204 (2%)

Query: 10  QVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAA 69
           QV P   N   ++DEE+ EAV++D G D  ++ + +Q R   V  ++ THGH DHV    
Sbjct: 9   QVGPLSSNSYIVYDEETREAVIIDAGDDAWLLLETLQERRLRVNAVYATHGHFDHVMAVD 68

Query: 70  QLKEDLSLTIIGPHKDDAAMMGKVDEQAR-LLSIRMNARNASSDRWLQDGDTLLLGTHIF 128
            LK+ L +     H+ D  ++    E  R  L I +     S D +L+DG T+ +G    
Sbjct: 69  DLKQALKIPFY-IHRLDLEILSMAREMTRRFLGIDV-GDPPSPDGFLEDGQTIQVGGKSL 126

Query: 129 KVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGD 188
           KV H PGHSPG V +  + +     GD LF  S+GRTD   G  QQL  SI  K+  L D
Sbjct: 127 KVIHTPGHSPGSVCF--YGDGVLFSGDLLFMGSVGRTDAPGGSAQQLTQSILEKVFKLPD 184

Query: 189 EISFVCGHGPNSTIGRERRLNPFL 212
           ++    GHGP +TIG E++ NPF+
Sbjct: 185 DVKVYPGHGPETTIGWEKKHNPFV 208


>gi|315425048|dbj|BAJ46721.1| metallo-beta-lactamase family protein [Candidatus Caldiarchaeum
           subterraneum]
          Length = 218

 Score =  137 bits (346), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 77/204 (37%), Positives = 110/204 (53%), Gaps = 5/204 (2%)

Query: 10  QVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAA 69
           QV P   N   ++DEE+ EAV++D G D  ++ + +Q R   V  ++ THGH DHV    
Sbjct: 9   QVGPLSSNSYIVYDEETREAVIIDAGDDAWLLLETLQERRLRVNAVYATHGHFDHVMAVD 68

Query: 70  QLKEDLSLTIIGPHKDDAAMMGKVDEQAR-LLSIRMNARNASSDRWLQDGDTLLLGTHIF 128
            LK+ L +     H+ D  ++    E  R  L I +     S D +++DG T+ +G    
Sbjct: 69  DLKQALKIPFY-IHRLDLEILSMAREMTRRFLGIDV-GDPPSPDGYIEDGQTIQVGGKSL 126

Query: 129 KVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGD 188
           KV H PGHSPG V +  + +     GD LF  S+GRTD   G  QQL  SI  K+  L D
Sbjct: 127 KVIHTPGHSPGSVCF--YGDGVLFSGDLLFMGSVGRTDAPGGSAQQLTQSILEKVFKLPD 184

Query: 189 EISFVCGHGPNSTIGRERRLNPFL 212
           ++    GHGP +TIG E++ NPF+
Sbjct: 185 DVKVYPGHGPETTIGWEKKHNPFV 208


>gi|300087873|ref|YP_003758395.1| putative metallo-beta-lactamase family protein [Dehalogenimonas
           lykanthroporepellens BL-DC-9]
 gi|299527606|gb|ADJ26074.1| putative metallo-beta-lactamase family protein [Dehalogenimonas
           lykanthroporepellens BL-DC-9]
          Length = 212

 Score =  137 bits (345), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 76/202 (37%), Positives = 115/202 (56%), Gaps = 5/202 (2%)

Query: 11  VTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQ 70
           V P + NC  + D  S E +V+DPGGD ++I + I++    +  I +THGH DH   AA+
Sbjct: 8   VGPIQANCYLVGDPASREGLVIDPGGDGEVIVERIKALGLRIGHIVLTHGHFDHTA-AAE 66

Query: 71  LKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFKV 130
           + +  +   +  H+DD  ++   D   R+   R+    A  +  L+  + + +G   F +
Sbjct: 67  MVKSATGARLAVHQDDLGLLND-DFLPRMAGFRVEPLPAP-EVVLRGWEDIAVGALRFTI 124

Query: 131 FHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEI 190
            H PGHSPG +   + +  F   GD+LF   IGRTD+  GDY  LI+S+N ++L L D+I
Sbjct: 125 LHLPGHSPGGIALYSQDAVFT--GDSLFAGGIGRTDLPGGDYDTLIDSLNQRLLALDDDI 182

Query: 191 SFVCGHGPNSTIGRERRLNPFL 212
               GHGP++TIG ERR NPFL
Sbjct: 183 KVYPGHGPDTTIGTERRGNPFL 204


>gi|327479682|gb|AEA82992.1| metallo-beta-lactamase family protein [Pseudomonas stutzeri DSM
           4166]
          Length = 214

 Score =  136 bits (342), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 74/204 (36%), Positives = 111/204 (54%), Gaps = 4/204 (1%)

Query: 11  VTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQ 70
           V P + NCT + D  S +A+VVDPGGD ++I   +++    V  I  TH H+DH   + +
Sbjct: 15  VGPLQCNCTIIGDPLSKKAIVVDPGGDPELIMARLEAHGLKVVSIIHTHAHLDHFLASGK 74

Query: 71  LKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFKV 130
           +KE    T+   HK D  +   ++ Q RL  +      A  DRWL D + L  G  +   
Sbjct: 75  MKERTGATL-HLHKADQFLWDNLEMQCRLFGVPYTPVPAP-DRWLADDEELACGCGV--A 130

Query: 131 FHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEI 190
            H PGH+PG + +   +      GDTLFR  IGRTD+  GDY  +  SI  ++  L ++ 
Sbjct: 131 LHTPGHTPGSMSFWFADAKLLIAGDTLFRRGIGRTDLWGGDYASIERSIRQRLYALDEDA 190

Query: 191 SFVCGHGPNSTIGRERRLNPFLKS 214
           + V GHGP++ +G E R NPF+++
Sbjct: 191 TVVTGHGPDTRLGDEMRANPFVRA 214


>gi|332799392|ref|YP_004460891.1| beta-lactamase domain-containing protein [Tepidanaerobacter sp.
           Re1]
 gi|332697127|gb|AEE91584.1| beta-lactamase domain protein [Tepidanaerobacter sp. Re1]
          Length = 208

 Score =  136 bits (342), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 79/207 (38%), Positives = 114/207 (55%), Gaps = 10/207 (4%)

Query: 9   VQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGA 68
           +QV     NC  + DE++  A ++DPG D D I + I   +  VK I++THGH DH+   
Sbjct: 6   LQVGDLAANCYIIADEKNANAAIIDPGADADKIIETITKEHLIVKYIFLTHGHSDHISAL 65

Query: 69  AQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNAR--NASSDRWLQDGDTLLLGTH 126
            ++K + +   I  H+ DA M+    +    LSI           D  L+  +   +G  
Sbjct: 66  KEVK-NATDAKIAIHEQDAPMLLSPKDN---LSIYFGEGFIQPPPDIMLKGNEKFAVGDL 121

Query: 127 IFKVFHCPGHSPGHV-IYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILP 185
           + ++ H PGH+PG + I V    N    GDTLF  S+GRTD   G Y +LINSI +K+LP
Sbjct: 122 VLEIIHTPGHTPGGISIKVG---NIVFTGDTLFAGSVGRTDFPGGSYDELINSIRDKLLP 178

Query: 186 LGDEISFVCGHGPNSTIGRERRLNPFL 212
           LGD IS + GHG  ST+  E+++NPFL
Sbjct: 179 LGDNISILPGHGEPSTLSIEKKINPFL 205


>gi|260887824|ref|ZP_05899087.1| metallo-beta-lactamase family protein [Selenomonas sputigena ATCC
           35185]
 gi|330838609|ref|YP_004413189.1| beta-lactamase domain protein [Selenomonas sputigena ATCC 35185]
 gi|260862430|gb|EEX76930.1| metallo-beta-lactamase family protein [Selenomonas sputigena ATCC
           35185]
 gi|329746373|gb|AEB99729.1| beta-lactamase domain protein [Selenomonas sputigena ATCC 35185]
          Length = 213

 Score =  136 bits (342), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 78/210 (37%), Positives = 112/210 (53%), Gaps = 6/210 (2%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L+   + V     NC  L +E S EA+ +DPGG  + +   IQ    ++K I  TH H D
Sbjct: 3   LNMKALVVGALGVNCYILHEEGSKEAIAIDPGGSEETVWQHIQEDGLNLKAILNTHAHAD 62

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNA-RNASSDRWLQDGDTLL 122
           H+G    L+E     +   H+ DA M+  +D Q  L +          +D  L+ G+ L 
Sbjct: 63  HIGAIDFLREKTGAKLY-IHEADAPML--LDAQKNLSAFMGTPIMTRPADILLKGGEVLE 119

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
           +G   F V H PGHSPG V Y+  +  F+  GDTLF  S+GRTD      + L+ SI  K
Sbjct: 120 IGGMKFTVLHTPGHSPGGVCYLMEDRVFS--GDTLFAESVGRTDFPGSSSRDLLTSIKEK 177

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           ++ L DE++  CGHGP +TIG ER+ NP++
Sbjct: 178 LMTLPDELAVYCGHGPATTIGHERKCNPYI 207


>gi|91203527|emb|CAJ71180.1| similar to hydroxyacylglutathione hydrolase (glyoxalase II)
           [Candidatus Kuenenia stuttgartiensis]
          Length = 210

 Score =  135 bits (341), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 73/207 (35%), Positives = 114/207 (55%), Gaps = 4/207 (1%)

Query: 6   FHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHV 65
           F  ++V P   NC  +       A V+D GG++  I ++++ +N  +K I  TH H DHV
Sbjct: 8   FETLEVGPLSVNCYIIGSRSDNTAAVIDAGGNVKEIVEILKKQNLTLKYIINTHAHFDHV 67

Query: 66  GGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGT 125
           GG ++L   L+      H+ D  ++  +DEQ+    +    +    DR+L D + L LG 
Sbjct: 68  GGVSELHA-LTGAPFLLHQGDVPLLDFLDEQSNYFGLPPIPK-PKVDRYLIDNEELPLGD 125

Query: 126 HIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILP 185
            + ++ H PGHSPG V ++   NN    GDTLF  S+GRTD+  G +  LINS+  ++  
Sbjct: 126 EVIRIIHTPGHSPGCVCFLF--NNAIFAGDTLFAGSVGRTDLYGGSHDTLINSVKTRLFT 183

Query: 186 LGDEISFVCGHGPNSTIGRERRLNPFL 212
           L D +    GHGP +TIG+E++ NP+ 
Sbjct: 184 LEDHVLVYPGHGPVTTIGKEKKHNPYF 210


>gi|188997639|ref|YP_001931890.1| beta-lactamase domain protein [Sulfurihydrogenibium sp. YO3AOP1]
 gi|188932706|gb|ACD67336.1| beta-lactamase domain protein [Sulfurihydrogenibium sp. YO3AOP1]
          Length = 212

 Score =  135 bits (341), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 75/209 (35%), Positives = 116/209 (55%), Gaps = 5/209 (2%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +    + V P  +NC  +FD  S +AVV+DPG D + I +  + ++ +VK I  THGH+D
Sbjct: 1   MKVKTLTVGPLAENCFIVFDGNSKDAVVIDPGADGEFILN--ELKDLNVKAILATHGHLD 58

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G    LKE L++      KD+  +  ++        I    +  S D  ++DGD L  
Sbjct: 59  HIGQVGYLKEKLNVPFYMNKKDEFLINNEI--FPNFAYIIKAVKCPSPDFDVKDGDVLKF 116

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   F+V   PGH+PG V + N +     +GDTLF+ S+GRTD+  G+ + L  S+  K+
Sbjct: 117 GNLEFQVIETPGHTPGSVCFFNEKEKIIFVGDTLFKGSVGRTDLPGGNGKMLEESL-KKL 175

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           + L ++     GHGP +TIG E+R NPF+
Sbjct: 176 MELPEDTVVYSGHGPKTTIGIEKRTNPFI 204


>gi|146308666|ref|YP_001189131.1| beta-lactamase domain-containing protein [Pseudomonas mendocina
           ymp]
 gi|145576867|gb|ABP86399.1| beta-lactamase domain protein [Pseudomonas mendocina ymp]
          Length = 215

 Score =  135 bits (341), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 73/204 (35%), Positives = 112/204 (54%), Gaps = 4/204 (1%)

Query: 11  VTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQ 70
           V P + NCT + D  + +A+VVDPGG+ D+I   +++    V  I  TH H+DH   + Q
Sbjct: 16  VGPLQCNCTIIGDPLTKKAIVVDPGGNPDLIMARLEAHGLKVVSIIHTHAHLDHFLASGQ 75

Query: 71  LKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFKV 130
           +KE    T+   HK+D  +   ++ Q R+  +      A  DRWL D + L  G  +   
Sbjct: 76  MKEKTGATL-HLHKEDQFLWDNLEMQCRMFGVPYTPVPAP-DRWLADDEELACGCGV--A 131

Query: 131 FHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEI 190
            H PGH+PG + +   +      GDTLFR  IGRTD+  GDY  +  SI  ++  L ++ 
Sbjct: 132 LHTPGHTPGSMSFWFADAKLLIAGDTLFRRGIGRTDLWGGDYATIERSIRQRLYRLDEDA 191

Query: 191 SFVCGHGPNSTIGRERRLNPFLKS 214
           + V GHGP++ +G E R NPF+++
Sbjct: 192 TVVTGHGPDTRLGDEMRENPFIRA 215


>gi|291279802|ref|YP_003496637.1| metallo-beta-lactamase family protein [Deferribacter desulfuricans
           SSM1]
 gi|290754504|dbj|BAI80881.1| metallo-beta-lactamase family protein [Deferribacter desulfuricans
           SSM1]
          Length = 208

 Score =  135 bits (341), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 75/210 (35%), Positives = 113/210 (53%), Gaps = 4/210 (1%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +   +V V     NC  +   ++ +A+++DPG D + IK  I S       I  THGH D
Sbjct: 1   MKIDVVIVGDLYVNCYII--SKNKDAIIIDPGSDFEKIKSFIDSNGLKPLAIVNTHGHFD 58

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG    LK + ++ +   H+ D  ++    E A +  I    ++++ D +L+D   L  
Sbjct: 59  HVGAIEDLKSEYNIPLY-MHEGDEFLLKNAVEHASMFGI-FGIKSSNIDNYLEDNQLLDF 116

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    KV H PGHSPG V     E      GDTLF+ S+GRTD  + D+  L NSI NK+
Sbjct: 117 GDIKLKVLHTPGHSPGGVSLYLGEAKVVFTGDTLFKDSVGRTDFPYADFNTLANSIKNKL 176

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
             L D+++   GHGP+STIG E+++N F++
Sbjct: 177 YVLDDDVTVYPGHGPSSTIGYEKKMNAFVR 206


>gi|206889881|ref|YP_002248933.1| metallo-beta-lactamase family protein [Thermodesulfovibrio
           yellowstonii DSM 11347]
 gi|206741819|gb|ACI20876.1| metallo-beta-lactamase family protein [Thermodesulfovibrio
           yellowstonii DSM 11347]
          Length = 209

 Score =  135 bits (341), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 73/202 (36%), Positives = 109/202 (53%), Gaps = 4/202 (1%)

Query: 10  QVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAA 69
           +V P   NC  ++DE + EAVV+DPG + D+I D I+  N ++K I  THGH DH+G   
Sbjct: 7   EVGPLFVNCYIIYDERTKEAVVIDPGDEPDLILDFIKEENLNLKYILCTHGHFDHIGSVK 66

Query: 70  QLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFK 129
           +L+++    ++   KD            +   I +  +    D  +++G+ L  G     
Sbjct: 67  ELRDETGAKVVLHEKDIEIYRNSPQIAMQFFGIEIEPQ-PEPDILIKNGEILNTGNIQLT 125

Query: 130 VFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDE 189
           V H  GHSPG V +  + + +   GDTLF  S+GRTDI+ G   +L+NS+  KI  L DE
Sbjct: 126 VIHTSGHSPGSVCF--YTDGYIFTGDTLFAGSVGRTDIIGGSMNELLNSL-KKIASLPDE 182

Query: 190 ISFVCGHGPNSTIGRERRLNPF 211
                GHGP + IG E++ NPF
Sbjct: 183 TIVFPGHGPKTKIGIEKKTNPF 204


>gi|301063229|ref|ZP_07203778.1| metallo-beta-lactamase domain protein [delta proteobacterium
           NaphS2]
 gi|300442657|gb|EFK06873.1| metallo-beta-lactamase domain protein [delta proteobacterium
           NaphS2]
          Length = 190

 Score =  135 bits (340), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 81/206 (39%), Positives = 109/206 (52%), Gaps = 20/206 (9%)

Query: 9   VQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGA 68
           + V P++ NC  L  +++ E VV+DPG +   I   I     +++ I ITHGHVDHVG A
Sbjct: 5   IVVGPYQANCYILGCDKTKEGVVIDPGDEAVRIVTEISKLGLNIRYILITHGHVDHVGAA 64

Query: 69  AQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIF 128
            +LK +++   +  H  DA  +G                   SD  L +G  +  G    
Sbjct: 65  GELK-NVTKAPVWIHPQDAGALG-----------------FPSDGDLFEGQKISWGEFTL 106

Query: 129 KVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGD 188
            V H PGHS G V +      F   GDTLF  SIGRTD   G++QQLI  + NKI PLGD
Sbjct: 107 SVIHTPGHSAGGVCFHAPGAVFT--GDTLFAGSIGRTDFPGGNHQQLIQGVINKIFPLGD 164

Query: 189 EISFVCGHGPNSTIGRERRLNPFLKS 214
            +    GHGP+STIG+ER+ NPF + 
Sbjct: 165 ALRVYPGHGPHSTIGQERKFNPFFRG 190


>gi|56964264|ref|YP_175995.1| hypothetical protein ABC2499 [Bacillus clausii KSM-K16]
 gi|56910507|dbj|BAD65034.1| conserved hypothetical protein [Bacillus clausii KSM-K16]
          Length = 209

 Score =  135 bits (340), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 75/214 (35%), Positives = 115/214 (53%), Gaps = 22/214 (10%)

Query: 9   VQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGA 68
           + + P + N   L++E+  EAV+ DPGGD     + I+ +    + I +TH H DH+G  
Sbjct: 5   IPLGPLQTNAYVLYNEKK-EAVLFDPGGDGAAFVNWIREQKLTPQAILLTHAHFDHIGAL 63

Query: 69  AQLKEDLSLTI----------IGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDG 118
            ++++  +  +          + P K+ +A MG           R   +   +D  L+D 
Sbjct: 64  EEVRQAFACPVYLHEAEKQWLLDPLKNGSARMG-----------RQPIKTKPADHLLKDE 112

Query: 119 DTLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINS 178
            TL +G+  FK+FH PGHSPG V Y   + N    GD LF+  IGRTD+  G+++ L+ S
Sbjct: 113 GTLKVGSFSFKLFHTPGHSPGSVSYYVADENIVFSGDALFQQGIGRTDLFGGNHELLVQS 172

Query: 179 INNKILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           I+NK+L L +E     GHGP +TIG+E   NPFL
Sbjct: 173 IHNKLLTLPEETIVASGHGPLTTIGQEMDHNPFL 206


>gi|225175876|ref|ZP_03729869.1| beta-lactamase domain protein [Dethiobacter alkaliphilus AHT 1]
 gi|225168800|gb|EEG77601.1| beta-lactamase domain protein [Dethiobacter alkaliphilus AHT 1]
          Length = 205

 Score =  135 bits (340), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 81/205 (39%), Positives = 109/205 (53%), Gaps = 5/205 (2%)

Query: 9   VQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGA 68
           ++V  F  NC  L  +E+ E VVVDPG D   I  +++    +VK I  THGHVDHVG  
Sbjct: 6   MEVGSFAANCYLLACDETKEGVVVDPGADARRILKMVEDNQVNVKYIINTHGHVDHVGAN 65

Query: 69  AQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIF 128
            +++E L   I+  H+ D  M  K    A L +       A  DR ++  DT  +G    
Sbjct: 66  EEVREALGAPIL-IHEADGEMCKK--PHASLSTFLGKKTLAEPDRLIKGKDTFTVGNLTI 122

Query: 129 KVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGD 188
           +V   PGH+ G V  +     F   GDTLF  SIGRTD+  G + ++I SI  K+L   D
Sbjct: 123 EVIETPGHTKGCVTLLVDGKLFT--GDTLFAGSIGRTDLPGGSFDEIIRSIKEKLLVFPD 180

Query: 189 EISFVCGHGPNSTIGRERRLNPFLK 213
           E     GHGP STIG E++ NPFL+
Sbjct: 181 ETPVFPGHGPESTIGDEKQYNPFLR 205


>gi|15895540|ref|NP_348889.1| metallo-beta-lactamase superfamily Zn-dependent hydrolase
           [Clostridium acetobutylicum ATCC 824]
 gi|15025276|gb|AAK80229.1|AE007728_8 Predicted Zn-dependent hydrolase of metallo-beta-lactamase
           superfamily [Clostridium acetobutylicum ATCC 824]
 gi|325509688|gb|ADZ21324.1| Zn-dependent hydrolase of metallo-beta-lactamase superfamily
           [Clostridium acetobutylicum EA 2018]
          Length = 199

 Score =  135 bits (340), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 73/209 (34%), Positives = 116/209 (55%), Gaps = 10/209 (4%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +   ++Q   +  NC  L DE+S E+VV+DPG     I +  +    ++K + +THGH D
Sbjct: 1   MKISVIQAGAYMTNCYILVDEKSNESVVIDPGDAPQAILEAFKDTETNLKFVLLTHGHAD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H    A+LK++ ++ +   +KDD  ++    E    +      ++ ++ +++ DGD L  
Sbjct: 61  HTAAVAELKKEYNVDVY-MNKDDCKLI----ENGEYM---FGDKSENATKYVDDGDELQF 112

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    K    PGH+PG + Y+   +N+   GDTLF SSIGRTD   GD+  LINSI +K+
Sbjct: 113 GELKIKCIKTPGHTPGGMCYL--VDNYLFSGDTLFNSSIGRTDFPGGDFSTLINSIKSKL 170

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           + L + I    GHG  +TIG E+  NPF+
Sbjct: 171 MKLDENIVVYPGHGEGTTIGYEKIHNPFI 199


>gi|168699564|ref|ZP_02731841.1| beta-lactamase domain protein [Gemmata obscuriglobus UQM 2246]
          Length = 214

 Score =  135 bits (340), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 74/207 (35%), Positives = 109/207 (52%), Gaps = 3/207 (1%)

Query: 9   VQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGA 68
           V+  PF +N   ++ + S EA V+DPG + D+I++ +  R   +  +  THGH DH+ G 
Sbjct: 8   VESQPFAENSYLVWKDGSPEAFVIDPGFEPDLIEEALAERGLKLVALVCTHGHCDHIAGN 67

Query: 69  AQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIF 128
           A LK+      I     DAAM+   ++            +  +DR + +G+TL +     
Sbjct: 68  AALKQAHPEAPIVIGAGDAAMLTDANKNLSG-PFGFEVLSPPADRVVGEGETLTVAGIAL 126

Query: 129 KVFHCPGHSPGHVIYVNFENNFAHL--GDTLFRSSIGRTDILHGDYQQLINSINNKILPL 186
           +VF  PGHSPGHV+YV  E     +  GD LFR  +GRTD   G ++QL   I   + PL
Sbjct: 127 EVFEVPGHSPGHVVYVVRETQPVTVLGGDVLFRGGVGRTDFPGGSFEQLKAGIQRVLWPL 186

Query: 187 GDEISFVCGHGPNSTIGRERRLNPFLK 213
             +     GHGP +TIG E+R NPF+ 
Sbjct: 187 PADAVVYPGHGPVTTIGHEKRTNPFVA 213


>gi|295695641|ref|YP_003588879.1| Hydroxyacylglutathione hydrolase [Bacillus tusciae DSM 2912]
 gi|295411243|gb|ADG05735.1| Hydroxyacylglutathione hydrolase [Bacillus tusciae DSM 2912]
          Length = 219

 Score =  135 bits (339), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 84/205 (40%), Positives = 112/205 (54%), Gaps = 13/205 (6%)

Query: 17  NCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLKEDLS 76
           NC ++   E   AVV+DPGG L+ I+D +Q +   V+ I +THGH DH+ G   L+E   
Sbjct: 14  NC-YIVSGEDGGAVVIDPGGPLEPIEDYLQKQGLVVRAILLTHGHADHLAGLEALRERTG 72

Query: 77  LTIIGPHKDDAAMMGKVDEQARLLSIRMNAR--NASSDRWLQDGDTLLLGTHIFKVFHCP 134
             +   H+ DA M+    + AR LS  M        +D  L+DGD L +G  + KV H P
Sbjct: 73  APVY-VHEADAEML---TDPARNLSAFMGRPVICRPADHRLKDGDVLEVGGLMVKVLHTP 128

Query: 135 GHSPGHVIY-VNFENNFAH-----LGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGD 188
           GH+PG V   +  +  F H      GDTLF  SIGRTD   G Y+ L+ SI   +LP  D
Sbjct: 129 GHTPGGVCLDIAPQGAFIHPRVVFTGDTLFAGSIGRTDFPGGSYETLLASIRRALLPYED 188

Query: 189 EISFVCGHGPNSTIGRERRLNPFLK 213
           +     GH  +STIG ERR NPFL+
Sbjct: 189 DTVIYPGHEEDSTIGDERRFNPFLQ 213


>gi|146281505|ref|YP_001171658.1| metallo-beta-lactamase family protein [Pseudomonas stutzeri A1501]
 gi|145569710|gb|ABP78816.1| metallo-beta-lactamase family protein [Pseudomonas stutzeri A1501]
          Length = 214

 Score =  135 bits (339), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 73/204 (35%), Positives = 111/204 (54%), Gaps = 4/204 (1%)

Query: 11  VTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQ 70
           V P + NCT + D  S +A+VVDPGGD ++I   +++    V  I  TH H+DH   + +
Sbjct: 15  VGPLQCNCTIIGDPLSKKAIVVDPGGDPELIMARLEAHGLKVVSIIHTHAHLDHFLASGK 74

Query: 71  LKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFKV 130
           +KE    T+   HK D  +   ++ Q R+  +      A  DRWL D + L  G  +   
Sbjct: 75  MKERTGATL-HLHKADQFLWDNLEMQCRMFGVPYTPVPAP-DRWLADDEELACGCGV--A 130

Query: 131 FHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEI 190
            H PGH+PG + +   +      GDTLFR  IGRTD+  GDY  +  SI  ++  L ++ 
Sbjct: 131 LHTPGHTPGSMSFWFADAKLLIAGDTLFRRGIGRTDLWGGDYASIERSIRQRLYALDEDA 190

Query: 191 SFVCGHGPNSTIGRERRLNPFLKS 214
           + V GHGP++ +G E R NPF+++
Sbjct: 191 TVVTGHGPDTRLGDEMRENPFVRA 214


>gi|331269252|ref|YP_004395744.1| metallo-beta-lactamase family protein [Clostridium botulinum
           BKT015925]
 gi|329125802|gb|AEB75747.1| metallo-beta-lactamase family protein [Clostridium botulinum
           BKT015925]
          Length = 201

 Score =  135 bits (339), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 75/199 (37%), Positives = 109/199 (54%), Gaps = 8/199 (4%)

Query: 14  FKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLKE 73
           +  NC  L DEE++   ++DPGGD D + ++I   N  VK I +THGH+DHV G   L++
Sbjct: 11  YGANCYILIDEETMVGCIIDPGGDADRLANIIDEFNIEVKFILLTHGHMDHVEGVEILRQ 70

Query: 74  DLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFKVFHC 133
             ++ +    KD   M    +   R+ +        S D+ L+DG+ L LG    K    
Sbjct: 71  KYNVPVYINGKDKELMEKGTEVFGRIWN------KTSEDKELKDGEMLKLGNLDIKCMET 124

Query: 134 PGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEISFV 193
           PGH+PG + ++   NN    GDTLFR S+GR D+  G+  QLI SI +K++ L DEI  +
Sbjct: 125 PGHTPGGMSFL--VNNVVFTGDTLFRGSVGRCDLPGGNQSQLIESIKSKLMILDDEIVVL 182

Query: 194 CGHGPNSTIGRERRLNPFL 212
            GH   S I  E++ NPF 
Sbjct: 183 PGHEGESNIRFEKQYNPFF 201


>gi|83590514|ref|YP_430523.1| Beta-lactamase-like [Moorella thermoacetica ATCC 39073]
 gi|83573428|gb|ABC19980.1| Beta-lactamase-like protein [Moorella thermoacetica ATCC 39073]
          Length = 207

 Score =  135 bits (339), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 80/205 (39%), Positives = 108/205 (52%), Gaps = 9/205 (4%)

Query: 11  VTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQ 70
           V P   NC  +   E+ E  V+DPG + + I    +    ++KQI  THGH DH+G    
Sbjct: 8   VGPLGANCYLIGCPETGEGAVIDPGAEGERILAAAREAGLNIKQIINTHGHGDHIGANGA 67

Query: 71  LKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNAS--SDRWLQDGDTLLLG-THI 127
           +K      I+  H+ DA  +    +  R LS+ + +R AS  +DR L++ DT+ +G T  
Sbjct: 68  IKAATGAAIL-IHRADAHYL---TDPGRNLSVLLGSREASPPADRLLEEDDTIAIGKTVT 123

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
            +V H PGH+PG +            GDTLF  SIGRTD   G Y QLI+SI  K+  L 
Sbjct: 124 LRVIHTPGHTPGGICL--HGEGLVFTGDTLFAGSIGRTDFPGGSYSQLISSIKEKLFTLD 181

Query: 188 DEISFVCGHGPNSTIGRERRLNPFL 212
           D +    GHGP STIG ER  NPF 
Sbjct: 182 DALEVYPGHGPASTIGAERVDNPFF 206


>gi|150016420|ref|YP_001308674.1| beta-lactamase domain-containing protein [Clostridium beijerinckii
           NCIMB 8052]
 gi|149902885|gb|ABR33718.1| beta-lactamase domain protein [Clostridium beijerinckii NCIMB 8052]
          Length = 198

 Score =  134 bits (337), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 75/199 (37%), Positives = 113/199 (56%), Gaps = 11/199 (5%)

Query: 14  FKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLKE 73
           +++NC  + DE + E  ++DPGG  ++I+  I   +   K I +THGH+DHVG   +L  
Sbjct: 11  YEENCYLIMDEGTKELAIIDPGGQPNLIEKEISRLDGKPKFILLTHGHMDHVGAVIELMN 70

Query: 74  DLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFKVFHC 133
            L++       ++  M  K DE        +      + ++L++GDT+ LG +I KV   
Sbjct: 71  KLNIPFYISENEEQYM--KNDE-------FVFGSLPKASKYLKEGDTVSLGNNIIKVIET 121

Query: 134 PGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEISFV 193
            GH+ G + ++  +  F   GDTLF+ SIGR+D   G+  QLI +I  K+LPLGD +   
Sbjct: 122 AGHTAGGICFLVNDELFT--GDTLFQGSIGRSDFPGGNGAQLIKNIKEKLLPLGDGVKVY 179

Query: 194 CGHGPNSTIGRERRLNPFL 212
            GHGP STIG E+R NPFL
Sbjct: 180 PGHGPASTIGYEKRNNPFL 198


>gi|108803964|ref|YP_643901.1| beta-lactamase-like protein [Rubrobacter xylanophilus DSM 9941]
 gi|108765207|gb|ABG04089.1| beta-lactamase-like protein [Rubrobacter xylanophilus DSM 9941]
          Length = 214

 Score =  134 bits (337), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 71/208 (34%), Positives = 115/208 (55%), Gaps = 4/208 (1%)

Query: 9   VQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGA 68
           + V  F++NC  L DE S    +VDPG +   I   ++     +++I +TH H+DHVG  
Sbjct: 6   LTVGTFQENCYILGDEASGSGALVDPGDEAVRIALAVEQTGLEIEKILLTHAHIDHVGAV 65

Query: 69  AQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIF 128
           A L E+    ++  H++   ++ ++  QA ++ +R   +    D +++D + + +G    
Sbjct: 66  ASLVEEYGCPVLA-HRESEPLLEQLPTQALMMGLRFG-KVPRLDGYIEDRERVEVGGLTL 123

Query: 129 KVFHCPGHSPGHVIYVNFENNFAHL-GDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
           +  + PGH+PGH+ +   E+  A L GD LF  S+GRTD+  GD   L+ SI  ++L L 
Sbjct: 124 EALYTPGHAPGHLAFY-LESEGALLSGDALFAGSVGRTDLPGGDAGLLMRSIKERMLVLP 182

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLKSN 215
           DE     GHGP +TIG ER  NPFL+  
Sbjct: 183 DETVVHPGHGPQTTIGNERAYNPFLQQG 210


>gi|170723578|ref|YP_001751266.1| beta-lactamase domain-containing protein [Pseudomonas putida W619]
 gi|169761581|gb|ACA74897.1| beta-lactamase domain protein [Pseudomonas putida W619]
          Length = 214

 Score =  134 bits (337), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 76/218 (34%), Positives = 117/218 (53%), Gaps = 8/218 (3%)

Query: 1   MSKLSFHIVQVT----PFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIW 56
           M K S  +++ T    P + NCT + D  + +A+VVDPGGD D I   +Q+    +  I 
Sbjct: 1   MEKASLALIRETFPVGPLQCNCTLIGDPLTKKAIVVDPGGDPDKILARLQAHGLTLVSII 60

Query: 57  ITHGHVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQ 116
            TH H DH   + +LKE L+   +  HKDD  +   ++ Q ++  +       S DRWL 
Sbjct: 61  HTHAHFDHFLASGKLKE-LTGATLHLHKDDQVLWDNLEMQCQMFGVPYTP-VPSPDRWLG 118

Query: 117 DGDTLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLI 176
           D + L  G  +    H PGH+PG + +   +      GDTLFR  IGRTD+  GD + ++
Sbjct: 119 DDEALACGCGV--ALHTPGHTPGSMSFWFADAKLLVAGDTLFRRGIGRTDLWGGDQRAIV 176

Query: 177 NSINNKILPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
            SI  ++  L ++   V GHGP++ +G E R NPF+++
Sbjct: 177 RSIKERLYRLDEDAIVVTGHGPDTRLGDEMRENPFVRA 214


>gi|253682453|ref|ZP_04863250.1| metallo-beta-lactamase family protein [Clostridium botulinum D str.
           1873]
 gi|253562165|gb|EES91617.1| metallo-beta-lactamase family protein [Clostridium botulinum D str.
           1873]
          Length = 201

 Score =  134 bits (337), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 74/199 (37%), Positives = 106/199 (53%), Gaps = 8/199 (4%)

Query: 14  FKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLKE 73
           +  NC  L DEE++   ++DPGGD D + ++I   N  +K I +THGH+DHVGG   L+E
Sbjct: 11  YGANCYILIDEETMVGCIIDPGGDADRLANIIDELNIEIKFILLTHGHMDHVGGVEVLRE 70

Query: 74  DLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFKVFHC 133
             ++ +    KD   M        R+            D+ L+D + + LG+   +    
Sbjct: 71  KYNVPVYINGKDKELMEKGTQVFGRIWG------KTPEDKELKDEEIIKLGSLDIRCIET 124

Query: 134 PGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEISFV 193
           PGH+PG + +    NN    GDTLF  S+GR D+  G+  QLI SI NK++ L DEI  +
Sbjct: 125 PGHTPGGMSF--LVNNVVFTGDTLFHGSVGRCDLPGGNQSQLIESIKNKLMVLDDEIVVL 182

Query: 194 CGHGPNSTIGRERRLNPFL 212
            GH   S I  ER+ NPFL
Sbjct: 183 PGHEGESNIKFERQYNPFL 201


>gi|70732414|ref|YP_262170.1| metallo-beta-lactamase family protein [Pseudomonas fluorescens
           Pf-5]
 gi|68346713|gb|AAY94319.1| metallo-beta-lactamase family protein [Pseudomonas fluorescens
           Pf-5]
          Length = 214

 Score =  134 bits (337), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 111/204 (54%), Gaps = 4/204 (1%)

Query: 11  VTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQ 70
           V P + NCT + D  + +A+VVDPGG+ D+I   + +    V  I  TH H+DH   + Q
Sbjct: 15  VGPLQCNCTIIGDPLTKKAIVVDPGGNPDLIMARLDALGLKVVSIIHTHAHLDHFLASGQ 74

Query: 71  LKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFKV 130
           +KE    T+   HKDD  +   ++ Q  +  +       S DRWL D + L  G  +   
Sbjct: 75  MKEKTGATL-HLHKDDQFLWDNLEMQCSMFGVPYTPV-PSPDRWLGDDEELACGCGV--A 130

Query: 131 FHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEI 190
            H PGH+PG + +   E     +GDTLF+  +GRTD+  GD   L+ SI  ++  L ++ 
Sbjct: 131 LHTPGHTPGSMSFWFSEAKLLIVGDTLFKRGVGRTDLWGGDQATLVRSIKQRLYTLDEDA 190

Query: 191 SFVCGHGPNSTIGRERRLNPFLKS 214
           + V GHGP++ +G E R NPF+++
Sbjct: 191 TVVAGHGPDTRLGDEMRQNPFVRA 214


>gi|224370205|ref|YP_002604369.1| putative metallo-beta-lactamase family protein [Desulfobacterium
           autotrophicum HRM2]
 gi|223692922|gb|ACN16205.1| putative metallo-beta-lactamase family protein [Desulfobacterium
           autotrophicum HRM2]
          Length = 208

 Score =  134 bits (336), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 77/204 (37%), Positives = 109/204 (53%), Gaps = 4/204 (1%)

Query: 9   VQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGA 68
           ++V P   NC  L  + + +AVV+DPG + D I   +      V+ I  THGH DHVG  
Sbjct: 6   LEVGPIMANCYILGCDRTRKAVVIDPGDEADRILMALSELKLSVEYILNTHGHFDHVGAN 65

Query: 69  AQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIF 128
           A+LKE     ++  H+DDA M+  +   A    +R    + + D +L DGD +  G    
Sbjct: 66  ARLKEATGAKLM-IHQDDAPMLKDLTSAAATFGLRAE-NSPAPDGYLADGDEVTFGDITL 123

Query: 129 KVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGD 188
            V H PGHS G +    +       GDTLF  SIGRTD+  G+Y  LI+SI  ++L L  
Sbjct: 124 TVIHTPGHSRGGISL--YTKGVLFSGDTLFAGSIGRTDLPGGNYDTLIHSIKTRLLCLDK 181

Query: 189 EISFVCGHGPNSTIGRERRLNPFL 212
           +     GHGP ++I +E R+NPFL
Sbjct: 182 KTIVYPGHGPETSILQEERMNPFL 205


>gi|94268959|ref|ZP_01291335.1| Beta-lactamase-like [delta proteobacterium MLMS-1]
 gi|93451399|gb|EAT02253.1| Beta-lactamase-like [delta proteobacterium MLMS-1]
          Length = 213

 Score =  134 bits (336), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 82/201 (40%), Positives = 108/201 (53%), Gaps = 7/201 (3%)

Query: 18  CTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLKEDLSL 77
           C  L  EES + + +DPGGD D I +  ++    +K +  THGH DHV G A LK++   
Sbjct: 15  CYLLGCEESGQVLAIDPGGDEDKILEHCRAAGLELKMLLCTHGHPDHVCGNAVLKKETGA 74

Query: 78  TIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFKVFHCPGHS 137
            II  H DDAA   K + Q     + + A +   DR LQDGDT++LGT   +V H PGH+
Sbjct: 75  EIIM-HGDDAAFFAKPEIQHYFSMLGLPA-SPPPDRLLQDGDTVVLGTIELQVIHTPGHT 132

Query: 138 PGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEISFVCGH- 196
           PG +      + F   GDTLF   +GRTD   GD   L+NS+  ++L L  E     GH 
Sbjct: 133 PGGICLYTAPHLFT--GDTLFVGGVGRTDFPGGDTATLVNSLQQRLLKLPPETVVWPGHG 190

Query: 197 --GPNSTIGRERRLNPFLKSN 215
             G  STIG E R NP+L   
Sbjct: 191 YGGARSTIGEEARDNPYLSEQ 211


>gi|26987508|ref|NP_742933.1| beta-lactamase domain protein [Pseudomonas putida KT2440]
 gi|24982175|gb|AAN66397.1|AE016267_6 metallo-beta-lactamase family protein [Pseudomonas putida KT2440]
          Length = 214

 Score =  134 bits (336), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 76/213 (35%), Positives = 113/213 (53%), Gaps = 4/213 (1%)

Query: 2   SKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGH 61
           S L      V P + NCT + D  + +A+VVDPGGD+D I   +Q     +  I  TH H
Sbjct: 6   SALIRETFPVGPLQCNCTLIGDPLTKKAIVVDPGGDVDKILARLQVHGLTLVSIIHTHAH 65

Query: 62  VDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
            DH   + +LKE L+   +  HKDD  +   ++ Q ++  +      A  DRWL D + L
Sbjct: 66  FDHFLASGKLKE-LTGATLHLHKDDQMLWDNLEMQCQMFGVPYTPVPAP-DRWLGDDEEL 123

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
             G  +    H PGH+PG + +   +      GDTLFR  IGRTD+  GD + ++ SI  
Sbjct: 124 ACGCGV--ALHTPGHTPGSMSFWFADAKLLIAGDTLFRRGIGRTDLWGGDQRAIVRSIKE 181

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           ++  L +E   V GHGP++ +G E R NPF+++
Sbjct: 182 RLYRLDEEAVVVTGHGPDTRLGDEMRENPFVRA 214


>gi|315924150|ref|ZP_07920376.1| metallo-beta-lactamase [Pseudoramibacter alactolyticus ATCC 23263]
 gi|315622552|gb|EFV02507.1| metallo-beta-lactamase [Pseudoramibacter alactolyticus ATCC 23263]
          Length = 211

 Score =  134 bits (336), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 79/211 (37%), Positives = 119/211 (56%), Gaps = 6/211 (2%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L      V P   NC   + +E  + V++DPGG    I   I  +   +K I +THGH D
Sbjct: 6   LEIQKYMVGPLMANCYIAWSQEDGQGVIIDPGGWRPEIAQFITDQAISIKAILLTHGHFD 65

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+GG  + +  L+   +  H DDA  +    +    L + M AR   ++  L+DGD +++
Sbjct: 66  HIGGLNEARA-LTGAPVYIHADDADCLNSPGKNIAAL-MGMTARFDPAEGLLRDGDDIVI 123

Query: 124 GTHI-FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
           G H+ FKV H PGH+PG V +++ +  F   GD+LF +SIGRTD   G Y QLI S+  K
Sbjct: 124 GDHLKFKVIHTPGHTPGGVCFLSDDVIFT--GDSLFCASIGRTDFPGGSYPQLIASV-KK 180

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           ++ L + ++ + GHG N+TIG ER  NPF++
Sbjct: 181 LMTLDEALTVLPGHGENTTIGFERTHNPFIQ 211


>gi|167031826|ref|YP_001667057.1| beta-lactamase domain-containing protein [Pseudomonas putida GB-1]
 gi|166858314|gb|ABY96721.1| beta-lactamase domain protein [Pseudomonas putida GB-1]
          Length = 214

 Score =  134 bits (336), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 74/204 (36%), Positives = 111/204 (54%), Gaps = 4/204 (1%)

Query: 11  VTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQ 70
           V P + NCT + D  + +A+VVDPGGD D I   +Q+    +  I  TH H DH   + +
Sbjct: 15  VGPLQCNCTLIGDPLTKKAIVVDPGGDPDKILARLQAHGLTLVSIIHTHAHFDHFLASGK 74

Query: 71  LKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFKV 130
           LKE L+   +  HKDD A+   ++ Q ++  +         DRWL D + L  G  +   
Sbjct: 75  LKE-LTGATLHLHKDDQALWDNLEMQCQMFGVPYTP-VPPPDRWLGDDEELACGCGV--A 130

Query: 131 FHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEI 190
            H PGH+PG + +   +      GDTLFR  IGRTD+  GD + ++ SI  ++  L +E 
Sbjct: 131 LHTPGHTPGSMSFWFADAKLLIAGDTLFRRGIGRTDLWGGDQRAIVRSIKERLYRLDEEA 190

Query: 191 SFVCGHGPNSTIGRERRLNPFLKS 214
             V GHGP++ +G E R NPF+++
Sbjct: 191 IVVTGHGPDTRLGDEMRENPFVRA 214


>gi|313497138|gb|ADR58504.1| Beta-lactamase domain protein [Pseudomonas putida BIRD-1]
          Length = 214

 Score =  134 bits (336), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 76/213 (35%), Positives = 113/213 (53%), Gaps = 4/213 (1%)

Query: 2   SKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGH 61
           S L      V P + NCT + D  + +A+VVDPGGD+D I   +Q     +  I  TH H
Sbjct: 6   SALIRETFPVGPLQCNCTLIGDPLTKKAIVVDPGGDVDKILARLQVHGLTLVSIIHTHAH 65

Query: 62  VDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
            DH   + +LKE L+   +  HKDD  +   ++ Q ++  +      A  DRWL D + L
Sbjct: 66  FDHFLASGKLKE-LTGATLHLHKDDQVLWDNLEMQCQMFGVPYTPVPAP-DRWLGDDEEL 123

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
             G  +    H PGH+PG + +   +      GDTLFR  IGRTD+  GD + ++ SI  
Sbjct: 124 ACGCGV--ALHTPGHTPGSMSFWFADAKLLIAGDTLFRRGIGRTDLWGGDQRAIVRSIKE 181

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           ++  L +E   V GHGP++ +G E R NPF+++
Sbjct: 182 RLYRLDEEAIVVTGHGPDTRLGDEMRENPFVRA 214


>gi|325272912|ref|ZP_08139239.1| beta-lactamase domain-containing protein [Pseudomonas sp. TJI-51]
 gi|324101956|gb|EGB99475.1| beta-lactamase domain-containing protein [Pseudomonas sp. TJI-51]
          Length = 237

 Score =  134 bits (336), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 74/204 (36%), Positives = 111/204 (54%), Gaps = 4/204 (1%)

Query: 11  VTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQ 70
           V P + NCT + D  S +A+VVDPGGD D I   +Q+    +  I  TH H DH   + +
Sbjct: 38  VGPLQCNCTLIGDPLSKKAIVVDPGGDPDKILARLQAHGLTLVSIIHTHAHFDHFLASGK 97

Query: 71  LKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFKV 130
           LK  L+   +  HK D A+   ++ Q ++  +       S DRWL D + L  G  +   
Sbjct: 98  LKA-LTGATLHLHKADQALWDNLEMQCQMFGVPYTP-VPSPDRWLADDEELACGCGV--A 153

Query: 131 FHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEI 190
            H PGH+PG + +   +      GDTLFR  IGRTD+  GD + ++ SI  ++  L +E 
Sbjct: 154 LHTPGHTPGSMSFWFADAKLLIAGDTLFRRGIGRTDLWGGDQRAIVRSIKERLYRLDEEA 213

Query: 191 SFVCGHGPNSTIGRERRLNPFLKS 214
           + V GHGP++ +G E R NPF+++
Sbjct: 214 TVVTGHGPDTRLGDEMRENPFVRA 237


>gi|284037894|ref|YP_003387824.1| beta-lactamase [Spirosoma linguale DSM 74]
 gi|283817187|gb|ADB39025.1| beta-lactamase domain protein [Spirosoma linguale DSM 74]
          Length = 213

 Score =  133 bits (335), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 72/208 (34%), Positives = 112/208 (53%), Gaps = 6/208 (2%)

Query: 10  QVTPFKQNCTFLFDEESLEAVVVDPG----GDLDIIKDVIQSRNFHVKQIWITHGHVDHV 65
           + +PF +N   + D+ + EAV++DPG     + + +   I S    VK + +TH H+DHV
Sbjct: 6   EFSPFHENTYVIADDATGEAVIIDPGCYEQAEKEALAHFITSNKLTVKYLLLTHSHLDHV 65

Query: 66  GGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGT 125
            G A +K    +     H+ D  +   V  +  L  +R     ++ D +L++GD    G 
Sbjct: 66  FGVAYVKRKFGVKAY-LHESDMVIYNDVPTRCALYGLR-GYEPSTIDAFLKEGDQFQFGN 123

Query: 126 HIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILP 185
            +  V   PGH+PGHV +VN ++ +   GD LF  S+GRTD  + ++  LINSI NK   
Sbjct: 124 TVLDVIFVPGHAPGHVAFVNHKDQYIVGGDVLFNGSVGRTDFPYCNHADLINSIRNKFFT 183

Query: 186 LGDEISFVCGHGPNSTIGRERRLNPFLK 213
           L D+     GH   +TIG+E+R NPF+K
Sbjct: 184 LPDDYIVYAGHMEPTTIGQEKRSNPFVK 211


>gi|77460925|ref|YP_350432.1| Beta-lactamase-like [Pseudomonas fluorescens Pf0-1]
 gi|77384928|gb|ABA76441.1| putative metallo-beta-lactamase family protein [Pseudomonas
           fluorescens Pf0-1]
          Length = 214

 Score =  133 bits (335), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 73/213 (34%), Positives = 113/213 (53%), Gaps = 4/213 (1%)

Query: 2   SKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGH 61
           S L      V P + NCT + D  + +A+VVDPGG+ D+I   + +    V  I  TH H
Sbjct: 6   SALLRETFPVGPLQCNCTIIGDPITKKAIVVDPGGNSDLIMARLDALGLKVVSIIHTHAH 65

Query: 62  VDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
           +DH   + Q+KE    T+   HK+D  +   ++ Q ++  +       S DRWL D + L
Sbjct: 66  LDHFLASGQMKEKTGATL-HLHKEDQFLWDNLEMQCQMFGVPYTPV-PSPDRWLSDDEEL 123

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
             G  +    H PGH+PG + +   E      GDTLFR  +GRTD+  GD   ++ SI  
Sbjct: 124 ACGCGV--ALHTPGHTPGSMSFWFSEAKLLIAGDTLFRRGVGRTDLWGGDQATIVRSIKQ 181

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           ++  L ++ + V GHGP++ +G E R NPF+++
Sbjct: 182 RLYTLDEDATVVAGHGPDTRLGDEMRENPFVRA 214


>gi|95929446|ref|ZP_01312189.1| beta-lactamase-like [Desulfuromonas acetoxidans DSM 684]
 gi|95134562|gb|EAT16218.1| beta-lactamase-like [Desulfuromonas acetoxidans DSM 684]
          Length = 209

 Score =  133 bits (335), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 77/207 (37%), Positives = 116/207 (56%), Gaps = 4/207 (1%)

Query: 9   VQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGA 68
           + V P + NC  +    + +A+V+DPG + D I +VI      VK +  THGH DHVG  
Sbjct: 6   LAVGPLQVNCYLVACPRTKQALVIDPGDEGDRILEVIDKLGLKVKMVVNTHGHFDHVGAN 65

Query: 69  AQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIF 128
            Q+     + +   H+DD  ++    +QA    +    ++    R+L++GD + +G   F
Sbjct: 66  HQILAVTGVELCM-HRDDLPLLKVAAKQAEGYGLPA-VQSPDPKRFLENGDLVEVGDLSF 123

Query: 129 KVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGD 188
           +V H PGHSPG +      + F+  GDTLF SSIGRTD+  GD  QL++ I ++++ L D
Sbjct: 124 EVIHTPGHSPGGICLYGEGHLFS--GDTLFASSIGRTDLPGGDMNQLLSHIRSQLMVLPD 181

Query: 189 EISFVCGHGPNSTIGRERRLNPFLKSN 215
                 GHGP STIGRE+ +NPFL  +
Sbjct: 182 ATVVHPGHGPESTIGREKTVNPFLNGD 208


>gi|306821794|ref|ZP_07455389.1| metallo-beta-lactamase [Eubacterium yurii subsp. margaretiae ATCC
           43715]
 gi|304550161|gb|EFM38157.1| metallo-beta-lactamase [Eubacterium yurii subsp. margaretiae ATCC
           43715]
          Length = 208

 Score =  133 bits (335), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 73/214 (34%), Positives = 118/214 (55%), Gaps = 10/214 (4%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + +  ++  PF +N    +DE+S +A ++DPGG  + I+D I  +  +VK + +THGH D
Sbjct: 1   MQYFRIRTFPFDENVYIFYDEQSSDACIIDPGGSFEKIRDFINKKKLNVKSVILTHGHAD 60

Query: 64  HVGGAAQ-LKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNAS--SDRWLQDGDT 120
           H+G   + L E   + +I   ++   +    +  A  L++    +N S  + R+++DGDT
Sbjct: 61  HIGALQEVLDEYPGIELIASKREKKIL----NSPAYNLTVNFGMKNNSFEATRYVEDGDT 116

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
             +G    K    PGH+ G +    F+      GDTLF  SIGRTD+  G YQ++ NS+ 
Sbjct: 117 YQIGGKTLKFLVTPGHTSGSMCI--FDGEIMFTGDTLFEGSIGRTDLPSGSYQEMENSLR 174

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
              L  G+ I  + GHG  STI +E+R NPFL++
Sbjct: 175 RLSLMDGN-IIILPGHGDQSTIAQEKRHNPFLRN 207


>gi|182420397|ref|ZP_02951619.1| metallo-beta-lactamase family protein [Clostridium butyricum 5521]
 gi|237668438|ref|ZP_04528422.1| hydroxyacylglutathione hydrolase [Clostridium butyricum E4 str.
           BoNT E BL5262]
 gi|182375763|gb|EDT73361.1| metallo-beta-lactamase family protein [Clostridium butyricum 5521]
 gi|237656786|gb|EEP54342.1| hydroxyacylglutathione hydrolase [Clostridium butyricum E4 str.
           BoNT E BL5262]
          Length = 199

 Score =  133 bits (335), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 74/211 (35%), Positives = 114/211 (54%), Gaps = 15/211 (7%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L+   V    ++ NC  L D E+ +  ++D GGD   I   ++S   + K + +THGH D
Sbjct: 2   LNLKTVPAGVYEANCYILVDSETKDCAIIDAGGDAGKISAAVESMQGNPKYLLLTHGHFD 61

Query: 64  HVGGAAQL--KEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
           HVGG  ++  K D+   I            K DE+       +      +  +L++GD +
Sbjct: 62  HVGGVKEICSKYDIPFYI-----------SKTDEEYMEKDNSVFGTLPKASGYLKEGDVV 110

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
            LG+   KV   PGH+ G + ++     F   GDTLF+ SIGRTD + GD +++I+SI N
Sbjct: 111 KLGSREIKVIETPGHTKGGLCFLIDGKLFT--GDTLFQGSIGRTDFIGGDMKEIISSIKN 168

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           K+LPLGD++    GHGP+S+I  E+  NP+L
Sbjct: 169 KLLPLGDDVEVYPGHGPSSSIKFEKMRNPYL 199


>gi|158320741|ref|YP_001513248.1| beta-lactamase domain-containing protein [Alkaliphilus oremlandii
           OhILAs]
 gi|158140940|gb|ABW19252.1| beta-lactamase domain protein [Alkaliphilus oremlandii OhILAs]
          Length = 206

 Score =  133 bits (335), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 72/202 (35%), Positives = 118/202 (58%), Gaps = 8/202 (3%)

Query: 14  FKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLKE 73
           +  NC  + DE++ +A VVDPGGD+D I  V+++ +  +K I +TH H DH+GG  +L+E
Sbjct: 11  YAVNCYVIGDEQTNKAAVVDPGGDVDKIIKVLENNDLELKYILLTHAHGDHIGGLVELRE 70

Query: 74  DLSLTIIGPHKDDAAMM--GKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFKVF 131
                +   H++D  M+    V+    +  +++     ++D +L DGD L LG     + 
Sbjct: 71  RTGAPVY-IHQEDLYMLQNSSVNYSQAISGVKIET---NADGFLNDGDRLELGDLTLSII 126

Query: 132 HCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEIS 191
           H PGHS G +       N    GDTLF +SIGR+D+  G+ ++LI SI NK+  L ++++
Sbjct: 127 HTPGHSKGGICIA--VGNVLLTGDTLFANSIGRSDLYGGNQEELIQSIKNKLFTLDEDLT 184

Query: 192 FVCGHGPNSTIGRERRLNPFLK 213
            + GHGP +TI  E+  NP+++
Sbjct: 185 VLPGHGPATTIRIEKITNPYVR 206


>gi|222056608|ref|YP_002538970.1| beta-lactamase domain protein [Geobacter sp. FRC-32]
 gi|221565897|gb|ACM21869.1| beta-lactamase domain protein [Geobacter sp. FRC-32]
          Length = 207

 Score =  133 bits (335), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 79/209 (37%), Positives = 110/209 (52%), Gaps = 6/209 (2%)

Query: 6   FHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHV 65
           F  + V     NC  L  EE+ E +VVDPG D + +  V+Q     ++ +  THGH DH+
Sbjct: 3   FETIVVGQLGVNCFILGCEETREGIVVDPGADAERVLAVVQKLGLKIRYVINTHGHFDHM 62

Query: 66  GGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASS-DRWLQDGDTLLLG 124
           GG   + E     ++  H+ D   + +  + A   S  + A N+S  D  LQDG  +  G
Sbjct: 63  GGNRSIIEKTGAKLL-IHESDVYFLSRAADSAA--SYGLKAENSSKPDDLLQDGMVVNFG 119

Query: 125 THIFKVFHCPGHSPGHV-IYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
            H  KV H PGH+PG   +Y+  E+     GDTLF  S+GRTD        LI+ I  K+
Sbjct: 120 KHQLKVLHTPGHTPGGCCLYLESEDKII-TGDTLFAESVGRTDFPGSSQADLIDGIRTKL 178

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           L L DE     GHGP++TIG E+R NP+L
Sbjct: 179 LVLPDETQAFPGHGPSTTIGHEKRHNPYL 207


>gi|330504867|ref|YP_004381736.1| beta-lactamase domain-containing protein [Pseudomonas mendocina
           NK-01]
 gi|328919153|gb|AEB59984.1| beta-lactamase domain-containing protein [Pseudomonas mendocina
           NK-01]
          Length = 215

 Score =  133 bits (334), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 73/204 (35%), Positives = 110/204 (53%), Gaps = 4/204 (1%)

Query: 11  VTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQ 70
           V P + NCT + D  + +AVVVDPGG+ D+I   + +    V  I  TH H+DH   + Q
Sbjct: 16  VGPLQCNCTIIGDPVTKKAVVVDPGGNPDLIMARLDAHGLKVVSIIHTHAHLDHFLASGQ 75

Query: 71  LKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFKV 130
           +KE    T+   HK+D  +   ++ Q  +  +      A  DRWL D + L  G  +   
Sbjct: 76  MKEKTGATL-HLHKEDQFLWDNLEMQCNMFGVPYTPVPAP-DRWLADDEELACGCGV--A 131

Query: 131 FHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEI 190
            H PGH+PG + +   +      GDTLFR  IGRTD+  GDY  +  SI  ++  L ++ 
Sbjct: 132 LHTPGHTPGSMSFWFEDAKLLIAGDTLFRRGIGRTDLWGGDYATIERSIRQRLYSLDEDA 191

Query: 191 SFVCGHGPNSTIGRERRLNPFLKS 214
           + V GHGP++ +G E R NPF+++
Sbjct: 192 TVVTGHGPDTRLGDEMRENPFIRA 215


>gi|153006430|ref|YP_001380755.1| beta-lactamase domain-containing protein [Anaeromyxobacter sp.
           Fw109-5]
 gi|152030003|gb|ABS27771.1| beta-lactamase domain protein [Anaeromyxobacter sp. Fw109-5]
          Length = 217

 Score =  133 bits (334), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 74/202 (36%), Positives = 106/202 (52%), Gaps = 3/202 (1%)

Query: 11  VTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQ 70
           V PF  N      + + EA++VDPGG+   +  +++   + V +I  THGH+DHV GAA+
Sbjct: 9   VGPFAANAYVAACDRTGEALLVDPGGETARVLALVEP-GWRVVRIVCTHGHIDHVAGAAE 67

Query: 71  LKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFKV 130
            KE     +   H  DA  +  +  QA +         A  D    DG++  +G    +V
Sbjct: 68  AKEATGAPV-SLHAGDAGWLEALPRQAEMFGFEPVVAPAV-DHHPGDGESFRVGASEGRV 125

Query: 131 FHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEI 190
            H PGHSPG +     +      GDTLF  S+GRTD+  GD+  L  SI  K+ PLGD++
Sbjct: 126 IHTPGHSPGSICLFFPQERLLFSGDTLFAGSVGRTDLPGGDFDALHASITGKLFPLGDDV 185

Query: 191 SFVCGHGPNSTIGRERRLNPFL 212
            F+ GHGP   +G ER  NPF+
Sbjct: 186 RFLPGHGPAGVVGEERLSNPFV 207


>gi|302391505|ref|YP_003827325.1| beta-lactamase [Acetohalobium arabaticum DSM 5501]
 gi|302203582|gb|ADL12260.1| beta-lactamase [Acetohalobium arabaticum DSM 5501]
          Length = 206

 Score =  133 bits (334), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 74/204 (36%), Positives = 107/204 (52%), Gaps = 3/204 (1%)

Query: 9   VQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGA 68
           + V     NC  L DEES +A+V+DPG +   I D++   +  +K I  THGH DH+G A
Sbjct: 6   IPVGSLGANCYMLGDEESGKAIVIDPGAEGAKILDLVNELSLELKYIVNTHGHYDHIG-A 64

Query: 69  AQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIF 128
            Q     S + +  H+DD+  +    +    LSI        +DR L +GD +  G    
Sbjct: 65  NQFLLQKSQSKLLIHQDDSEFLVDPKKNLSSLSISGKIEGPKADRLLTEGDEISCGKWEL 124

Query: 129 KVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGD 188
           +V H PGH+PG +  +   N    +GDT+F   +GRTD  +G  + L+ SI  K+LPL D
Sbjct: 125 EVIHTPGHTPGGITLLG--NGKLFVGDTIFARGVGRTDFPYGSKEVLMESIQEKLLPLAD 182

Query: 189 EISFVCGHGPNSTIGRERRLNPFL 212
           E+    GHGP   +G  +  NPFL
Sbjct: 183 ELEVFPGHGPKGKLGEIKASNPFL 206


>gi|290968826|ref|ZP_06560363.1| metallo-beta-lactamase domain protein [Megasphaera genomosp. type_1
           str. 28L]
 gi|290781122|gb|EFD93713.1| metallo-beta-lactamase domain protein [Megasphaera genomosp. type_1
           str. 28L]
          Length = 213

 Score =  132 bits (333), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 69/213 (32%), Positives = 112/213 (52%), Gaps = 4/213 (1%)

Query: 3   KLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHV 62
            + + +  + P   NC  ++D E++EA+V+DP    + I   +Q     +K+I +THGH 
Sbjct: 2   SMKYDVTVLGPVMTNCYIVYDTETMEAMVIDPSWSCETIAANLQRLGVTLKRIVLTHGHA 61

Query: 63  DHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLL 122
           DH+G    L++   + +     D   +    +  +  +   +     S D   +DGD + 
Sbjct: 62  DHIGALQDLRQQYQVPVYVGAGDKDLITNSRNNMSLFVGKEIVCD--SPDYIAEDGDIIA 119

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
           +G   FKV   PGH+PG +        F+  GDTLFR S+GRTD+  G ++ L+ SIN+K
Sbjct: 120 VGKLQFKVITTPGHTPGGICLYGSRTLFS--GDTLFRYSVGRTDLYGGAWETLLQSINDK 177

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFLKSN 215
           ++ L D    + GHGP +TIG ER  NP+L  +
Sbjct: 178 LMVLPDSTLVLPGHGPATTIGEERTGNPYLDGD 210


>gi|148546043|ref|YP_001266145.1| beta-lactamase domain-containing protein [Pseudomonas putida F1]
 gi|148510101|gb|ABQ76961.1| beta-lactamase domain protein [Pseudomonas putida F1]
          Length = 238

 Score =  132 bits (332), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 74/204 (36%), Positives = 111/204 (54%), Gaps = 4/204 (1%)

Query: 11  VTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQ 70
           V P + NCT + D  + +A+VVDPGGD+D I   +Q     +  I  TH H DH   + +
Sbjct: 39  VGPLQCNCTLIGDPLTKKAMVVDPGGDVDKILARLQVHGLTLVSIIHTHAHFDHFLASGK 98

Query: 71  LKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFKV 130
           LKE L+   +  HKDD  +   ++ Q ++  +      A  DRWL D + L  G  +   
Sbjct: 99  LKE-LTGATLHLHKDDQMLWDNLEMQCQMFGVPYTPVPAP-DRWLGDDEELACGCGV--A 154

Query: 131 FHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEI 190
            H PGH+PG + +   +      GDTLFR  IGRTD+  GD + ++ SI  ++  L +E 
Sbjct: 155 LHTPGHTPGSMSFWFADAKLLIAGDTLFRRGIGRTDLWGGDQRAIVRSIKERLYRLDEEA 214

Query: 191 SFVCGHGPNSTIGRERRLNPFLKS 214
             V GHGP++ +G E R NPF+++
Sbjct: 215 IVVTGHGPDTRLGDEMRENPFVRA 238


>gi|77919608|ref|YP_357423.1| hypothetical protein Pcar_2012 [Pelobacter carbinolicus DSM 2380]
 gi|77545691|gb|ABA89253.1| conserved hypothetical protein [Pelobacter carbinolicus DSM 2380]
          Length = 213

 Score =  132 bits (332), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 72/196 (36%), Positives = 106/196 (54%), Gaps = 3/196 (1%)

Query: 17  NCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLKEDLS 76
           NC  L   ++ +AVV+DPGG+   I   ++ + F +K +  THGH DH+GG   L +   
Sbjct: 17  NCYLLGCPKTRQAVVIDPGGNGSSILAELEKQGFELKAVINTHGHFDHIGGNKTLIDQTG 76

Query: 77  LTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFKVFHCPGH 136
             ++  H +   ++      A     R    +    R LQDGD + +G+ + +V H PGH
Sbjct: 77  ADLL-LHAEALPLLRGASSHAASFGCRAIDPSPEPTRLLQDGDRIEVGSIVLEVLHVPGH 135

Query: 137 SPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEISFVCGH 196
           SPG V     E  FA  GD LF  SIGRTD+  GD+  L+  + +++L L D +    GH
Sbjct: 136 SPGSVCLKCGEALFA--GDVLFAGSIGRTDLPGGDHHLLLKGLQSRVLTLADSVKVYPGH 193

Query: 197 GPNSTIGRERRLNPFL 212
           GP +TIG ER+ NP+L
Sbjct: 194 GPATTIGHERKNNPYL 209


>gi|296132726|ref|YP_003639973.1| Hydroxyacylglutathione hydrolase [Thermincola sp. JR]
 gi|296031304|gb|ADG82072.1| Hydroxyacylglutathione hydrolase [Thermincola potens JR]
          Length = 206

 Score =  132 bits (332), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 79/212 (37%), Positives = 113/212 (53%), Gaps = 10/212 (4%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           ++   + V P   NC  +  EE+ EA V+DPGGD   I   + ++   +K I  THGH+D
Sbjct: 1   MNIKSMAVGPMGANCYIVSCEETKEAAVIDPGGDAAKIISYLNNQGLQLKYIINTHGHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARL-LSIRMNA--RNASSDRWLQDGDT 120
           H+    +LKE     ++  H  DAAM+    E   L LS  M    R   +DR L +GD 
Sbjct: 61  HIAANEELKEKTGAELL-IHTQDAAML----ENPNLNLSAFMGVPVRQQPADRLLNEGDE 115

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           + +G    KV H PGH+ G +  +  +  F   GDTLF  SIGRTD   G + ++I SI 
Sbjct: 116 IEIGNVKLKVIHTPGHTRGGICLLAGDVVFT--GDTLFAGSIGRTDFPGGSFDEIIRSIK 173

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
            K++ L D+     GH   S+IG+E++ NPFL
Sbjct: 174 TKLMTLPDDTEVYPGHMGKSSIGQEKKYNPFL 205


>gi|152985724|ref|YP_001350032.1| hypothetical protein PSPA7_4688 [Pseudomonas aeruginosa PA7]
 gi|150960882|gb|ABR82907.1| conserved hypothetical protein [Pseudomonas aeruginosa PA7]
          Length = 207

 Score =  132 bits (332), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 73/203 (35%), Positives = 111/203 (54%), Gaps = 4/203 (1%)

Query: 11  VTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQ 70
           V P + NCT + D  + +A+VVDPGGD ++I   ++     V  I  TH H+DH   + +
Sbjct: 8   VGPLQCNCTIIGDPLTKKAIVVDPGGDHELILQRLERLGLQVVSIVHTHAHLDHFLASGE 67

Query: 71  LKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFKV 130
           LK+    ++   HKDD  +   ++ Q +L  +  N   A  DRWL D + L  G  +   
Sbjct: 68  LKKRTGASL-HLHKDDQFLWDNLEMQCQLFGVPYNPVPAP-DRWLADDEELACGCGV--A 123

Query: 131 FHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEI 190
            H PGH+PG + +   +      GDTLFR  IGRTD+  GD   +  SI  ++  L ++ 
Sbjct: 124 LHTPGHTPGSMSFWFPQAKLLVAGDTLFRRGIGRTDLWGGDSAAIQRSIKQRLYRLDEDA 183

Query: 191 SFVCGHGPNSTIGRERRLNPFLK 213
           + V GHGP++T+G E R NPF++
Sbjct: 184 TVVAGHGPDTTLGEEMRENPFVR 206


>gi|189426391|ref|YP_001953568.1| beta-lactamase [Geobacter lovleyi SZ]
 gi|189422650|gb|ACD97048.1| beta-lactamase domain protein [Geobacter lovleyi SZ]
          Length = 208

 Score =  132 bits (331), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 76/208 (36%), Positives = 111/208 (53%), Gaps = 4/208 (1%)

Query: 6   FHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHV 65
           F  V V     NC  L  E + + VVVDPG ++D I   ++ R   +  I  THGH DHV
Sbjct: 3   FDTVVVGALGVNCFVLGCEATGQGVVVDPGDEVDRILAQVKQRGLTIVAIINTHGHFDHV 62

Query: 66  GGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGT 125
           GG  QL +     +   H+ DA ++ +V + A +  +     +   DR L+DG  +  GT
Sbjct: 63  GGNRQLTQATGAPLY-IHQADAPLLERVAKTAGMYGLP-GENSPQPDRLLEDGMQIEFGT 120

Query: 126 HIFKVFHCPGHSPGHV-IYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKIL 184
           H  +V H PGH+ G   +Y+  E      GDTLF   +GRTD+  G + QL+ SI  ++ 
Sbjct: 121 HRLQVIHTPGHTQGGCCLYLEAEGRLI-AGDTLFADGVGRTDLPGGSHTQLVESIKTRLF 179

Query: 185 PLGDEISFVCGHGPNSTIGRERRLNPFL 212
            L D++    GHGP ++IG E+R NP+L
Sbjct: 180 TLPDQVQVYPGHGPTTSIGHEKRHNPYL 207


>gi|297622654|ref|YP_003704088.1| beta-lactamase-like protein [Truepera radiovictrix DSM 17093]
 gi|297163834|gb|ADI13545.1| beta-lactamase-like protein [Truepera radiovictrix DSM 17093]
          Length = 210

 Score =  132 bits (331), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 76/210 (36%), Positives = 111/210 (52%), Gaps = 4/210 (1%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           LS     V P ++N   L D E+LEAV+VDPG + + +   +    F +  IW+TH H D
Sbjct: 2   LSLSGFCVGPLQENTYLLADTETLEAVLVDPGDEAERLLAALA--GFKLTAIWLTHAHFD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG  A + E   + +   H  D  ++ +    A L  + +      +   L     L +
Sbjct: 60  HVGALAAVHEAHPVPVYL-HPADRPLLAQAAASAALFGLPLRQPELPT-LPLAHAQQLQV 117

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G +  +  H PGH+PGHV +   E      GD LFR SIGRTD+  GD + L+ S+ +++
Sbjct: 118 GAYRARCLHTPGHAPGHVAFYLAEAGVLLAGDALFRGSIGRTDLPGGDLETLLRSLRDEV 177

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           L L DE   + GHGP +T+G ERR NPFL+
Sbjct: 178 LTLPDETRVLPGHGPETTVGSERRRNPFLQ 207


>gi|148381008|ref|YP_001255549.1| metallo-beta-lactamase family protein [Clostridium botulinum A str.
           ATCC 3502]
 gi|153933041|ref|YP_001385379.1| metallo-beta-lactamase family protein [Clostridium botulinum A str.
           ATCC 19397]
 gi|153935894|ref|YP_001388786.1| metallo-beta-lactamase family protein [Clostridium botulinum A str.
           Hall]
 gi|148290492|emb|CAL84620.1| putative metallo-beta-lactamase superfamily protein [Clostridium
           botulinum A str. ATCC 3502]
 gi|152929085|gb|ABS34585.1| metallo-beta-lactamase family protein [Clostridium botulinum A str.
           ATCC 19397]
 gi|152931808|gb|ABS37307.1| metallo-beta-lactamase family protein [Clostridium botulinum A str.
           Hall]
 gi|322807358|emb|CBZ04932.1| hypothetical metal-binding enzyme, YcbL homolog [Clostridium
           botulinum H04402 065]
          Length = 199

 Score =  132 bits (331), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 77/209 (36%), Positives = 112/209 (53%), Gaps = 10/209 (4%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +    + V  +  NC  L D++  +  ++DPGGD + I ++I+  N   K I +THGH+D
Sbjct: 1   MDIKTIPVGIYNANCYLLIDQD--KCAIIDPGGDPEDIINIIEDNNLIPKFILLTHGHID 58

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVGG   +K++ ++      KD+      + E   +       +NA  D +L +G    L
Sbjct: 59  HVGGVEAIKDEYNIPFYINRKDEDL----IKEAEYIFGNFGKYKNA--DEYLVEGKEFQL 112

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    K    PGHSPG + ++   NN    GDTLFR SIGR+D + G +  LINSI +KI
Sbjct: 113 GNLKIKAIETPGHSPGGMSFL--VNNVIFTGDTLFRESIGRSDFIGGSHNTLINSIQSKI 170

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
             L  +I  + GHGP STIG E+  NPF 
Sbjct: 171 TVLDPDIYVLPGHGPQSTIGYEKDNNPFF 199


>gi|153939572|ref|YP_001392335.1| metallo-beta-lactamase family protein [Clostridium botulinum F str.
           Langeland]
 gi|170755686|ref|YP_001782692.1| metallo-beta-lactamase family protein [Clostridium botulinum B1
           str. Okra]
 gi|152935468|gb|ABS40966.1| metallo-beta-lactamase family protein [Clostridium botulinum F str.
           Langeland]
 gi|169120898|gb|ACA44734.1| metallo-beta-lactamase family protein [Clostridium botulinum B1
           str. Okra]
 gi|295320327|gb|ADG00705.1| metallo-beta-lactamase family protein [Clostridium botulinum F str.
           230613]
          Length = 199

 Score =  131 bits (330), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 77/209 (36%), Positives = 111/209 (53%), Gaps = 10/209 (4%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +    + V  +  NC  L D++  +  ++DPGGD + I  +I+  N   K I +THGH+D
Sbjct: 1   MDIKTIPVGIYNANCYLLIDQD--KCAIIDPGGDPEDIIKIIEDNNLIPKFILLTHGHID 58

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVGG   +K++ ++      KD+      + E   +       +NA  D +L +G    L
Sbjct: 59  HVGGVEAIKDEYNIPFYINRKDEDL----IKEAEYIFGNFGKYKNA--DEYLVEGKEFQL 112

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    K    PGHSPG + ++   NN    GDTLFR SIGR+D + G +  LINSI +KI
Sbjct: 113 GNLKIKAIETPGHSPGGMSFL--VNNVIFTGDTLFRESIGRSDFIGGSHNTLINSIQSKI 170

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
             L  +I  + GHGP STIG E+  NPF 
Sbjct: 171 TVLDPDIYVLPGHGPQSTIGYEKNNNPFF 199


>gi|91202855|emb|CAJ72494.1| similar to hydroxyacylglutathione hydrolase [Candidatus Kuenenia
           stuttgartiensis]
          Length = 217

 Score =  131 bits (330), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 77/213 (36%), Positives = 114/213 (53%), Gaps = 9/213 (4%)

Query: 9   VQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGA 68
           + V P  Q CT++  + S EA++VDPG D + I   I +     K + ITHGH DH+G  
Sbjct: 6   ITVGPL-QVCTYIVYDVSAEALIVDPGADPEKIIAFINALKLLPKHVVITHGHGDHIGAN 64

Query: 69  AQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSI---RMNARNASSDRWLQDGDTLLLGT 125
           A LKE      I  H+ D  M+    +   +L+        R+  +DR L++GDT+  G 
Sbjct: 65  ASLKEAFPELQICVHEKDHDMLPYPAKNLSILAAFYGGATVRSPYADRTLKEGDTISAGK 124

Query: 126 HIFKVFHCPGHSPGHVIYVNFENNFAHL-----GDTLFRSSIGRTDILHGDYQQLINSIN 180
            IF+V H PGH+PG +     +           GD+LF++ IGRTD      + LI SI 
Sbjct: 125 CIFEVIHTPGHTPGGICLYRKDPEKGQPPVLFSGDSLFKNGIGRTDFPGCSQETLIQSIK 184

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           NK+L L ++     GHGP++T+  E++ NPFL+
Sbjct: 185 NKLLVLDEKTIIYPGHGPSTTLAEEKQHNPFLQ 217


>gi|226330679|ref|ZP_03806197.1| hypothetical protein PROPEN_04599 [Proteus penneri ATCC 35198]
 gi|225201474|gb|EEG83828.1| hypothetical protein PROPEN_04599 [Proteus penneri ATCC 35198]
          Length = 141

 Score =  131 bits (329), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 55/142 (38%), Positives = 95/142 (66%), Gaps = 2/142 (1%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + +HIV VT + QNCT ++ +E+ EA +VDPGGD++ +   I+ R   + ++ +THGH D
Sbjct: 1   MMYHIVPVTNYMQNCTLIWCDETKEAAIVDPGGDVETLIAEIEERQLTLTKVLLTHGHFD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+ G +Q+ E  ++ + GPHKDD  ++ ++++Q R+ +     ++ + D WL +GDT+ +
Sbjct: 61  HIAGTSQIVEHFNVPVYGPHKDDNFLLEELEQQCRMFNFPC-GKSFTPDSWLNEGDTVTI 119

Query: 124 GTHI-FKVFHCPGHSPGHVIYV 144
           G  I   V HCPGH+PGH+I++
Sbjct: 120 GKTISLSVLHCPGHTPGHIIFL 141


>gi|94265075|ref|ZP_01288842.1| Beta-lactamase-like [delta proteobacterium MLMS-1]
 gi|93454454|gb|EAT04745.1| Beta-lactamase-like [delta proteobacterium MLMS-1]
          Length = 213

 Score =  131 bits (329), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 81/201 (40%), Positives = 107/201 (53%), Gaps = 7/201 (3%)

Query: 18  CTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLKEDLSL 77
           C  L  EES + + +DPGGD D I +  ++    +K +  THGH DHV G A LK+    
Sbjct: 15  CYLLGCEESGQVLAIDPGGDEDKILEHCRAAGLELKMLLCTHGHPDHVCGNAVLKKATGA 74

Query: 78  TIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFKVFHCPGHS 137
            II  H DDAA   K + Q     + + A +   DR L+DGDT++LGT   +V H PGH+
Sbjct: 75  EIIM-HGDDAAFFAKPEIQHYFSMLGLPA-SPPPDRLLRDGDTVVLGTIELQVIHTPGHT 132

Query: 138 PGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEISFVCGH- 196
           PG +      + F   GDTLF   +GRTD   GD   L+NS+  ++L L  E     GH 
Sbjct: 133 PGGICLYTAPHLFT--GDTLFVGGVGRTDFPGGDTATLVNSLQQRLLKLPPETVVWPGHG 190

Query: 197 --GPNSTIGRERRLNPFLKSN 215
             G  STIG E R NP+L   
Sbjct: 191 YGGARSTIGEEARDNPYLSEQ 211


>gi|168179551|ref|ZP_02614215.1| metallo-beta-lactamase family protein [Clostridium botulinum NCTC
           2916]
 gi|170760448|ref|YP_001788377.1| metallo-beta-lactamase family protein [Clostridium botulinum A3
           str. Loch Maree]
 gi|169407437|gb|ACA55848.1| metallo-beta-lactamase family protein [Clostridium botulinum A3
           str. Loch Maree]
 gi|182669741|gb|EDT81717.1| metallo-beta-lactamase family protein [Clostridium botulinum NCTC
           2916]
          Length = 199

 Score =  131 bits (329), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 77/209 (36%), Positives = 111/209 (53%), Gaps = 10/209 (4%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +    + V  +  NC  L D++  +  ++DPGGD + I  +I+  N   K I +THGH+D
Sbjct: 1   MDIKTIPVGIYNANCYLLIDQD--KCAIIDPGGDPEDIIKIIEDNNLIPKFILLTHGHID 58

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVGG   +K++ ++      KD+      + E   +       +NA  D +L +G    L
Sbjct: 59  HVGGVEAIKDEYNIPFYINRKDEDL----IKEAEYIFGNFGKYKNA--DEYLVEGKEFQL 112

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    K    PGHSPG + ++   NN    GDTLFR SIGR+D + G +  LINSI +KI
Sbjct: 113 GNLKIKAIETPGHSPGGMSFL--VNNVIFTGDTLFRESIGRSDFIGGSHNTLINSIQSKI 170

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
             L  +I  + GHGP STIG E+  NPF 
Sbjct: 171 TVLDPDIYVLPGHGPQSTIGYEKDNNPFF 199


>gi|149198624|ref|ZP_01875668.1| Beta-lactamase-like protein [Lentisphaera araneosa HTCC2155]
 gi|149138339|gb|EDM26748.1| Beta-lactamase-like protein [Lentisphaera araneosa HTCC2155]
          Length = 213

 Score =  131 bits (329), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 69/204 (33%), Positives = 112/204 (54%), Gaps = 6/204 (2%)

Query: 14  FKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLKE 73
           ++ NC+ ++  ES EA+++DPG + + I   I  +   +K I  TH H+DH G   ++ E
Sbjct: 13  YQCNCSIVYCPESKEAILIDPGSEAETILKKINYQGLKIKAIIHTHAHLDHFGATHEVSE 72

Query: 74  DLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFKVFHC 133
               ++   HKDD  +    D QA +L +     +A+ D +++D  +   G    +  H 
Sbjct: 73  STDASV-HLHKDDMPLWNIADLQAEMLGLP-KCPHANVDHFIEDSQSFEFGEFKLEAIHT 130

Query: 134 PGHSPGHVIYVNFENNFAHL---GDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEI 190
           PGHS G   +   EN+   L   GDTLFR  +GRTD+  GD +++  SI  K+  L  + 
Sbjct: 131 PGHSAGSTCF-KIENSDEQLLFSGDTLFRRGVGRTDLPSGDSREIAKSIKEKLYKLDIDT 189

Query: 191 SFVCGHGPNSTIGRERRLNPFLKS 214
           + + GHGPN+ IG E+R NP++K+
Sbjct: 190 TVIPGHGPNTVIGEEKRQNPYIKA 213


>gi|313888462|ref|ZP_07822129.1| metallo-beta-lactamase domain protein [Peptoniphilus harei
           ACS-146-V-Sch2b]
 gi|312845491|gb|EFR32885.1| metallo-beta-lactamase domain protein [Peptoniphilus harei
           ACS-146-V-Sch2b]
          Length = 208

 Score =  130 bits (328), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 79/203 (38%), Positives = 110/203 (54%), Gaps = 6/203 (2%)

Query: 11  VTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQ 70
           V   ++NC  LFDE   +A VVDPGG  + I + I+    ++K I +THGH DHVG  A 
Sbjct: 10  VGELQENCFILFDENK-DAFVVDPGGSSENIIEAIEKNGLNIKYILLTHGHFDHVGAVAA 68

Query: 71  LKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFKV 130
           L +     +    KDD A + +  ++ R  S  M    A  D ++++GD +       KV
Sbjct: 69  LVKKYKAPVY-MSKDDRAFL-ESPKEVRASSFGMQIEAADVDVFVKEGDEIPFSEGTIKV 126

Query: 131 FHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEI 190
              PGH+ G V Y+ FE N+   GDTLF  SIGRTD    D+  +I S+  K+  L DEI
Sbjct: 127 IETPGHTLGSVCYL-FE-NYLFAGDTLFNGSIGRTDFPESDHSLMIESL-KKLKKLDDEI 183

Query: 191 SFVCGHGPNSTIGRERRLNPFLK 213
             + GHGP S I  E+  NP+L+
Sbjct: 184 YVLSGHGPESQIYYEKMTNPYLR 206


>gi|262361438|gb|ACY58159.1| metallo-beta-lactamase superfamily protein [Yersinia pestis
           D106004]
          Length = 170

 Score =  130 bits (328), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 54/160 (33%), Positives = 95/160 (59%), Gaps = 1/160 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + I+ VT F QNCT ++ E + +A +VDPGG+   I   ++ +   + Q+ +THGH+D
Sbjct: 1   MKYQIIPVTAFSQNCTLIWCEATGQAALVDPGGEATKIIAEVERQGVTISQVLLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA++     + I GP K+D   +  +  Q+R+  +       +  RWL++GD + +
Sbjct: 61  HVGAAAEVAAHFQVPIYGPEKEDTFWLEGLPAQSRMFGLS-ECEAFTPTRWLEEGDKITV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIG 163
           G     V HCPGH+PGH+++++ +   A +GD +F+  +G
Sbjct: 120 GEIELSVLHCPGHTPGHIVFIDPQGRLALVGDVIFKGGVG 159


>gi|299136768|ref|ZP_07029951.1| metallo-beta-lactamase family protein [Acidobacterium sp. MP5ACTX8]
 gi|298601283|gb|EFI57438.1| metallo-beta-lactamase family protein [Acidobacterium sp. MP5ACTX8]
          Length = 209

 Score =  130 bits (328), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 74/196 (37%), Positives = 106/196 (54%), Gaps = 2/196 (1%)

Query: 17  NCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLKEDLS 76
           NCT L DE S EA+VVDPG D+  I  V+      VKQI +TH H+DH+  A +LK+   
Sbjct: 14  NCTVLGDETSREAIVVDPGYDIPRILAVLAKHQLTVKQIVVTHAHIDHIASAFELKQITG 73

Query: 77  LTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFKVFHCPGH 136
             I+  ++ D  ++  ++EQA  + + +       D    D + + +      V H PGH
Sbjct: 74  APIVY-NQADLPLVAIMEEQAAWIEVAV-PEVKPPDHSPADEEKITVRGIEATVLHTPGH 131

Query: 137 SPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEISFVCGH 196
           + G +       +    GDTLF  SIGRTD+  G+  +++ SI  ++LPL D    V GH
Sbjct: 132 TEGSLCLYIPTESLLLAGDTLFARSIGRTDLPGGNTAKILESIRERLLPLPDATLVVPGH 191

Query: 197 GPNSTIGRERRLNPFL 212
           GP +TI RER  NPFL
Sbjct: 192 GPTTTIVRERTSNPFL 207


>gi|229588473|ref|YP_002870592.1| putative metallo-beta-lactamase family protein [Pseudomonas
           fluorescens SBW25]
 gi|229360339|emb|CAY47196.1| putative metallo-beta-lactamase family protein [Pseudomonas
           fluorescens SBW25]
          Length = 214

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 111/204 (54%), Gaps = 4/204 (1%)

Query: 11  VTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQ 70
           V P + NCT + D  S +A+VVDPGG+ ++I   + +    V  I  TH H+DH   + Q
Sbjct: 15  VGPLQCNCTIIGDPISKKAIVVDPGGNHELILARLDALGLKVVSIIHTHAHLDHFLASGQ 74

Query: 71  LKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFKV 130
           LKE    T+   HK+D  +   ++ Q ++  +       S DRWL+D + L  G  +   
Sbjct: 75  LKEKTGATL-HLHKEDQFLWDNLEMQCQMFRVPYTPV-PSPDRWLEDDEELACGCGV--A 130

Query: 131 FHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEI 190
            H PGH+PG + +   +      GDTLFR  IGRTD+  GD   ++ SI  ++  L +  
Sbjct: 131 LHTPGHTPGSMSFWFADAKLLIAGDTLFRRGIGRTDLWGGDQATIVRSIKQRLYTLDEGA 190

Query: 191 SFVCGHGPNSTIGRERRLNPFLKS 214
           + V GHGP++ +G E R NPF+++
Sbjct: 191 TVVTGHGPDTRLGDEMRENPFVRA 214


>gi|225376527|ref|ZP_03753748.1| hypothetical protein ROSEINA2194_02169 [Roseburia inulinivorans DSM
           16841]
 gi|225211626|gb|EEG93980.1| hypothetical protein ROSEINA2194_02169 [Roseburia inulinivorans DSM
           16841]
          Length = 233

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 74/213 (34%), Positives = 113/213 (53%), Gaps = 5/213 (2%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M+ LS  I  V P + NC F  ++++ E +++DPG     + + ++ +      I +THG
Sbjct: 25  MAPLSIQIYVVGPVQTNCYFAINDDTKEVLIIDPGASAKQLAEKVKEQGLKPVAILLTHG 84

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H DH  GA +L + L + I    K+   +    + Q  L   + +     +D +L+D   
Sbjct: 85  HFDHATGAGELAQLLHIKIYAQEKEKETLE---NPQLNLSGWQGSELVFYADEYLKDEQE 141

Query: 121 L-LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSI 179
           + L G HI +VF  PGH+ G   Y     N    GD+LF++SIGRTD   G   QLI++I
Sbjct: 142 IDLAGFHI-RVFLTPGHTVGGCCYYFPYQNTLFSGDSLFQTSIGRTDFPKGSASQLIHAI 200

Query: 180 NNKILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
             K++PL DE +   GHG  +TIG ER  NP+L
Sbjct: 201 REKLMPLPDETAVYTGHGDMTTIGTERMYNPYL 233


>gi|312959041|ref|ZP_07773560.1| beta-lactamase-like protein [Pseudomonas fluorescens WH6]
 gi|311286811|gb|EFQ65373.1| beta-lactamase-like protein [Pseudomonas fluorescens WH6]
          Length = 214

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 71/204 (34%), Positives = 111/204 (54%), Gaps = 4/204 (1%)

Query: 11  VTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQ 70
           V P + NCT + D  + +A+VVDPGG+ ++I   + +    V  I  TH H+DH   + Q
Sbjct: 15  VGPLQCNCTIIGDPITKKAIVVDPGGNHELILARLDALGLKVVSIIHTHAHLDHFLASGQ 74

Query: 71  LKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFKV 130
           LKE    T+   HKDD  +   ++ Q ++  +       S DRWL+D + L  G  +   
Sbjct: 75  LKEKTGATL-HLHKDDQFLWDNLEMQCQMFRVPYTP-VPSPDRWLEDDEELACGCGV--A 130

Query: 131 FHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEI 190
            H PGH+PG + +   +      GDTLFR  +GRTD+  GD   ++ SI  ++  L +  
Sbjct: 131 LHTPGHTPGSMSFWFADARLLIAGDTLFRRGVGRTDLWGGDQATIVRSIKQRLYTLDEGA 190

Query: 191 SFVCGHGPNSTIGRERRLNPFLKS 214
           + V GHGP++ +G E R NPF+++
Sbjct: 191 TVVTGHGPDTRLGDEMRENPFVRA 214


>gi|163782029|ref|ZP_02177028.1| hypothetical protein HG1285_17889 [Hydrogenivirga sp. 128-5-R1-1]
 gi|159882561|gb|EDP76066.1| hypothetical protein HG1285_17889 [Hydrogenivirga sp. 128-5-R1-1]
          Length = 212

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 74/213 (34%), Positives = 117/213 (54%), Gaps = 10/213 (4%)

Query: 7   HIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVG 66
            ++ V P   NC+ + D+ + +AV++DPG D + I +V  +R F V  I  THGH+DHVG
Sbjct: 6   EVIPVGPLAVNCSVVADDNTGKAVIIDPGADAERIIEV--AREFEVVGIVNTHGHIDHVG 63

Query: 67  GAAQLKE--DLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASS-DRWLQDGDTLLL 123
              ++KE  D+   +   H++D  ++   DE     S  +NA      D +L+DG  + +
Sbjct: 64  QVKRVKEFFDVPFYL---HREDVYLIK--DEIWSGFSAYINAEPCPEPDEFLEDGIEIEV 118

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V H PGH+PG   +   E +    GD LF+ S+GRTD+  GD +++  S+    
Sbjct: 119 GDLKMRVLHTPGHTPGLCCFYIEEESVLIAGDLLFKGSVGRTDLPGGDPEKMRRSLERVF 178

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
             L DE   +CGH   +TIG ER+ NP+L+  +
Sbjct: 179 TELPDETLVICGHYEETTIGHERKFNPYLRGGL 211


>gi|323702160|ref|ZP_08113827.1| beta-lactamase domain-containing protein [Desulfotomaculum
           nigrificans DSM 574]
 gi|323532847|gb|EGB22719.1| beta-lactamase domain-containing protein [Desulfotomaculum
           nigrificans DSM 574]
          Length = 207

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 76/203 (37%), Positives = 112/203 (55%), Gaps = 8/203 (3%)

Query: 14  FKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLKE 73
            + NC  +   E+ +A +VDPG +   I   +      V  I +THGH DH+G  A+LK+
Sbjct: 11  LEANCYIIGCPETDQAAIVDPGDEARRILAQVAKLGLTVSAIILTHGHYDHIGAVAELKK 70

Query: 74  DLSLTIIGPHKDDAAMMGKVDEQARLLSIRM--NARNASSDRWLQDGDTLLLGTHIFKVF 131
                ++  H+ D+ M+ K    A  LS  +  +     +DR L+DGD + +G    +V 
Sbjct: 71  ATGAPVM-IHRQDSEMLTK---PALNLSAWLGEDIELKPADRLLEDGDLIKVGNLTLEVL 126

Query: 132 HCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEIS 191
           H PGH+PG +      + F   GDTLF  S+GR+D   G +  LINSI  K+L L D+  
Sbjct: 127 HTPGHTPGGICLKVGGDVFT--GDTLFAQSVGRSDFPGGSHTTLINSIKQKLLVLPDDTM 184

Query: 192 FVCGHGPNSTIGRERRLNPFLKS 214
              GHGP STIG+E+RLNP+L++
Sbjct: 185 IYPGHGPASTIGQEKRLNPYLQN 207


>gi|118578537|ref|YP_899787.1| beta-lactamase domain-containing protein [Pelobacter propionicus
           DSM 2379]
 gi|118501247|gb|ABK97729.1| beta-lactamase domain protein [Pelobacter propionicus DSM 2379]
          Length = 207

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 74/207 (35%), Positives = 106/207 (51%), Gaps = 2/207 (0%)

Query: 6   FHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHV 65
           F  ++V P   NC  L  EE+ + VV+D GGD   I  V++ +   +  I  THGH DH+
Sbjct: 3   FESLEVGPLGVNCFILGCEETGQGVVIDAGGDARDIIAVVERQGLTIAHIINTHGHFDHI 62

Query: 66  GGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGT 125
           G    LKE  S  ++  H  D  ++ +  + A+   I     +   D  L+DG  +  G 
Sbjct: 63  GANRALKERFSANLM-IHAADIPLLDRAADIAKAYGIP-GENSPQPDTCLEDGMEISFGK 120

Query: 126 HIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILP 185
               V H PGHSPG   +          GDTLF  SIGRTD+  G ++QL++S+  K+  
Sbjct: 121 LAMTVLHTPGHSPGGCCFYLEAEQKIITGDTLFADSIGRTDLPGGSHEQLLDSVRAKLFT 180

Query: 186 LGDEISFVCGHGPNSTIGRERRLNPFL 212
           L D +    GHGP +TIG E+R NP+ 
Sbjct: 181 LPDHVVAYPGHGPETTIGHEKRHNPYF 207


>gi|167947534|ref|ZP_02534608.1| Beta-lactamase-like protein [Endoriftia persephone
           'Hot96_1+Hot96_2']
          Length = 157

 Score =  130 bits (326), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 67/155 (43%), Positives = 94/155 (60%), Gaps = 1/155 (0%)

Query: 59  HGHVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDG 118
           HGH+DH GGAA L + L + I GPH++D   +  + +QA +          + +RWL+ G
Sbjct: 3   HGHIDHAGGAAALAKALGVVIEGPHQEDRFWLENMPQQAEIFGF-PQVETFTPERWLEQG 61

Query: 119 DTLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINS 178
           D + +G    +V H PGH+PGH+ + +  +  A +GD +F+ SIGRTD    DY  LI S
Sbjct: 62  DRITVGDEQLEVIHTPGHTPGHLTFYHAPSKLALVGDVIFQGSIGRTDFPRSDYATLIRS 121

Query: 179 INNKILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           I  ++ PLGD+  FV GHGP ST G ER  NPFL+
Sbjct: 122 IRERLWPLGDDCRFVPGHGPESTFGEERLHNPFLR 156


>gi|89895195|ref|YP_518682.1| hypothetical protein DSY2449 [Desulfitobacterium hafniense Y51]
 gi|219669625|ref|YP_002460060.1| beta-lactamase [Desulfitobacterium hafniense DCB-2]
 gi|89334643|dbj|BAE84238.1| hypothetical protein [Desulfitobacterium hafniense Y51]
 gi|219539885|gb|ACL21624.1| beta-lactamase domain protein [Desulfitobacterium hafniense DCB-2]
          Length = 205

 Score =  130 bits (326), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 80/206 (38%), Positives = 113/206 (54%), Gaps = 10/206 (4%)

Query: 11  VTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQ 70
           V     NC  +   E+ +A ++DPG +   I++ +  R   V+ I +THGH DH+G   +
Sbjct: 7   VGAMGANCYLVSCPETKKAALIDPGANGPGIQEWVDERGVQVEYILLTHGHFDHIGAVDK 66

Query: 71  LKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARN---ASSDRWLQDGDTLLLGTHI 127
           L+E L    +G HK+DA M+      A  LS RM  R+     +D  L+DG  L +G   
Sbjct: 67  LRE-LYQAKVGIHKEDAVML---TSGAHNLS-RMLGRSYEFKPADFLLEDGQILQVGNLN 121

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
             V   PGH+ G V ++  E   +  GDTLF  SIGRTD   G Y +LI S+  K+L L 
Sbjct: 122 LTVIATPGHTLGGVCFLTSEGLLS--GDTLFDGSIGRTDFPGGSYDELIKSVVKKLLVLP 179

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLK 213
           ++     GHGP +TIGRE+R NPFL+
Sbjct: 180 EDTKVYPGHGPETTIGREKRENPFLQ 205


>gi|147677382|ref|YP_001211597.1| Zn-dependent hydrolases [Pelotomaculum thermopropionicum SI]
 gi|146273479|dbj|BAF59228.1| Zn-dependent hydrolases [Pelotomaculum thermopropionicum SI]
          Length = 207

 Score =  130 bits (326), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 73/200 (36%), Positives = 107/200 (53%), Gaps = 5/200 (2%)

Query: 14  FKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLKE 73
            + NC  +  EE+ E  VVDPG + + I   ++     +K I +THGH+DH+G  A +++
Sbjct: 11  MESNCYIIGCEETREGAVVDPGAEAEKILKKVEELGLKIKYIILTHGHIDHIGALAGVQQ 70

Query: 74  DLSLTIIGPHKDDAAMMGKVDEQARL-LSIRMNARNASSDRWLQDGDTLLLGTHIFKVFH 132
                ++  H +DA M+   D +  L + +  N     +DR LQ+GD + +G    +V H
Sbjct: 71  ATGAQVL-IHAEDAPML--TDARKNLSMYVGPNLSLKQADRLLQEGDIISVGKIAIEVIH 127

Query: 133 CPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEISF 192
            PGH+ G  I +    +    GDTLF  S+GR+D   G + QLI SI NK+L        
Sbjct: 128 TPGHTRGS-ISLKCAPDIILTGDTLFAGSVGRSDFPGGSHSQLIASIKNKLLKFPPGTGV 186

Query: 193 VCGHGPNSTIGRERRLNPFL 212
             GHGP STIG E+  NPFL
Sbjct: 187 YPGHGPKSTIGEEKLYNPFL 206


>gi|51893566|ref|YP_076257.1| putative Zn-dependent hydrolase [Symbiobacterium thermophilum IAM
           14863]
 gi|51857255|dbj|BAD41413.1| putative Zn-dependent hydrolase [Symbiobacterium thermophilum IAM
           14863]
          Length = 206

 Score =  130 bits (326), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 76/200 (38%), Positives = 107/200 (53%), Gaps = 4/200 (2%)

Query: 14  FKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLKE 73
           F  NC  +   E+ +A+V+DPG     I+  +   +  V  I +THGH+DH+GG   +K 
Sbjct: 11  FMANCYIVACGETRQALVIDPGVPDPWIQSCVMENDLTVVGIVLTHGHLDHIGGVDWVK- 69

Query: 74  DLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFKVFHC 133
             S   +  H+ DA  +        L    M  + + +DR L+DGD +  G   F+V H 
Sbjct: 70  GWSGAPVAIHEADADCLTSPARNGSLY-FGMTVQASPADRLLRDGDEVEAGGLRFRVIHT 128

Query: 134 PGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEISFV 193
           PGHSPG +      +  A  GDTLF  SIGRTD+  GDY  LI SI  ++L L  + +  
Sbjct: 129 PGHSPGGICLYRPGHLLA--GDTLFAGSIGRTDLPGGDYHTLIQSIKERLLTLPPDTAVY 186

Query: 194 CGHGPNSTIGRERRLNPFLK 213
            GHGP++TIG E+  NPFL 
Sbjct: 187 PGHGPSTTIGDEKAYNPFLA 206


>gi|169831066|ref|YP_001717048.1| beta-lactamase domain-containing protein [Candidatus Desulforudis
           audaxviator MP104C]
 gi|169637910|gb|ACA59416.1| beta-lactamase domain protein [Candidatus Desulforudis audaxviator
           MP104C]
          Length = 213

 Score =  130 bits (326), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 72/217 (33%), Positives = 116/217 (53%), Gaps = 7/217 (3%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M +L    + V   + NC  L    + EA+V+DPG + ++I   +      +K + +THG
Sbjct: 1   MRRLILDTLVVGALQTNCYILGCPNTREALVIDPGAEAELIGSTLDKHGLKLKTVVLTHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLS-IRMNARNASSDRWLQDGD 119
           H DH+G   +L+ +  +T+   H++DA ++   D    L + I      ++++  L DGD
Sbjct: 61  HADHIGACGELRREPGVTL-AIHREDAPLLS--DTHRNLTAYIGPPLTLSAAETLLGDGD 117

Query: 120 TLLLGTHI-FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINS 178
            +  G  I   V H PGH+ G +  +     F   GDTLF  ++GRTD   GD++ LI S
Sbjct: 118 RVEFGAGIQLTVLHTPGHTRGSICLLG--EGFLFSGDTLFAGAVGRTDFPGGDFKTLIAS 175

Query: 179 INNKILPLGDEISFVCGHGPNSTIGRERRLNPFLKSN 215
           + N++ PL D+     GHGP ST+G E+R NP+L + 
Sbjct: 176 LKNRLEPLPDDTRVYPGHGPASTMGVEKRENPYLTTE 212


>gi|187778362|ref|ZP_02994835.1| hypothetical protein CLOSPO_01954 [Clostridium sporogenes ATCC
           15579]
 gi|187771987|gb|EDU35789.1| hypothetical protein CLOSPO_01954 [Clostridium sporogenes ATCC
           15579]
          Length = 199

 Score =  129 bits (325), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 75/209 (35%), Positives = 110/209 (52%), Gaps = 10/209 (4%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +    + V  +  NC  L D++  +  ++DPGGD + I   I+  N   + I +THGH+D
Sbjct: 1   MDIKTIPVGIYNANCYLLIDQD--KCAIIDPGGDSEDIIKTIEDNNLMPQFILLTHGHID 58

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVGG   +K+  ++      KD+      + E   +       +NA  D +L +G    L
Sbjct: 59  HVGGVEAIKDKYNIPFYINKKDEDL----IKEAGYIFGNFGKYKNA--DEYLVEGKVFQL 112

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    K    PGHSPG + ++   NN    GDTLFR SIGR+D + G +  LINSI +KI
Sbjct: 113 GNLKIKAIETPGHSPGGMSFL--VNNVIFTGDTLFRESIGRSDFIGGSHNTLINSIQSKI 170

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           + L  +I  + GHGP ST+G E+  NPF 
Sbjct: 171 IVLEPDIYVLPGHGPESTVGYEKDNNPFF 199


>gi|291532744|emb|CBL05857.1| Zn-dependent hydrolases, including glyoxylases [Megamonas
           hypermegale ART12/1]
          Length = 208

 Score =  129 bits (325), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 75/205 (36%), Positives = 108/205 (52%), Gaps = 8/205 (3%)

Query: 11  VTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQ 70
           V P  +NC  L+DE++LE ++VDPG +   I +V+ +   H+K I  THGH DH+G   +
Sbjct: 8   VGPIMENCYILYDEQTLEGIIVDPGDEATSILNVVDNLKLHIKYIVNTHGHADHIGANKE 67

Query: 71  LKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNAR---NASSDRWLQDGDTLLLGTHI 127
           L   L    +  H DDA M+   D    L       R   +  +D  L +GD +  G   
Sbjct: 68  LGLALKAK-LAIHADDACML--TDPHLNLSENGYMGRPIISQPADIILHEGDIISFGNCN 124

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
            KV H PGH+PG +  V         GD+LF  SIGRTD   G    LI+++  KIL L 
Sbjct: 125 LKVIHTPGHTPGGICLVG--EGVVMSGDSLFAGSIGRTDFPTGSMTDLISNLKAKILTLD 182

Query: 188 DEISFVCGHGPNSTIGRERRLNPFL 212
           + ++   GHG  +TI  E+++NP+L
Sbjct: 183 ENLTVFPGHGGATTIAYEKQINPYL 207


>gi|302874943|ref|YP_003843576.1| Hydroxyacylglutathione hydrolase [Clostridium cellulovorans 743B]
 gi|307690439|ref|ZP_07632885.1| Hydroxyacylglutathione hydrolase [Clostridium cellulovorans 743B]
 gi|302577800|gb|ADL51812.1| Hydroxyacylglutathione hydrolase [Clostridium cellulovorans 743B]
          Length = 199

 Score =  129 bits (325), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 77/204 (37%), Positives = 112/204 (54%), Gaps = 21/204 (10%)

Query: 9   VQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGA 68
           VQ+  ++ NC  + DE + +AV++DPG D++ +K  + S +  +K I++THGH+DH  G 
Sbjct: 6   VQLGAYQTNCYLVIDESTNDAVIIDPGDDVNGLKHFLTSADVQLKAIFLTHGHMDHSLGM 65

Query: 69  AQLKEDLSLTIIGPHKDDAAM------MGKVDEQARLLSIRMNARNASSDRWLQDGDTLL 122
             L E  +L +    +D+  M       G + E   +++I              DGD L 
Sbjct: 66  PYLVEQYNLPVYLKKEDEELMRENAFIFGYIPENCHIVNI-------------SDGDELN 112

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
            G   FKV   PGHSPG V + + +  F   GDTLF SS GRTD+  G+Y+ LINSI NK
Sbjct: 113 FGNLSFKVISTPGHSPGGVCFSSGKILFC--GDTLFNSSFGRTDLPGGNYETLINSIINK 170

Query: 183 ILPLGDEISFVCGHGPNSTIGRER 206
           +L L  +     GHGP +TIG E+
Sbjct: 171 LLCLDVDTVAYSGHGPYTTIGSEK 194


>gi|226950486|ref|YP_002805577.1| metallo-beta-lactamase family protein [Clostridium botulinum A2
           str. Kyoto]
 gi|237796513|ref|YP_002864065.1| metallo-beta-lactamase family protein [Clostridium botulinum Ba4
           str. 657]
 gi|226841485|gb|ACO84151.1| metallo-beta-lactamase family protein [Clostridium botulinum A2
           str. Kyoto]
 gi|229263517|gb|ACQ54550.1| metallo-beta-lactamase family protein [Clostridium botulinum Ba4
           str. 657]
          Length = 199

 Score =  129 bits (323), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 76/209 (36%), Positives = 110/209 (52%), Gaps = 10/209 (4%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +    + V  +  NC  L D++  +  ++DPGGD + I  +I+  N   + I +THGH+D
Sbjct: 1   MDIKTIPVGIYNANCYLLIDQD--KCAIIDPGGDPEDIIKIIEDNNLIPQFILLTHGHID 58

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVGG   +K+  ++      KD+      + E   +       +NA  D +L +G    L
Sbjct: 59  HVGGVEAIKDKYNIPFYINRKDEDL----IKEAEYIFGNFGKYKNA--DEYLVEGKEFQL 112

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    K    PGHSPG + ++   NN    GDTLFR SIGR+D + G +  LINSI +KI
Sbjct: 113 GNLKIKAIETPGHSPGGMSFL--VNNVIFTGDTLFRESIGRSDFIGGSHNTLINSIQSKI 170

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
             L  +I  + GHGP STIG E+  NPF 
Sbjct: 171 TVLDPDIYVLPGHGPQSTIGYEKDNNPFF 199


>gi|162447814|ref|YP_001620946.1| metallo-beta-lactamase superfamily hydrolase [Acholeplasma
           laidlawii PG-8A]
 gi|161985921|gb|ABX81570.1| hydrolase of the metallo-beta-lactamase superfamily [Acholeplasma
           laidlawii PG-8A]
          Length = 198

 Score =  128 bits (322), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 74/189 (39%), Positives = 100/189 (52%), Gaps = 10/189 (5%)

Query: 25  ESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLKEDLSLTIIGPHK 84
           E+ +  ++DPG +   I + I+SR    + I+ITHGH DH GG  QLKE   + +  P K
Sbjct: 20  ENKQCFIIDPGYEGSEIIEYIKSRKLDPQFIYITHGHHDHTGGVKQLKEHYHIPVYAPLK 79

Query: 85  DDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFKVFHCPGHSPGHVIYV 144
           D   M   V            A     D+++ +GD +  G H+FKV   PGHS G     
Sbjct: 80  DKVWMTDTV--------YNYFAYEIPVDQYVVEGDKIDFGRHVFKVIETPGHSEGSTALY 131

Query: 145 NFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEISFVCGHGPNSTIGR 204
           N    F   GDTLF  SIGRT+I  GD + L+++I  K+L L D+     GHG  +TIG 
Sbjct: 132 N--EPFLFCGDTLFFESIGRTNIPFGDEEVLMDTIRTKLLTLPDKTVVYPGHGKPTTIGY 189

Query: 205 ERRLNPFLK 213
           E+  NPFLK
Sbjct: 190 EKENNPFLK 198


>gi|313206646|ref|YP_004045823.1| hydroxyacylglutathione hydrolase [Riemerella anatipestifer DSM
           15868]
 gi|312445962|gb|ADQ82317.1| hydroxyacylglutathione hydrolase [Riemerella anatipestifer DSM
           15868]
 gi|315022142|gb|EFT35171.1| Hydroxyacylglutathione hydrolase [Riemerella anatipestifer RA-YM]
 gi|325335913|gb|ADZ12187.1| Zn-dependent hydrolase [Riemerella anatipestifer RA-GD]
          Length = 212

 Score =  128 bits (322), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 74/214 (34%), Positives = 112/214 (52%), Gaps = 7/214 (3%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGG----DLDIIKDVIQSRNFHVKQIWITH 59
           LS       PF +N   +++E+  +A ++DPG     +   + + I S+N  VK I +TH
Sbjct: 2   LSIKTFTFNPFSENTYIVYNEDR-QAFIIDPGNFTANETLALSEFITSQNLTVKNILLTH 60

Query: 60  GHVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGD 119
            H+DH+ G  Q   D     +  H+ D  ++ +    AR     M         ++ +G+
Sbjct: 61  AHIDHIVGL-QWAFDTYQVPVLMHQLDQELLDRAPLTARQYGFNM-LPFVGQITFIDEGE 118

Query: 120 TLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSI 179
           TL LG     + H PGHSPG + + + E N+   GD LF+ SIGRTD+  G+Y+QLI SI
Sbjct: 119 TLHLGADTLHLLHTPGHSPGSISFYHKEQNWVISGDVLFQGSIGRTDLYKGNYEQLIESI 178

Query: 180 NNKILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
             K+L L        GHG ++ IG E++ NPFLK
Sbjct: 179 KTKLLTLPPNTQVYSGHGASTNIGFEQQYNPFLK 212


>gi|195952855|ref|YP_002121145.1| beta-lactamase domain protein [Hydrogenobaculum sp. Y04AAS1]
 gi|195932467|gb|ACG57167.1| beta-lactamase domain protein [Hydrogenobaculum sp. Y04AAS1]
          Length = 212

 Score =  128 bits (322), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 71/214 (33%), Positives = 114/214 (53%), Gaps = 6/214 (2%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M KL    +   P  +NC  + +E++ EA+V+DPG D+  I + I   +F +  I  THG
Sbjct: 1   MEKLKIETIPTKPIDENCIVIKNEDTKEAIVIDPGSDIQAILETIG--DFKLVAILATHG 58

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASS-DRWLQDGD 119
           H DH+G  A LKE  ++     HK+D  ++   DE     SI +NA+     D +++DGD
Sbjct: 59  HYDHIGQVATLKERYNVPFYM-HKEDEFLLN--DELFPGFSIYLNAKTPPKPDFYIKDGD 115

Query: 120 TLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSI 179
            L + +   ++ H PGH+PG   +     N    GDTLF+  +GRTD+  G ++ L  S+
Sbjct: 116 KLSIASVDIEIIHTPGHTPGGCCFYLPSQNTLIAGDTLFKGGVGRTDLPGGSWEDLSKSL 175

Query: 180 NNKILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
                 L  +   +CGH  ++++  E + NPFL+
Sbjct: 176 KKIFSILPKDTHVICGHYQDTSLEHELKFNPFLR 209


>gi|49079038|gb|AAT49847.1| PA0832 [synthetic construct]
          Length = 214

 Score =  128 bits (321), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 71/205 (34%), Positives = 108/205 (52%), Gaps = 4/205 (1%)

Query: 11  VTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQ 70
           V P + NCT + D  + +A+VVDPGGD ++I   +      V  I  TH H+DH   + +
Sbjct: 14  VGPLQCNCTIIGDPLTRKAIVVDPGGDHELILQRLDRLGLQVVSIIHTHAHLDHFLASGE 73

Query: 71  LKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFKV 130
           +K+    ++   HKDD  +   ++ Q +L  +      A  DRWL D + L  G  +   
Sbjct: 74  MKKRTGASL-HLHKDDQFLWDNLEMQCQLFGVPYTPVPAP-DRWLADDEELACGCGV--A 129

Query: 131 FHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEI 190
            H PGH+PG + +          GDTLFR  IGRTD+  GD   +  SI  ++  L ++ 
Sbjct: 130 LHTPGHTPGSMSFWFPRAKLLIAGDTLFRRGIGRTDLWGGDSAAIQRSIRQRLYSLDEDA 189

Query: 191 SFVCGHGPNSTIGRERRLNPFLKSN 215
           + V GHGP++T+G E R NPF++  
Sbjct: 190 TVVAGHGPDTTLGEEMRENPFVRGG 214


>gi|226946150|ref|YP_002801223.1| metallo beta-lactamase-like protein [Azotobacter vinelandii DJ]
 gi|226721077|gb|ACO80248.1| metallo beta-lactamase-like protein [Azotobacter vinelandii DJ]
          Length = 213

 Score =  128 bits (321), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 74/204 (36%), Positives = 109/204 (53%), Gaps = 4/204 (1%)

Query: 11  VTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQ 70
           V P + NCT + D  S +A+VVDPGG+ ++I   +Q     V  I  TH H DH   A Q
Sbjct: 14  VGPLRCNCTIVGDPVSKKAMVVDPGGNPELILARLQRHGLKVVSIVHTHAHFDHFLAAGQ 73

Query: 71  LKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFKV 130
           LKE L+   +  H+DD  +   ++ Q R+  +   A   + D WL D + L  G  +   
Sbjct: 74  LKE-LTGATLHLHQDDRFLWDNLEMQCRMFGVPY-APVPAPDHWLTDDEELACGCGV--A 129

Query: 131 FHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEI 190
            H PGH+PG + +   +      GDTLF  S+GRTD+  GD   L  SI  ++  L +E 
Sbjct: 130 LHTPGHTPGSMSFWFADARLLIAGDTLFHRSVGRTDLWGGDAAALKRSIRERLYTLDEEA 189

Query: 191 SFVCGHGPNSTIGRERRLNPFLKS 214
           + V GHG ++ +G E R NPF+++
Sbjct: 190 TVVTGHGSDTRLGDEMRENPFVRA 213


>gi|153955743|ref|YP_001396508.1| hypothetical protein CKL_3129 [Clostridium kluyveri DSM 555]
 gi|219856112|ref|YP_002473234.1| hypothetical protein CKR_2769 [Clostridium kluyveri NBRC 12016]
 gi|146348601|gb|EDK35137.1| Conserved hypothetical protein [Clostridium kluyveri DSM 555]
 gi|219569836|dbj|BAH07820.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 199

 Score =  128 bits (321), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 73/208 (35%), Positives = 107/208 (51%), Gaps = 22/208 (10%)

Query: 11  VTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQ 70
           V  +  NC  L DE SL+  V+DPGGD   I   ++     VK I +THGH+DH G   +
Sbjct: 8   VGSYGTNCYILIDEGSLQCAVIDPGGDAPQIIKAVEDSKCKVKYILLTHGHIDHTGAVVE 67

Query: 71  LKEDLSLTIIGPHKD------DAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLG 124
           LK   +  +    KD       A + G +  +A L              +++D     +G
Sbjct: 68  LKNKYNAPVAISEKDYKMVQQGAFVYGNIGNEAPL--------------YIKDNQIFEIG 113

Query: 125 THIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKIL 184
               K  + PGH+PG V ++  +  F+  GDTLF+ SIGRTD   GD++ +I+SI  KI+
Sbjct: 114 DIKLKAIYTPGHTPGGVSFLTDKVVFS--GDTLFQGSIGRTDFPGGDFETIIDSIKTKII 171

Query: 185 PLGDEISFVCGHGPNSTIGRERRLNPFL 212
            L +E   + GHGP + +G E+  NPFL
Sbjct: 172 VLPNETVVLSGHGPKTFVGEEKMHNPFL 199


>gi|325290216|ref|YP_004266397.1| beta-lactamase domain protein [Syntrophobotulus glycolicus DSM
           8271]
 gi|324965617|gb|ADY56396.1| beta-lactamase domain protein [Syntrophobotulus glycolicus DSM
           8271]
          Length = 213

 Score =  128 bits (321), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 71/207 (34%), Positives = 108/207 (52%), Gaps = 3/207 (1%)

Query: 9   VQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGA 68
           ++      NC  +   E+ +A++VDPG   + I + I  +N  V  I +THGH DH+G  
Sbjct: 5   IKTPGMGTNCYLVSCPETKKALLVDPGAGAEGILEWISQKNVEVIGILLTHGHYDHIGAL 64

Query: 69  AQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIF 128
            ++++ L + +   H+DDA M+    +       R       +D  LQ+ D L +G   +
Sbjct: 65  EEVRDALKVKVY-IHRDDAPMLADPQKNLSAYGGRNIRVEKGADVLLQENDVLEIGQLTY 123

Query: 129 KVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGD 188
            V H PGH+PG +  +  +   +  GDTLF  SIGRTD   G    ++NSIN K++ L D
Sbjct: 124 TVLHTPGHTPGCICLLGPDGLLS--GDTLFCRSIGRTDFPGGSMLNILNSINGKLMLLRD 181

Query: 189 EISFVCGHGPNSTIGRERRLNPFLKSN 215
           E     GH   +TIG ERR NP+L  +
Sbjct: 182 ETKVFPGHESTTTIGEERRYNPYLNGD 208


>gi|218893201|ref|YP_002442070.1| hypothetical protein PLES_44861 [Pseudomonas aeruginosa LESB58]
 gi|218773429|emb|CAW29241.1| conserved hypothetical protein [Pseudomonas aeruginosa LESB58]
          Length = 214

 Score =  128 bits (321), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 71/203 (34%), Positives = 108/203 (53%), Gaps = 4/203 (1%)

Query: 11  VTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQ 70
           V P + NCT + D  + +A+VVDPGGD ++I   +      V  I  TH H+DH   + +
Sbjct: 15  VGPLQCNCTIIGDPLTRKAIVVDPGGDHELILQRLDRLGLQVVSIIHTHAHLDHFLASGE 74

Query: 71  LKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFKV 130
           +K+    ++   HKDD  +   ++ Q +L  +      A  DRWL D + L  G  +   
Sbjct: 75  MKKRTGASL-HLHKDDQFLWDNLEMQCQLFGVPYTPVPAP-DRWLADDEELACGCGV--A 130

Query: 131 FHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEI 190
            H PGH+PG + +          GDTLFR  IGRTD+  GD   +  SI  ++  L ++ 
Sbjct: 131 LHTPGHTPGSMSFWFPRAKLLIAGDTLFRRGIGRTDLWGGDSAAIQRSIRQRLYSLDEDA 190

Query: 191 SFVCGHGPNSTIGRERRLNPFLK 213
           + V GHGP++T+G E R NPF++
Sbjct: 191 TVVAGHGPDTTLGEEMRENPFVR 213


>gi|15596029|ref|NP_249523.1| hypothetical protein PA0832 [Pseudomonas aeruginosa PAO1]
 gi|254239184|ref|ZP_04932507.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719]
 gi|254245119|ref|ZP_04938441.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192]
 gi|313105708|ref|ZP_07791971.1| hypothetical protein PA39016_000110005 [Pseudomonas aeruginosa
           39016]
 gi|9946727|gb|AAG04221.1|AE004518_2 conserved hypothetical protein [Pseudomonas aeruginosa PAO1]
 gi|126171115|gb|EAZ56626.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719]
 gi|126198497|gb|EAZ62560.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192]
 gi|310878473|gb|EFQ37067.1| hypothetical protein PA39016_000110005 [Pseudomonas aeruginosa
           39016]
          Length = 213

 Score =  128 bits (321), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 71/203 (34%), Positives = 108/203 (53%), Gaps = 4/203 (1%)

Query: 11  VTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQ 70
           V P + NCT + D  + +A+VVDPGGD ++I   +      V  I  TH H+DH   + +
Sbjct: 14  VGPLQCNCTIIGDPLTRKAIVVDPGGDHELILQRLDRLGLQVVSIIHTHAHLDHFLASGE 73

Query: 71  LKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFKV 130
           +K+    ++   HKDD  +   ++ Q +L  +      A  DRWL D + L  G  +   
Sbjct: 74  MKKRTGASL-HLHKDDQFLWDNLEMQCQLFGVPYTPVPAP-DRWLADDEELACGCGV--A 129

Query: 131 FHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEI 190
            H PGH+PG + +          GDTLFR  IGRTD+  GD   +  SI  ++  L ++ 
Sbjct: 130 LHTPGHTPGSMSFWFPRAKLLIAGDTLFRRGIGRTDLWGGDSAAIQRSIRQRLYSLDEDA 189

Query: 191 SFVCGHGPNSTIGRERRLNPFLK 213
           + V GHGP++T+G E R NPF++
Sbjct: 190 TVVAGHGPDTTLGEEMRENPFVR 212


>gi|291287356|ref|YP_003504172.1| beta-lactamase domain protein [Denitrovibrio acetiphilus DSM 12809]
 gi|290884516|gb|ADD68216.1| beta-lactamase domain protein [Denitrovibrio acetiphilus DSM 12809]
          Length = 205

 Score =  128 bits (321), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 76/202 (37%), Positives = 104/202 (51%), Gaps = 4/202 (1%)

Query: 11  VTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQ 70
           V P   NC  +   +  +AV+VDPGG+ + I   ++        I  THGH DH+G  +Q
Sbjct: 8   VGPLAVNCYII--SKDGKAVIVDPGGNTESIVKYLKQGKLTPVAIVNTHGHFDHIGSVSQ 65

Query: 71  LKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFKV 130
           LKE   +  +  HKDD  +     E + +         A +D +L DG  L LG     V
Sbjct: 66  LKEAYDIPFM-LHKDDEFLCSHGAESSAMFGFDKIENPAITD-YLTDGQQLSLGGIEIGV 123

Query: 131 FHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEI 190
            H PGHSPG V     E      GDTLF  S+GR+D  +   +QL++SI  K+  L DE 
Sbjct: 124 IHTPGHSPGGVCLYVRELKSVMTGDTLFLESVGRSDFPYASTEQLMHSIREKVFSLPDET 183

Query: 191 SFVCGHGPNSTIGRERRLNPFL 212
               GHGP+S+IG E++ NPFL
Sbjct: 184 KVFPGHGPSSSIGHEKKFNPFL 205


>gi|297568309|ref|YP_003689653.1| Hydroxyacylglutathione hydrolase [Desulfurivibrio alkaliphilus
           AHT2]
 gi|296924224|gb|ADH85034.1| Hydroxyacylglutathione hydrolase [Desulfurivibrio alkaliphilus
           AHT2]
          Length = 213

 Score =  128 bits (321), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 78/201 (38%), Positives = 108/201 (53%), Gaps = 7/201 (3%)

Query: 18  CTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLKEDLSL 77
           C  L  E+S +A+ +DPGGD  +I D  +  N  +K +  THGH DHV   A LKE    
Sbjct: 15  CYLLACEDSSQAMAIDPGGDEALILDHCRRNNLQLKMLVCTHGHPDHVAANAALKEATGA 74

Query: 78  TIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFKVFHCPGHS 137
            I+  H++DAA  GK  E  +  S+     +   DR +QD DT+ LG+   +V H PGH+
Sbjct: 75  EIVM-HREDAAFFGK-PEVGQYFSMLGLPPSPPPDRLVQDRDTIELGSIKLEVIHTPGHT 132

Query: 138 PGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEISFVCGH- 196
           PG +   +  + F+  GDTLF  ++GRTD   GD   L++SI  ++L L  E     GH 
Sbjct: 133 PGGICLYSPPHLFS--GDTLFVGAVGRTDFPGGDTATLVDSIRQRLLVLPPETVVWPGHG 190

Query: 197 --GPNSTIGRERRLNPFLKSN 215
             G  STI  E   NPFL+  
Sbjct: 191 YGGSQSTIAAEAAENPFLQEK 211


>gi|104780137|ref|YP_606635.1| metallo-beta-lactamase family hydrolase [Pseudomonas entomophila
           L48]
 gi|95109124|emb|CAK13821.1| putative hydrolase; metallo-beta-lactamase family protein
           [Pseudomonas entomophila L48]
          Length = 214

 Score =  128 bits (321), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 108/204 (52%), Gaps = 4/204 (1%)

Query: 11  VTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQ 70
           V P + NCT + D  S +A+VVDPGGD   I   +Q     +  I  TH H DH   + +
Sbjct: 15  VGPLQCNCTLIGDPVSKKAIVVDPGGDEQKILARLQHHGLTLVSIIHTHAHFDHFLASGK 74

Query: 71  LKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFKV 130
           LK  L+   +  HK D  +   ++ Q ++  +       S DRWL D + L  G  +   
Sbjct: 75  LKA-LTGATLHLHKADQPLWDNLEMQCQMFGMPYTP-VPSPDRWLSDDEELACGCGV--A 130

Query: 131 FHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEI 190
            H PGH+PG + +   E+     GDTLFR  +GRTD+  GD + ++ SI  ++  L +E 
Sbjct: 131 LHTPGHTPGSMSFWFAEHKLLIAGDTLFRRGVGRTDLWGGDQRAIVRSIKERLYRLDEEA 190

Query: 191 SFVCGHGPNSTIGRERRLNPFLKS 214
             V GHGP++ +G E R NPF+++
Sbjct: 191 IVVTGHGPDTRLGDEMRENPFVRA 214


>gi|225848337|ref|YP_002728500.1| metallo-beta-lactamase [Sulfurihydrogenibium azorense Az-Fu1]
 gi|225644580|gb|ACN99630.1| putative metallo-beta-lactamase domain protein
           [Sulfurihydrogenibium azorense Az-Fu1]
          Length = 212

 Score =  127 bits (320), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 74/206 (35%), Positives = 116/206 (56%), Gaps = 7/206 (3%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGD-LDIIKDVIQSRNFHVKQIWITHGHVDHVG 66
           ++ V P  +NC  ++DE++ + V++DPG D  DI+++V    +F+VK I  THGH+DHVG
Sbjct: 5   VLTVGPLAENCVVIYDEKTKDCVIIDPGADGEDILEEV---EHFNVKAILATHGHLDHVG 61

Query: 67  GAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTH 126
               LK+ L +      KD+  +   +     ++       N   D  L++GD L  G+ 
Sbjct: 62  QVGFLKKILDVPFYMNVKDEFLINNDIFPGFSMIIKATKCPNPDFD--LKEGDNLKFGSI 119

Query: 127 IFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPL 186
            F V   PGH+PG V + N EN     GDTLF  S+GR D+  G+  +L  S+ +K++ L
Sbjct: 120 SFYVIETPGHTPGSVCFYNQENKILISGDTLFAGSVGRVDLPGGNGAELEKSL-SKLMTL 178

Query: 187 GDEISFVCGHGPNSTIGRERRLNPFL 212
            ++     GHG  +TIG+E+R NPF+
Sbjct: 179 PEDTVVYPGHGGRTTIGKEKRTNPFI 204


>gi|20807652|ref|NP_622823.1| Zn-dependent hydrolase, including glyoxylases [Thermoanaerobacter
           tengcongensis MB4]
 gi|20516197|gb|AAM24427.1| Zn-dependent hydrolases, including glyoxylases [Thermoanaerobacter
           tengcongensis MB4]
          Length = 214

 Score =  127 bits (320), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 76/205 (37%), Positives = 113/205 (55%), Gaps = 6/205 (2%)

Query: 11  VTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQ 70
           V P+  N   ++D ++ E +++DPG   D IK+ I+     VK I +THGH DH+GG  +
Sbjct: 13  VGPYGANLYVVWDRDTREGIIIDPGEVYDEIKNYIKENGIKVKHILLTHGHFDHIGGVEE 72

Query: 71  LKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNAS-SDRWLQDGDTLLLGTHIFK 129
           ++   +   +   ++DA M+  +D    L  +       S +D  L+D D L  G +  +
Sbjct: 73  IRA-FTGGKVAISEEDAPML--LDPSQNLSEMVFKKVICSPADIILKDKDVLGFGNYYVE 129

Query: 130 VFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDE 189
           V   PGH+ G V +   +  F   GDTLFR SIGR D   G+++ L+ SI  ++L L DE
Sbjct: 130 VISTPGHTKGSVCFKIGDVYFT--GDTLFRGSIGRHDFPGGNFETLMASIKERLLTLKDE 187

Query: 190 ISFVCGHGPNSTIGRERRLNPFLKS 214
                GHG  STIGRE+RLN FLK+
Sbjct: 188 TVIYPGHGDFSTIGREKRLNMFLKN 212


>gi|254479347|ref|ZP_05092684.1| metallo-beta-lactamase domain protein, putative [Carboxydibrachium
           pacificum DSM 12653]
 gi|214034713|gb|EEB75450.1| metallo-beta-lactamase domain protein, putative [Carboxydibrachium
           pacificum DSM 12653]
          Length = 209

 Score =  127 bits (319), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 76/205 (37%), Positives = 113/205 (55%), Gaps = 6/205 (2%)

Query: 11  VTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQ 70
           V P+  N   ++D ++ E +++DPG   D IK+ I+     VK I +THGH DH+GG  +
Sbjct: 8   VGPYGANLYVVWDRDTREGIIIDPGEVYDEIKNYIKENGIKVKHILLTHGHFDHIGGVEE 67

Query: 71  LKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNAS-SDRWLQDGDTLLLGTHIFK 129
           ++   +   +   ++DA M+  +D    L  +       S +D  L+D D L  G +  +
Sbjct: 68  IRA-FTGGKVAISEEDAPML--LDPSQNLSEMVFKKVICSPADIILKDKDVLGFGNYSLE 124

Query: 130 VFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDE 189
           V   PGH+ G V +   +  F   GDTLFR SIGR D   G+++ L+ SI  ++L L DE
Sbjct: 125 VISTPGHTKGSVCFKIGDVYFT--GDTLFRGSIGRHDFPGGNFETLMASIKERLLTLKDE 182

Query: 190 ISFVCGHGPNSTIGRERRLNPFLKS 214
                GHG  STIGRE+RLN FLK+
Sbjct: 183 TVIYPGHGDFSTIGREKRLNMFLKN 207


>gi|229047979|ref|ZP_04193555.1| Metallo-beta-lactamase [Bacillus cereus AH676]
 gi|228723436|gb|EEL74805.1| Metallo-beta-lactamase [Bacillus cereus AH676]
          Length = 209

 Score =  127 bits (319), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 68/204 (33%), Positives = 112/204 (54%), Gaps = 7/204 (3%)

Query: 13  PFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLK 72
           P + N   L +++  E ++ DPG + + +   +Q        + +TH H DH+G    ++
Sbjct: 10  PLQTNAYILMNDQK-ECIIFDPGHEGEKLVTYLQEEQLKPLAVLLTHAHFDHIGAVDAVR 68

Query: 73  EDLSLTIIGPHKDDAAMMGKVD---EQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFK 129
           +   + +   HK++A  +G       Q  +++  + A+ A  D  +    TL +G+  F+
Sbjct: 69  DAFYIPVY-VHKEEADWLGDATVNGSQIFMMNRSITAKPA--DHIIDAEGTLTIGSFNFE 125

Query: 130 VFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDE 189
           VF  PGHSPG + Y + E N    GD LF++SIGRTD+  G + +LI SI  K+  L DE
Sbjct: 126 VFETPGHSPGSISYYSKEANAVFSGDVLFQTSIGRTDLPGGSFAELIGSIEEKLFVLPDE 185

Query: 190 ISFVCGHGPNSTIGRERRLNPFLK 213
            + +CGHGP ++IG E+  NPFL+
Sbjct: 186 TAVLCGHGPETSIGFEKENNPFLQ 209


>gi|86159897|ref|YP_466682.1| beta-lactamase-like protein [Anaeromyxobacter dehalogenans 2CP-C]
 gi|85776408|gb|ABC83245.1| Beta-lactamase-like protein [Anaeromyxobacter dehalogenans 2CP-C]
          Length = 218

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 72/205 (35%), Positives = 101/205 (49%), Gaps = 2/205 (0%)

Query: 11  VTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQ 70
           V PF  NC       + EAV+VDPG ++     +     + V +I+ THGH+DHVGG A+
Sbjct: 9   VGPFAANCWLAACGRTGEAVLVDPGAEVHRALALTGPSGWRVTRIFCTHGHIDHVGGGAE 68

Query: 71  LKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFKV 130
            +      +   H  D A +  +  QA +            D    DG+   +G    +V
Sbjct: 69  ARAATGAPLQ-IHAADDAWLEALPRQAEMFGFD-PVEAPEVDHHHVDGEAFRVGDCEAQV 126

Query: 131 FHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEI 190
            H PGHS G              GDTLF  S+GRTD+  GD++ L  SI  ++ PLGD +
Sbjct: 127 IHTPGHSAGSCSLWFPGEQVLFTGDTLFAGSVGRTDLPGGDFEALERSIKERLFPLGDAV 186

Query: 191 SFVCGHGPNSTIGRERRLNPFLKSN 215
            F  GHGP+ T+G ERR NPF+  +
Sbjct: 187 RFHPGHGPSGTLGEERRANPFVGES 211


>gi|229086831|ref|ZP_04218993.1| Metallo-beta-lactamase [Bacillus cereus Rock3-44]
 gi|228696475|gb|EEL49298.1| Metallo-beta-lactamase [Bacillus cereus Rock3-44]
          Length = 209

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 67/204 (32%), Positives = 112/204 (54%), Gaps = 7/204 (3%)

Query: 13  PFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLK 72
           P + N   L +++  E ++ DPG + + +   +Q        + +TH H DH+G    ++
Sbjct: 10  PLQTNAYILSNDQK-ECIIFDPGSEGEKLVTYLQEEQLKPLAVLLTHAHFDHIGAVDTVR 68

Query: 73  EDLSLTIIGPHKDDAAMMGKVD---EQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFK 129
           +   + +   HK++A  +G  +    Q  +++  + A+ A  D+ ++   TL +G+  F+
Sbjct: 69  DAFHIPVY-VHKEEADWLGDANVNGSQIFMMNRSITAKQA--DQIIEGEGTLTIGSFTFE 125

Query: 130 VFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDE 189
           +F  PGHSPG V Y   E +    GD LF+ SIGRTD+  G + +LI SI  K+  L DE
Sbjct: 126 MFETPGHSPGSVSYYCKEASAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKLFALPDE 185

Query: 190 ISFVCGHGPNSTIGRERRLNPFLK 213
            + +CGHGP + IG E+  NPFL+
Sbjct: 186 TAVLCGHGPETNIGFEKENNPFLQ 209


>gi|148264967|ref|YP_001231673.1| beta-lactamase domain-containing protein [Geobacter uraniireducens
           Rf4]
 gi|146398467|gb|ABQ27100.1| beta-lactamase domain protein [Geobacter uraniireducens Rf4]
          Length = 251

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 73/213 (34%), Positives = 107/213 (50%), Gaps = 4/213 (1%)

Query: 2   SKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGH 61
           S + F  V V     NC  L  EE+ E +VVDPG D D +   ++     +K +  THGH
Sbjct: 40  SPMIFETVVVGQLGVNCFILGCEETKEGIVVDPGADADRVLAAVKKSGLAIKYVLNTHGH 99

Query: 62  VDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
            DHVGG  +L E     ++  H+ D   + +  E A    ++    +   D  L+DG  +
Sbjct: 100 FDHVGGNRRLLEATGAKLL-IHEADVYFLSRAAEVAAAYGLKTE-NSPKPDGLLEDGMVV 157

Query: 122 LLGTHIFKVFHCPGHSPGH-VIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           + G+   KV H PGH+PG   +Y+  E      GDTLF   +GRTD     ++ LI  I 
Sbjct: 158 IFGSQQLKVLHTPGHTPGGCCLYLESEGKVI-TGDTLFADGVGRTDFPGSSHEALIEGIR 216

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           NK+  L +      GHGP+S IG E+  NP+++
Sbjct: 217 NKLFTLPEPTLVYPGHGPSSNIGHEKSNNPYVR 249


>gi|168187500|ref|ZP_02622135.1| metallo-beta-lactamase family protein [Clostridium botulinum C str.
           Eklund]
 gi|169294607|gb|EDS76740.1| metallo-beta-lactamase family protein [Clostridium botulinum C str.
           Eklund]
          Length = 199

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 73/199 (36%), Positives = 108/199 (54%), Gaps = 10/199 (5%)

Query: 14  FKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLKE 73
           +  NC  L D    E  ++DPGGD D++ + I + N H+K I +THGH+DH GG  +LK+
Sbjct: 11  YGANCYILIDGN--EGCIIDPGGDADMLINNIDTFNVHIKFILLTHGHMDHTGGVQELKD 68

Query: 74  DLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFKVFHC 133
             ++ +    KD   M     + +++     N      D+ ++DGD L LG    K    
Sbjct: 69  RYNVPVYINEKDRELMR----KHSQVFGPIWNE--TKEDKTIKDGDVLKLGNLEIKCLET 122

Query: 134 PGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEISFV 193
           PGH+PG + ++    N    GDTLFR S+GRTD   GD+ +LI SI  K++ L D+   +
Sbjct: 123 PGHTPGGMSFI--VKNVVFTGDTLFRGSVGRTDFPGGDHSKLIESIKEKLIVLDDDTVVL 180

Query: 194 CGHGPNSTIGRERRLNPFL 212
            GH   S I  E++ NPFL
Sbjct: 181 PGHEGESNIKFEKQYNPFL 199


>gi|116048754|ref|YP_792446.1| hypothetical protein PA14_53510 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|115583975|gb|ABJ09990.1| conserved hypothetical protein [Pseudomonas aeruginosa UCBPP-PA14]
          Length = 213

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 71/203 (34%), Positives = 108/203 (53%), Gaps = 4/203 (1%)

Query: 11  VTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQ 70
           V P + NCT + D  + +A+VVDPGGD ++I   +      V  I  TH H+DH   + +
Sbjct: 14  VGPLQCNCTIIGDPLTRKAIVVDPGGDHELILQRLDRLGLQVVSIIHTHAHLDHFLASGE 73

Query: 71  LKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFKV 130
           +K+    ++   HKDD  +   ++ Q +L  +      A  DRWL D + L  G  +   
Sbjct: 74  MKKRTGASL-HLHKDDQFLWDNLEMQCQLFGVPYTPVPAP-DRWLADDEELACGCGV--A 129

Query: 131 FHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEI 190
            H PGH+PG + +          GDTLFR  IGRTD+  GD   +  SI  ++  L ++ 
Sbjct: 130 LHTPGHTPGSMSFWFPRAKLLIAGDTLFRRGIGRTDLWGGDSAAIQRSIRLRLYSLDEDA 189

Query: 191 SFVCGHGPNSTIGRERRLNPFLK 213
           + V GHGP++T+G E R NPF++
Sbjct: 190 TVVAGHGPDTTLGEEMRENPFVR 212


>gi|182415466|ref|YP_001820532.1| beta-lactamase domain-containing protein [Opitutus terrae PB90-1]
 gi|177842680|gb|ACB76932.1| beta-lactamase domain protein [Opitutus terrae PB90-1]
          Length = 211

 Score =  126 bits (317), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 65/211 (30%), Positives = 106/211 (50%), Gaps = 2/211 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVD-PGGDLDIIKDVIQSRNFHVKQIWITHGHV 62
           ++ H++   P + N   L   E  EAV++D P G    ++ ++Q     + ++WITHGH 
Sbjct: 1   MNLHVLPAGPIRTNAYLLTAPERGEAVLIDAPAGVWLDVEPILQKEKCRLTELWITHGHW 60

Query: 63  DHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLL 122
           DH  GAA++       +   H DD  ++     Q   +  R++      DRW+  G+   
Sbjct: 61  DHTQGAAEIVRQTGAKVRA-HSDDRPLLETPKVQEAFMGTRLDVEPVGVDRWVGQGERFE 119

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
                 +V H PGH  G+V+Y       A +GD LF  S+GRTD+  G ++ L +SI  +
Sbjct: 120 SLGQPVEVRHVPGHCAGNVLYFLPRAQAAFVGDALFAGSVGRTDLPGGSFETLEHSIRQQ 179

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           I  L +E +   GHG ++T+G E   NP++ 
Sbjct: 180 IYTLPEETAVYPGHGADTTVGAEMATNPYVS 210


>gi|197123954|ref|YP_002135905.1| beta-lactamase [Anaeromyxobacter sp. K]
 gi|196173803|gb|ACG74776.1| beta-lactamase domain protein [Anaeromyxobacter sp. K]
          Length = 218

 Score =  126 bits (317), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 72/205 (35%), Positives = 100/205 (48%), Gaps = 2/205 (0%)

Query: 11  VTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQ 70
           V PF  NC       + EAV+VDPG ++     +     + + +I+ THGH+DHVGG A+
Sbjct: 9   VGPFAANCWLAACGRTGEAVLVDPGAEVHRALALAGPSGWRITRIFCTHGHIDHVGGGAE 68

Query: 71  LKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFKV 130
            +      +   H  D A +  +  QA +            D    DG+ L +G    +V
Sbjct: 69  ARAATGAPLQ-IHAADDAWLEALPRQAEMFGFD-PVEAPEVDHHHVDGEALRVGDCEARV 126

Query: 131 FHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEI 190
            H PGHS G              GDTLF  S+GRTD+  GD+  L  SI  ++ PLGD +
Sbjct: 127 IHTPGHSAGSCSLWFPGEQILFTGDTLFAGSVGRTDLPGGDFDALERSIKERLFPLGDAV 186

Query: 191 SFVCGHGPNSTIGRERRLNPFLKSN 215
            F  GHGP  T+G ERR NPF+  +
Sbjct: 187 RFHPGHGPAGTLGEERRANPFVGES 211


>gi|189502040|ref|YP_001957757.1| hypothetical protein Aasi_0630 [Candidatus Amoebophilus asiaticus
           5a2]
 gi|189497481|gb|ACE06028.1| hypothetical protein Aasi_0630 [Candidatus Amoebophilus asiaticus
           5a2]
          Length = 214

 Score =  126 bits (317), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 69/204 (33%), Positives = 109/204 (53%), Gaps = 6/204 (2%)

Query: 13  PFKQNCTFLFDEESLEAVVVDPGG----DLDIIKDVIQSRNFHVKQIWITHGHVDHVGGA 68
           P  ++   ++D       V+DPG     +   + D IQ+    V+ +  TH H+DH+ G 
Sbjct: 11  PLAEHTYVVYDPLDRRCAVIDPGCLEPHEQKRLSDFIQNEQLQVEHLINTHCHIDHIVGN 70

Query: 69  AQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIF 128
           A +K   S+ +   H  D +++    + A    I        +D +L  GD + +G +  
Sbjct: 71  AYIKRTYSVKL-AIHPADLSLLSIAADHAPRYGIH-GYEPTQADIFLTAGDIIQIGNNQL 128

Query: 129 KVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGD 188
           KV H PGHSPGH+   + ++ F  +GD LF++ IGRTD+  GDY  LI +I+ ++  L D
Sbjct: 129 KVLHVPGHSPGHIALYSEKDQFCLVGDVLFKNFIGRTDLPGGDYVTLIQTIHEQLFALQD 188

Query: 189 EISFVCGHGPNSTIGRERRLNPFL 212
           E+    GHGPN+TIG E+  NPF+
Sbjct: 189 EVIVYSGHGPNTTIGTEKTNNPFV 212


>gi|28211804|ref|NP_782748.1| hydroxyacylglutathione hydrolase [Clostridium tetani E88]
 gi|28204246|gb|AAO36685.1| hydroxyacylglutathione hydrolase [Clostridium tetani E88]
          Length = 201

 Score =  126 bits (316), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 69/205 (33%), Positives = 115/205 (56%), Gaps = 10/205 (4%)

Query: 9   VQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGA 68
           + V  ++ NC  L D++S E ++VDPG + ++I   +   +  VK I +THGHVDHV   
Sbjct: 6   IPVGMYQANCYILMDKKSKEGIIVDPGDEANLILQTVNKMDCKVKYILLTHGHVDHVSAV 65

Query: 69  AQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNA-SSDRWLQDGDTLLLGTHI 127
            ++K+ L   +    KD+ +++  +D       +  N++   ++D  +++GDT  +G   
Sbjct: 66  KEVKDSLKAPVGINEKDEESILKGMD-------LFGNSQTCGAADIKIKEGDTFKIGDKE 118

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
            K    PGHS G + ++    N    GDTLF  SIGRTD   G+++ LI +I  KIL + 
Sbjct: 119 IKCIETPGHSLGGMCFLI--ENIIFTGDTLFEGSIGRTDFYGGNFEILIKNIKEKILTIP 176

Query: 188 DEISFVCGHGPNSTIGRERRLNPFL 212
           ++   + GHG  +T+G+E+  NPFL
Sbjct: 177 EDTLVLPGHGMETTVGKEKISNPFL 201


>gi|218263051|ref|ZP_03477296.1| hypothetical protein PRABACTJOHN_02977 [Parabacteroides johnsonii
           DSM 18315]
 gi|218222984|gb|EEC95634.1| hypothetical protein PRABACTJOHN_02977 [Parabacteroides johnsonii
           DSM 18315]
          Length = 212

 Score =  126 bits (316), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 73/203 (35%), Positives = 111/203 (54%), Gaps = 6/203 (2%)

Query: 14  FKQNCTFLFDEESLEAVVVDPGG----DLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAA 69
           F++N TFL  +++ EAV++D G     +   + D I      +K +  TH HVDHV G  
Sbjct: 12  FQEN-TFLLYDDTREAVLIDCGCCRKEEEKELTDFILENKLTLKHLLCTHLHVDHVFGNG 70

Query: 70  QLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFK 129
            + +   L     +K D   +   DEQA+L  +R    N   ++++  G+T+  GT   +
Sbjct: 71  FIYKTYGLKPEA-NKQDVEKLPSPDEQAKLFGLRQQVENVPVEKYIVGGETIKFGTSELQ 129

Query: 130 VFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDE 189
           V   PGHSPG V + N +N FA +GD LF  SIGRTD+  G+ + L+ +I +K+L L DE
Sbjct: 130 VLTVPGHSPGSVAFYNKKNGFAIVGDALFAGSIGRTDLWGGNQEVLVAAIRDKLLSLPDE 189

Query: 190 ISFVCGHGPNSTIGRERRLNPFL 212
                GHGP + +  E+  NP+L
Sbjct: 190 TVIYPGHGPETRVIDEKFNNPYL 212


>gi|229111734|ref|ZP_04241282.1| Metallo-beta-lactamase [Bacillus cereus Rock1-15]
 gi|228671728|gb|EEL27024.1| Metallo-beta-lactamase [Bacillus cereus Rock1-15]
          Length = 209

 Score =  126 bits (316), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 68/204 (33%), Positives = 111/204 (54%), Gaps = 7/204 (3%)

Query: 13  PFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLK 72
           P + N   L +++  E ++ DPG + + +   +Q        + +TH H DH+G    ++
Sbjct: 10  PLQTNAYILMNDQK-ECIIFDPGHEGEKLVTYLQEEQLKPLAVLLTHAHFDHIGAVDAVR 68

Query: 73  EDLSLTIIGPHKDDAAMMGKVD---EQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFK 129
           +   + +   HK++A  +G       Q  +++  + A+ A  D  +    TL +G+  F+
Sbjct: 69  DAFYIPVY-VHKEEADWLGDATVNGSQIFMMNRSITAKPA--DHIIDAEGTLTIGSFNFE 125

Query: 130 VFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDE 189
           VF  PGHSPG + Y + E N    GD LF+ SIGRTD+  G + +LI SI  K+  L DE
Sbjct: 126 VFETPGHSPGSISYYSKEANAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKLFVLPDE 185

Query: 190 ISFVCGHGPNSTIGRERRLNPFLK 213
            + +CGHGP ++IG E+  NPFL+
Sbjct: 186 TAVLCGHGPETSIGFEKENNPFLQ 209


>gi|116747917|ref|YP_844604.1| beta-lactamase domain-containing protein [Syntrophobacter
           fumaroxidans MPOB]
 gi|116696981|gb|ABK16169.1| beta-lactamase domain protein [Syntrophobacter fumaroxidans MPOB]
          Length = 215

 Score =  126 bits (316), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 80/208 (38%), Positives = 104/208 (50%), Gaps = 8/208 (3%)

Query: 9   VQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGA 68
           + V  F+ NC  L +  S  AVV+DPG + + I   I +       I ITH H+DHV GA
Sbjct: 13  IPVGMFRTNCYVLGETRSHRAVVIDPGAEGERIAGRIGALGLQPVAILITHAHIDHVMGA 72

Query: 69  AQLKEDLSLTIIGPHKDDAAM---MGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGT 125
             LKE+L   I    KD   +   M  +D+ A     R  A     DR L++GD L  G 
Sbjct: 73  WSLKEELGGEIFLHPKDQPLLDDHMIGLDDLACAHVPRFAA-----DRTLEEGDVLDFGP 127

Query: 126 HIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILP 185
               V   PGH+PGHV     E     +GDT+F  SIGRTD   G + +LI S+  KI  
Sbjct: 128 IRLSVIETPGHTPGHVSVYFPEAKSIFVGDTIFAGSIGRTDFPGGSHDRLIRSVKEKIFT 187

Query: 186 LGDEISFVCGHGPNSTIGRERRLNPFLK 213
           L  +     GHGP +T+ RE R NPF +
Sbjct: 188 LPGDTLVYPGHGPGTTVEREMRTNPFFR 215


>gi|229129540|ref|ZP_04258511.1| Metallo-beta-lactamase [Bacillus cereus BDRD-Cer4]
 gi|229152461|ref|ZP_04280653.1| Metallo-beta-lactamase [Bacillus cereus m1550]
 gi|228631069|gb|EEK87706.1| Metallo-beta-lactamase [Bacillus cereus m1550]
 gi|228654145|gb|EEL10012.1| Metallo-beta-lactamase [Bacillus cereus BDRD-Cer4]
          Length = 239

 Score =  126 bits (316), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 67/204 (32%), Positives = 111/204 (54%), Gaps = 7/204 (3%)

Query: 13  PFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLK 72
           P + N   L +++  E ++ DPG + + +   +Q +      + +TH H DH+G    ++
Sbjct: 40  PLQTNAYILMNDQK-ECIIFDPGHEGEKLVTYLQEKQLKPLAVLLTHAHFDHIGAVDAVR 98

Query: 73  EDLSLTIIGPHKDDAAMMGKVD---EQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFK 129
           +   + +   HK++A  +G       Q  +++  + A+ A  D  +    TL +G+  F+
Sbjct: 99  DAFHIPVY-VHKEEADWLGDATVNGSQIFMMNRSITAKPA--DHIIDAEGTLTIGSFNFE 155

Query: 130 VFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDE 189
           +F  PGHSPG + Y   E N    GD LF+ SIGRTD+  G + +LI SI  K+  L DE
Sbjct: 156 IFETPGHSPGSISYYTKEANAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKLFVLPDE 215

Query: 190 ISFVCGHGPNSTIGRERRLNPFLK 213
            + +CGHGP ++IG E+  NPFL+
Sbjct: 216 TAVLCGHGPETSIGFEKENNPFLQ 239


>gi|229192471|ref|ZP_04319434.1| Metallo-beta-lactamase [Bacillus cereus ATCC 10876]
 gi|228591048|gb|EEK48904.1| Metallo-beta-lactamase [Bacillus cereus ATCC 10876]
          Length = 239

 Score =  125 bits (315), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 67/204 (32%), Positives = 111/204 (54%), Gaps = 7/204 (3%)

Query: 13  PFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLK 72
           P + N   L +++  E ++ DPG + + +   +Q        + +TH H DH+G    ++
Sbjct: 40  PLQTNAYILMNDQK-ECIIFDPGHEGEKLVTYVQEEQLKPLAVLLTHAHFDHIGAVDAVR 98

Query: 73  EDLSLTIIGPHKDDAAMMGKVD---EQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFK 129
           +   + +   HK++A  +G       Q  +++  + A+ A  D  +    TL +G+  F+
Sbjct: 99  DTFHIPVY-VHKEEADWLGDATVNGSQIFMMNRSITAKPA--DHIIDAEGTLTIGSFNFE 155

Query: 130 VFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDE 189
           +F  PGHSPG + Y + E N    GD LF+ SIGRTD+  G + +LI SI  K+  L DE
Sbjct: 156 IFETPGHSPGSISYYSKEANAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKLFVLPDE 215

Query: 190 ISFVCGHGPNSTIGRERRLNPFLK 213
            + +CGHGP ++IG E+  NPFL+
Sbjct: 216 TAVLCGHGPETSIGFEKENNPFLQ 239


>gi|229061955|ref|ZP_04199282.1| Metallo-beta-lactamase [Bacillus cereus AH603]
 gi|229169007|ref|ZP_04296723.1| Metallo-beta-lactamase [Bacillus cereus AH621]
 gi|228614416|gb|EEK71525.1| Metallo-beta-lactamase [Bacillus cereus AH621]
 gi|228717339|gb|EEL69011.1| Metallo-beta-lactamase [Bacillus cereus AH603]
          Length = 209

 Score =  125 bits (315), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 67/204 (32%), Positives = 113/204 (55%), Gaps = 7/204 (3%)

Query: 13  PFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLK 72
           P + N   L ++++ E ++ DPG + + +   +Q        + +TH H DH+G    ++
Sbjct: 10  PLQTNAYILTNDQN-ECIIFDPGHEGEKLVTYLQEAQLKPLAVLLTHAHFDHIGAVDAVR 68

Query: 73  EDLSLTIIGPHKDDAAMMGKVD---EQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFK 129
           +   + +   HK++A  +G       Q  +++  + A+ A  D  + +  TL +G+  F+
Sbjct: 69  DAFHIPVY-VHKEEADWLGDATVNGSQIFMMNRSITAKPA--DHIIDEEGTLTIGSFSFE 125

Query: 130 VFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDE 189
           +F  PGHSPG + Y + E N    GD LF+ SIGRTD+  G + +LI SI  K+  L DE
Sbjct: 126 IFETPGHSPGSISYYSKEANAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKLFVLPDE 185

Query: 190 ISFVCGHGPNSTIGRERRLNPFLK 213
            + +CGHGP ++IG E+  NPFL+
Sbjct: 186 TAVLCGHGPETSIGFEKENNPFLQ 209


>gi|30022341|ref|NP_833972.1| hydroxyacylglutathione hydrolase [Bacillus cereus ATCC 14579]
 gi|29897898|gb|AAP11173.1| Hydroxyacylglutathione hydrolase [Bacillus cereus ATCC 14579]
          Length = 209

 Score =  125 bits (315), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 67/204 (32%), Positives = 111/204 (54%), Gaps = 7/204 (3%)

Query: 13  PFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLK 72
           P + N   L +++  E ++ DPG + + +   +Q +      + +TH H DH+G    ++
Sbjct: 10  PLQTNAYILMNDQK-ECIIFDPGHEGEKLVTYLQEKQLKPLAVLLTHAHFDHIGAVDAVR 68

Query: 73  EDLSLTIIGPHKDDAAMMGKVD---EQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFK 129
           +   + +   HK++A  +G       Q  +++  + A+ A  D  +    TL +G+  F+
Sbjct: 69  DAFHIPVY-VHKEEADWLGDATVNGSQIFMMNRSITAKPA--DHIIDAEGTLTIGSFNFE 125

Query: 130 VFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDE 189
           +F  PGHSPG + Y   E N    GD LF+ SIGRTD+  G + +LI SI  K+  L DE
Sbjct: 126 IFETPGHSPGSISYYTKEANAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKLFVLPDE 185

Query: 190 ISFVCGHGPNSTIGRERRLNPFLK 213
            + +CGHGP ++IG E+  NPFL+
Sbjct: 186 TAVLCGHGPETSIGFEKENNPFLQ 209


>gi|75763951|ref|ZP_00743580.1| Hydroxyacylglutathione hydrolase [Bacillus thuringiensis serovar
           israelensis ATCC 35646]
 gi|218899427|ref|YP_002447838.1| metallo-beta-lactamase family protein [Bacillus cereus G9842]
 gi|228902775|ref|ZP_04066921.1| Metallo-beta-lactamase [Bacillus thuringiensis IBL 4222]
 gi|74488563|gb|EAO52150.1| Hydroxyacylglutathione hydrolase [Bacillus thuringiensis serovar
           israelensis ATCC 35646]
 gi|218541364|gb|ACK93758.1| metallo-beta-lactamase family protein [Bacillus cereus G9842]
 gi|228856849|gb|EEN01363.1| Metallo-beta-lactamase [Bacillus thuringiensis IBL 4222]
          Length = 209

 Score =  125 bits (315), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 67/204 (32%), Positives = 111/204 (54%), Gaps = 7/204 (3%)

Query: 13  PFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLK 72
           P + N   L +++  E ++ DPG + + +   +Q        + +TH H DH+G    ++
Sbjct: 10  PLQTNAYILMNDQK-ECIIFDPGHEGEKLVTYLQEEQLKPLAVLLTHAHFDHIGAVDAVR 68

Query: 73  EDLSLTIIGPHKDDAAMMGKVD---EQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFK 129
           +   + +   HK++A  +G       Q  +++  + A+ A  D  +    TL +G+  F+
Sbjct: 69  DAFYIPVY-VHKEEADWLGDATVNGSQIFMMNRSITAKPA--DHIIDAEGTLTIGSFNFE 125

Query: 130 VFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDE 189
           +F  PGHSPG + Y + E N    GD LF+ SIGRTD+  G + +LI SI  K+  L DE
Sbjct: 126 IFETPGHSPGSISYYSKEANAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKLFVLPDE 185

Query: 190 ISFVCGHGPNSTIGRERRLNPFLK 213
            + +CGHGP ++IG E+  NPFL+
Sbjct: 186 TAVLCGHGPETSIGFEKENNPFLQ 209


>gi|206971234|ref|ZP_03232185.1| metallo-beta-lactamase family protein [Bacillus cereus AH1134]
 gi|206734006|gb|EDZ51177.1| metallo-beta-lactamase family protein [Bacillus cereus AH1134]
          Length = 209

 Score =  125 bits (315), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 67/204 (32%), Positives = 111/204 (54%), Gaps = 7/204 (3%)

Query: 13  PFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLK 72
           P + N   L +++  E ++ DPG + + +   +Q        + +TH H DH+G    ++
Sbjct: 10  PLQTNAYILMNDQK-ECIIFDPGHEGEKLVTYVQEEQLKPLAVLLTHAHFDHIGAVDAVR 68

Query: 73  EDLSLTIIGPHKDDAAMMGKVD---EQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFK 129
           +   + +   HK++A  +G       Q  +++  + A+ A  D  +    TL +G+  F+
Sbjct: 69  DAFHIPVY-VHKEEADWLGDATVNGSQIFMMNRSITAKPA--DHIIDAEGTLTIGSFNFE 125

Query: 130 VFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDE 189
           +F  PGHSPG + Y + E N    GD LF+ SIGRTD+  G + +LI SI  K+  L DE
Sbjct: 126 IFETPGHSPGSISYYSKEANAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKLFVLPDE 185

Query: 190 ISFVCGHGPNSTIGRERRLNPFLK 213
            + +CGHGP ++IG E+  NPFL+
Sbjct: 186 TAVLCGHGPETSIGFEKENNPFLQ 209


>gi|260892288|ref|YP_003238385.1| Hydroxyacylglutathione hydrolase [Ammonifex degensii KC4]
 gi|260864429|gb|ACX51535.1| Hydroxyacylglutathione hydrolase [Ammonifex degensii KC4]
          Length = 211

 Score =  125 bits (315), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 76/210 (36%), Positives = 111/210 (52%), Gaps = 7/210 (3%)

Query: 8   IVQVTPFKQNCTFLFDEESL-EAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVG 66
           IV V    Q  T+L    S  EA+++DPG +   I             I +THGH DH+G
Sbjct: 4   IVLVVGELQTNTYLVGCPSTGEALIIDPGAEGGRILAAASRAGLRPTLICLTHGHADHIG 63

Query: 67  GAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARL-LSIRMNARNASSDRWLQDGDTLLLGT 125
             A+++  L+L ++  H +DA M+   D QA L + +         DR+L DG+ +  G 
Sbjct: 64  AVAEIRRTLNLPVL-IHAEDAHML--TDPQANLSVWLGRGFVVGEPDRYLHDGEEVTCGK 120

Query: 126 HIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILP 185
             F+V H PGH+PG +    +       GDTLF  S+GRTD   GD+++L++S+  K+L 
Sbjct: 121 LKFQVLHVPGHTPGSICL--YAPGVLFSGDTLFAGSVGRTDFPGGDWKKLLHSVRTKLLV 178

Query: 186 LGDEISFVCGHGPNSTIGRERRLNPFLKSN 215
           L DE     GHG ++TIG E+  NPFL   
Sbjct: 179 LPDETVVYPGHGASTTIGEEKEQNPFLTGE 208


>gi|228954545|ref|ZP_04116570.1| Metallo-beta-lactamase [Bacillus thuringiensis serovar kurstaki
           str. T03a001]
 gi|228805202|gb|EEM51796.1| Metallo-beta-lactamase [Bacillus thuringiensis serovar kurstaki
           str. T03a001]
          Length = 252

 Score =  125 bits (314), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 67/204 (32%), Positives = 111/204 (54%), Gaps = 7/204 (3%)

Query: 13  PFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLK 72
           P + N   L +++  E ++ DPG + + +   +Q        + +TH H DH+G    ++
Sbjct: 53  PLQTNAYILMNDQK-ECIIFDPGHEGEKLVTYLQEEQLKPLAVLLTHAHFDHIGAVDAVR 111

Query: 73  EDLSLTIIGPHKDDAAMMGKVD---EQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFK 129
           +   + +   HK++A  +G       Q  +++  + A+ A  D  +    TL +G+  F+
Sbjct: 112 DTFHIPVY-VHKEEADWLGDATVNGSQIFMMNRSITAKPA--DHIIDAEGTLTIGSFNFE 168

Query: 130 VFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDE 189
           +F  PGHSPG + Y + E N    GD LF+ SIGRTD+  G + +LI SI  K+  L DE
Sbjct: 169 IFETPGHSPGSISYYSKEANAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKLFVLPDE 228

Query: 190 ISFVCGHGPNSTIGRERRLNPFLK 213
            + +CGHGP ++IG E+  NPFL+
Sbjct: 229 TAVLCGHGPETSIGFEKENNPFLQ 252


>gi|228960527|ref|ZP_04122176.1| Metallo-beta-lactamase [Bacillus thuringiensis serovar pakistani
           str. T13001]
 gi|228799127|gb|EEM46095.1| Metallo-beta-lactamase [Bacillus thuringiensis serovar pakistani
           str. T13001]
          Length = 239

 Score =  125 bits (314), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 67/204 (32%), Positives = 111/204 (54%), Gaps = 7/204 (3%)

Query: 13  PFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLK 72
           P + N   L +++  E ++ DPG + + +   +Q        + +TH H DH+G    ++
Sbjct: 40  PLQTNAYILMNDQK-ECIIFDPGHEGEKLVTYLQEEQLKPLAVLLTHAHFDHIGAVDAVR 98

Query: 73  EDLSLTIIGPHKDDAAMMGKVD---EQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFK 129
           +   + +   HK++A  +G       Q  +++  + A+ A  D  +    TL +G+  F+
Sbjct: 99  DAFHIPVY-VHKEEANWLGDATVNGSQIFMMNRSITAKPA--DHIIDAEGTLTIGSFNFE 155

Query: 130 VFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDE 189
           +F  PGHSPG + Y + E N    GD LF+ SIGRTD+  G + +LI SI  K+  L DE
Sbjct: 156 IFETPGHSPGSISYYSKEANAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKLFVLPDE 215

Query: 190 ISFVCGHGPNSTIGRERRLNPFLK 213
            + +CGHGP ++IG E+  NPFL+
Sbjct: 216 TAVLCGHGPETSIGFEKENNPFLQ 239


>gi|225163445|ref|ZP_03725761.1| beta-lactamase domain protein [Opitutaceae bacterium TAV2]
 gi|224801945|gb|EEG20225.1| beta-lactamase domain protein [Opitutaceae bacterium TAV2]
          Length = 236

 Score =  125 bits (314), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 67/214 (31%), Positives = 110/214 (51%), Gaps = 2/214 (0%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVD-PGGDLDIIKDVIQSRNFHVKQIWITH 59
           +  +  H++   P + N   L    S EA+++D P G    +  ++Q  N  ++++W+TH
Sbjct: 23  LESMKLHVIPAGPIRTNAYLLTQASSGEAILIDAPEGVWADVAPILQKENCKLRELWLTH 82

Query: 60  GHVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGD 119
           GH DH+ G A++ E  S  ++  H+DD  ++   +     L   +  R    D  +  GD
Sbjct: 83  GHWDHMQGGAEVVEK-SGALVRAHEDDRVLIETPEVMDGFLGPGVPVRAMKIDAVVTQGD 141

Query: 120 TLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSI 179
            L       +V H PGH PG+V++       A +GD LF  S+GRTD+  G  +QL  S+
Sbjct: 142 RLRAFGIEAEVRHVPGHCPGNVLFYFAPMGAAFVGDALFAGSVGRTDLPGGSSEQLARSV 201

Query: 180 NNKILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
             +I  L +E     GHG  +T+G+ER  NPF++
Sbjct: 202 RTQIYTLPNETQVFPGHGGPTTVGKERESNPFVR 235


>gi|168181747|ref|ZP_02616411.1| metallo-beta-lactamase family protein [Clostridium botulinum Bf]
 gi|182674998|gb|EDT86959.1| metallo-beta-lactamase family protein [Clostridium botulinum Bf]
          Length = 199

 Score =  125 bits (314), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 75/209 (35%), Positives = 109/209 (52%), Gaps = 10/209 (4%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +    + V  +  NC  L D++  +  ++D GGD + I  +I+  N   + I +THGH+D
Sbjct: 1   MDIKTIPVGIYNANCYLLIDQD--KCAIIDSGGDPEDIIKIIEDNNLIPQFILLTHGHID 58

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVGG   +K+  ++      KD+      + E   +       +NA  D +L +G    L
Sbjct: 59  HVGGVEAIKDKYNIPFYINRKDEDL----IKEAEYIFGNFGKYKNA--DEYLVEGKEFQL 112

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    K    PGHSPG + ++   NN    GDTLFR SIGR+D + G +  LINSI +KI
Sbjct: 113 GNLKIKAIETPGHSPGGMSFL--VNNVIFTGDTLFRESIGRSDFIGGSHNTLINSIQSKI 170

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
             L  +I  + GHGP STIG E+  NPF 
Sbjct: 171 TVLDPDIYVLPGHGPQSTIGYEKDNNPFF 199


>gi|229081520|ref|ZP_04214019.1| Metallo-beta-lactamase [Bacillus cereus Rock4-2]
 gi|228701827|gb|EEL54314.1| Metallo-beta-lactamase [Bacillus cereus Rock4-2]
          Length = 239

 Score =  125 bits (314), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 67/204 (32%), Positives = 111/204 (54%), Gaps = 7/204 (3%)

Query: 13  PFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLK 72
           P + N   L +++  E ++ DPG + + +   +Q        + +TH H DH+G    ++
Sbjct: 40  PLQTNAYILMNDQK-ECIIFDPGHEGEKLVTYLQEEQLKPLAVLLTHAHFDHIGAVDAVR 98

Query: 73  EDLSLTIIGPHKDDAAMMGKVD---EQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFK 129
           +   + +   HK++A  +G       Q  +++  + A+ A  D  +    TL +G+  F+
Sbjct: 99  DTFHIPVY-VHKEEADWLGDATVNGSQIFMMNRSITAKPA--DHIIDAEGTLTIGSFNFE 155

Query: 130 VFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDE 189
           +F  PGHSPG + Y + E N    GD LF+ SIGRTD+  G + +LI SI  K+  L DE
Sbjct: 156 IFETPGHSPGSISYYSKEANAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKLFVLPDE 215

Query: 190 ISFVCGHGPNSTIGRERRLNPFLK 213
            + +CGHGP ++IG E+  NPFL+
Sbjct: 216 TAVLCGHGPETSIGFEKENNPFLQ 239


>gi|327399418|ref|YP_004340287.1| beta-lactamase domain-containing protein [Hippea maritima DSM
           10411]
 gi|327182047|gb|AEA34228.1| beta-lactamase domain protein [Hippea maritima DSM 10411]
          Length = 209

 Score =  125 bits (314), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 69/204 (33%), Positives = 112/204 (54%), Gaps = 2/204 (0%)

Query: 9   VQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGA 68
           V V   ++NC  +FDE S E  ++DPG + + I  VI+        I  TH H DHVG  
Sbjct: 5   VVVGELEENCYLVFDESSKECTIIDPGDEPEKIIGVIEKYALTPTIILNTHYHFDHVGAN 64

Query: 69  AQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIF 128
           A LK+  ++ +   H++D +++ K    A++  ++    +   D  L+DGD + +G+  F
Sbjct: 65  AFLKKRYNIKL-AIHENDLSLLKKAHIDAKIFLLKDQEPSPEPDILLKDGDIVDVGSLSF 123

Query: 129 KVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGD 188
           +V H PGH+PG V +      +   GDTLF  S+GR D   G    L++S+  +++ L D
Sbjct: 124 EVLHTPGHTPGSVCFYEKNKKWLFSGDTLFFESVGRWDFPSGSKNDLLDSL-KRLIKLPD 182

Query: 189 EISFVCGHGPNSTIGRERRLNPFL 212
           ++    GHG  +TI  ER+LNP++
Sbjct: 183 DVLVYPGHGEPTTIEHERKLNPYI 206


>gi|228923013|ref|ZP_04086306.1| Metallo-beta-lactamase [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
 gi|228836646|gb|EEM81994.1| Metallo-beta-lactamase [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
          Length = 239

 Score =  125 bits (314), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 67/204 (32%), Positives = 111/204 (54%), Gaps = 7/204 (3%)

Query: 13  PFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLK 72
           P + N   L +++  E ++ DPG + + +   +Q        + +TH H DH+G    ++
Sbjct: 40  PLQTNAYILMNDQK-ECIIFDPGHEGEKLVTYLQEEQLKPLAVLLTHAHFDHIGAVDAVR 98

Query: 73  EDLSLTIIGPHKDDAAMMGKVD---EQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFK 129
           +   + +   HK++A  +G       Q  +++  + A+ A  D  +    TL +G+  F+
Sbjct: 99  DAFHIPVY-VHKEEADWLGDATVNGSQIFMMNRSITAKPA--DHIIDAEGTLTIGSFNFE 155

Query: 130 VFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDE 189
           +F  PGHSPG + Y + E N    GD LF+ SIGRTD+  G + +LI SI  K+  L DE
Sbjct: 156 IFETPGHSPGSISYYSKEANAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKLFVLPDE 215

Query: 190 ISFVCGHGPNSTIGRERRLNPFLK 213
            + +CGHGP ++IG E+  NPFL+
Sbjct: 216 TAVLCGHGPETSIGFEKENNPFLQ 239


>gi|229071764|ref|ZP_04204979.1| Metallo-beta-lactamase [Bacillus cereus F65185]
 gi|228711359|gb|EEL63319.1| Metallo-beta-lactamase [Bacillus cereus F65185]
          Length = 209

 Score =  125 bits (314), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 67/204 (32%), Positives = 111/204 (54%), Gaps = 7/204 (3%)

Query: 13  PFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLK 72
           P + N   L +++  E ++ DPG + + +   +Q        + +TH H DH+G    ++
Sbjct: 10  PLQTNAYILMNDQK-ECIIFDPGHEGEKLVTYLQEEQLKPLAVLLTHAHFDHIGAVDAVR 68

Query: 73  EDLSLTIIGPHKDDAAMMGKVD---EQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFK 129
           +   + +   HK++A  +G       Q  +++  + A+ A  D  +    TL +G+  F+
Sbjct: 69  DTFHIPVY-VHKEEADWLGDATVNGSQIFMMNRSITAKPA--DHIIDAEGTLTIGSFNFE 125

Query: 130 VFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDE 189
           +F  PGHSPG + Y + E N    GD LF+ SIGRTD+  G + +LI SI  K+  L DE
Sbjct: 126 IFETPGHSPGSISYYSKEANAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKLFVLPDE 185

Query: 190 ISFVCGHGPNSTIGRERRLNPFLK 213
            + +CGHGP ++IG E+  NPFL+
Sbjct: 186 TAVLCGHGPETSIGFEKENNPFLQ 209


>gi|323490434|ref|ZP_08095644.1| hypothetical protein GPDM_13791 [Planococcus donghaensis MPA1U2]
 gi|323395898|gb|EGA88734.1| hypothetical protein GPDM_13791 [Planococcus donghaensis MPA1U2]
          Length = 214

 Score =  125 bits (314), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 69/206 (33%), Positives = 112/206 (54%), Gaps = 3/206 (1%)

Query: 9   VQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGA 68
           +++ P + NC  + D++    ++ DPG +   I+ V++ +N     I +TH H DH+G  
Sbjct: 7   LELGPIQTNCYIISDDQK-NCLIFDPGEESTKIEAVVKKKNLKPLAILLTHAHFDHIGAV 65

Query: 69  AQLKEDLSLTIIGPH-KDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
             ++E  S+ +   H + D      ++   +  S+  + R   +D  L D  TL +G+  
Sbjct: 66  DDIRERYSVPVYLHHLEKDWLSRPNLNGSGKYPSLP-DYRMKDADVLLTDEKTLEIGSFK 124

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
             +FH PGHSPG V +   +  FA +GD +FR SIGRTD++ G  ++L+ SI   ILPL 
Sbjct: 125 MDIFHTPGHSPGSVSFSFGKEGFAIVGDVIFRGSIGRTDLIDGSEKRLLQSIEESILPLP 184

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLK 213
           + +    GHGP +T  +E   NPFLK
Sbjct: 185 EHMILYPGHGPETTPEQELNSNPFLK 210


>gi|229180539|ref|ZP_04307881.1| Metallo-beta-lactamase [Bacillus cereus 172560W]
 gi|228602963|gb|EEK60442.1| Metallo-beta-lactamase [Bacillus cereus 172560W]
          Length = 239

 Score =  125 bits (314), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 67/204 (32%), Positives = 110/204 (53%), Gaps = 7/204 (3%)

Query: 13  PFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLK 72
           P + N   L  ++  E ++ DPG + + +   +Q        + +TH H DH+G    ++
Sbjct: 40  PLQTNAYILMSDQK-ECIIFDPGHEGEKLVTYLQEEQLKPLAVLLTHAHFDHIGAVDAVR 98

Query: 73  EDLSLTIIGPHKDDAAMMGKVD---EQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFK 129
           +   + +   HK++A  +G       Q  +++  + A+ A  D  +    TL +G+  F+
Sbjct: 99  DTFHIPVY-VHKEEADWLGDATVNGSQIFMMNRSITAKPA--DHIIDAEGTLTIGSFNFE 155

Query: 130 VFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDE 189
           +F  PGHSPG + Y + E N    GD LF+ SIGRTD+  G + +LI SI  K+  L DE
Sbjct: 156 IFETPGHSPGSISYYSKEANAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKLFVLPDE 215

Query: 190 ISFVCGHGPNSTIGRERRLNPFLK 213
            + +CGHGP ++IG E+  NPFL+
Sbjct: 216 TAVLCGHGPETSIGFEKENNPFLQ 239


>gi|118579159|ref|YP_900409.1| beta-lactamase domain-containing protein [Pelobacter propionicus
           DSM 2379]
 gi|118501869|gb|ABK98351.1| beta-lactamase domain protein [Pelobacter propionicus DSM 2379]
          Length = 210

 Score =  125 bits (314), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 74/206 (35%), Positives = 104/206 (50%), Gaps = 4/206 (1%)

Query: 9   VQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG- 67
           + V P + N   L  E S E VV+D GGD+D +   I      ++ +  THGH DHVGG 
Sbjct: 6   IPVGPLQVNGYILGCERSREGVVIDAGGDVDRLLARITKLELSIRYLLDTHGHFDHVGGN 65

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
            A LK   +  +I  H+ DA ++    +  R   + +   +   D++L DG T+  G   
Sbjct: 66  RAFLKATGAKFLI--HERDAFLLSMAADAGRSFGV-LTENSPQPDQYLTDGMTISFGDQR 122

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
            KV H PGHSPG   + +        GDTLF  S+GRTD+  G  + L  SI  ++  L 
Sbjct: 123 LKVIHTPGHSPGGCCFYSMSTGVLFTGDTLFNGSVGRTDLPGGSMEVLTRSIRERLAVLP 182

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLK 213
           +      GHGP+STI  E   NPFL+
Sbjct: 183 ESTKLYPGHGPSSTIAIELFSNPFLR 208


>gi|218233520|ref|YP_002369066.1| metallo-beta-lactamase family protein [Bacillus cereus B4264]
 gi|218161477|gb|ACK61469.1| metallo-beta-lactamase family protein [Bacillus cereus B4264]
          Length = 209

 Score =  125 bits (313), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 67/204 (32%), Positives = 111/204 (54%), Gaps = 7/204 (3%)

Query: 13  PFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLK 72
           P + N   L +++  E ++ DPG + + +   +Q        + +TH H DH+G    ++
Sbjct: 10  PLQTNAYILMNDQK-ECIIFDPGHEGEKLVTYLQEEQLKPLAVLLTHAHFDHIGAVDAVR 68

Query: 73  EDLSLTIIGPHKDDAAMMGKVD---EQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFK 129
           +   + +   HK++A  +G       Q  +++  + A+ A  D  +    TL +G+  F+
Sbjct: 69  DAFHIPVY-VHKEEADWLGDATVNGSQIFMMNRSITAKPA--DHIIDAEGTLTIGSFNFE 125

Query: 130 VFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDE 189
           +F  PGHSPG + Y + E N    GD LF+ SIGRTD+  G + +LI SI  K+  L DE
Sbjct: 126 IFETPGHSPGSISYYSKEANAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKLFVLPDE 185

Query: 190 ISFVCGHGPNSTIGRERRLNPFLK 213
            + +CGHGP ++IG E+  NPFL+
Sbjct: 186 TAVLCGHGPETSIGFEKENNPFLQ 209


>gi|225851042|ref|YP_002731276.1| beta-lactamase domain protein [Persephonella marina EX-H1]
 gi|225645672|gb|ACO03858.1| beta-lactamase domain protein [Persephonella marina EX-H1]
          Length = 212

 Score =  125 bits (313), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 72/207 (34%), Positives = 111/207 (53%), Gaps = 9/207 (4%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLD-IIKDVIQSRNFHVKQIWITHGHVDHVG 66
           ++ V P ++N   L D    +AVV+DPG + + I+K++   + +    I  THGH+DHVG
Sbjct: 4   VLTVGPLEENTVILIDRSGKKAVVIDPGAEGERILKEL---KPYETVAILATHGHLDHVG 60

Query: 67  GAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRW-LQDGDTLLLGT 125
               LKE L+       KD   +   +       S  + A       + L++GD +  G 
Sbjct: 61  QVGFLKEKLNAPFYMNRKDSFLISNDIFPG---FSQMIGAYPCPEPDFDLREGDIINFGE 117

Query: 126 HIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILP 185
              +V   PGH+PG V + N E  +   GDT+F+ S+GRTD+  GD Q L+ S+  KI+ 
Sbjct: 118 SSLEVIETPGHTPGGVCFYNREEGYLVAGDTIFKGSVGRTDLPGGDPQTLMRSL-QKIIS 176

Query: 186 LGDEISFVCGHGPNSTIGRERRLNPFL 212
           L D    +CGHGP +T+G E+R NP++
Sbjct: 177 LPDNTVIICGHGPETTVGEEKRSNPYI 203


>gi|304383180|ref|ZP_07365653.1| metallo-beta-lactamase [Prevotella marshii DSM 16973]
 gi|304335651|gb|EFM01908.1| metallo-beta-lactamase [Prevotella marshii DSM 16973]
          Length = 214

 Score =  125 bits (313), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 76/205 (37%), Positives = 106/205 (51%), Gaps = 8/205 (3%)

Query: 13  PFKQNCTFLFDEESLEAVVVDPGG----DLDIIKDVIQSRNFHVKQIWITHGHVDHVGGA 68
           P ++NC ++  +E+ E VV+D G     +   +   I         +  TH H+DH  G 
Sbjct: 11  PLQENC-YVVADETRECVVIDCGAFYPEERQAVVQYINDSGLKPVHLLCTHAHIDHNFGN 69

Query: 69  AQLKEDLSLTIIGPHKDDAAMMGKVDEQAR-LLSIRMNARNASSDRWLQDGDTLLLGTHI 127
             L E   L     HK D  +M K+  QA  LL IR++       R LQ+ D +  GTH+
Sbjct: 70  NTLYETFCLQP-EVHKADLPLMEKLPMQAEALLGIRLDYEMPPVGRALQETDVVRFGTHV 128

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
           F + H PGH+PG V +   E   A  GDTLF+ SIGRTD   G   Q+INS+   I  L 
Sbjct: 129 FSIIHTPGHTPGGVFFYCKEEKVAFSGDTLFKGSIGRTDFEGGSMFQIINSL-RYIAQLP 187

Query: 188 DEISFVCGHGPNSTIGRERRLNPFL 212
           D+ + + GHG  +TIG E R NP++
Sbjct: 188 DDTTVLSGHGERTTIGDELRTNPYM 212


>gi|311748070|ref|ZP_07721855.1| metallo-beta-lactamase family protein [Algoriphagus sp. PR1]
 gi|126574714|gb|EAZ79095.1| metallo-beta-lactamase family protein [Algoriphagus sp. PR1]
          Length = 236

 Score =  125 bits (313), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 75/216 (34%), Positives = 118/216 (54%), Gaps = 9/216 (4%)

Query: 6   FHIVQVT--PFKQNCTFLFDEESLEAVVVDPGG----DLDIIKDVIQSRNFHVKQIWITH 59
            HI   T  PF++N   L+D+ S EA +VDPG     +   +K+ IQ     VKQ+  TH
Sbjct: 21  LHIATFTFNPFQENTYLLYDD-SGEAALVDPGCYEAHEKKELKEFIQENKLQVKQLLNTH 79

Query: 60  GHVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGD 119
            H+DHV G A    +  + ++  H+DD  ++  V+  A          +  S  +L++G+
Sbjct: 80  CHIDHVLGNAWAMREFGIPLL-IHQDDLPVLKSVESYASNYGFPAYEGSEPSG-FLEEGE 137

Query: 120 TLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSI 179
            + +G    KV   PGH+PGHV++ + ++     GDTLFR SIGRTD+  G+++ L+  I
Sbjct: 138 FISVGKEKLKVLFVPGHAPGHVVFYHSDSKQLIAGDTLFRGSIGRTDLPGGNHELLLQKI 197

Query: 180 NNKILPLGDEISFVCGHGPNSTIGRERRLNPFLKSN 215
            +++  L D+     GHGP + IG E+  NPF+  N
Sbjct: 198 KSELFNLPDQTVVFPGHGPETNIGFEKVHNPFVGQN 233


>gi|124006335|ref|ZP_01691169.1| metallo-beta-lactamase family protein [Microscilla marina ATCC
           23134]
 gi|123987992|gb|EAY27663.1| metallo-beta-lactamase family protein [Microscilla marina ATCC
           23134]
          Length = 217

 Score =  125 bits (313), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 65/204 (31%), Positives = 113/204 (55%), Gaps = 7/204 (3%)

Query: 13  PFKQNCTFLFDEESLEAVVVDPG----GDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGA 68
           PF++N TF+  +E+ EAV++DPG     +  ++ D I+     V ++  TH H+DHV G 
Sbjct: 11  PFQEN-TFVLYDETKEAVIIDPGCNSSSEHKVLTDFIEQNELKVVKLLNTHCHIDHVFGN 69

Query: 69  AQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIF 128
             +K+   + +   H+ D   +      + +  I+     ++ D ++ + DT+  G    
Sbjct: 70  QFIKDKYKVQL-HMHQLDVPTLQAAKTASDIYQIKPFIE-STPDVFVSEEDTIEFGNSSL 127

Query: 129 KVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGD 188
           ++   PGH+PGH+ ++N    F   GD LF+ S+GRTD     ++ L+NSI  K+  L D
Sbjct: 128 EILFVPGHAPGHIAFLNRAQKFVINGDVLFKGSVGRTDFPGCSHEDLVNSIRTKMYALDD 187

Query: 189 EISFVCGHGPNSTIGRERRLNPFL 212
           +++   GHGP +TIG E++ NPF+
Sbjct: 188 DVTVYTGHGPETTIGYEKQFNPFV 211


>gi|313675839|ref|YP_004053835.1| metallo-beta-lactamase family protein [Marivirga tractuosa DSM
           4126]
 gi|312942537|gb|ADR21727.1| metallo-beta-lactamase family protein [Marivirga tractuosa DSM
           4126]
          Length = 214

 Score =  125 bits (313), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 70/203 (34%), Positives = 115/203 (56%), Gaps = 7/203 (3%)

Query: 13  PFKQNCTFLFDEESLEAVVVDPGG----DLDIIKDVIQSRNFHVKQIWITHGHVDHVGGA 68
           PF +N   ++D+ S  A ++DPG     + D + + I++   +V+Q+  TH H+DHV G 
Sbjct: 11  PFMENTYVVYDD-SKNAAIIDPGCYEGYEQDELVNFIKTEGLNVQQLINTHCHIDHVLGN 69

Query: 69  AQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIF 128
           A +K+   + +   H+ D  ++  V   +       N + +  D +L++GD   +G   F
Sbjct: 70  AFVKDKFGVDLYM-HEKDLPILEAVPTYSAAYGFA-NYQPSQPDHFLKEGDIHKIGNIEF 127

Query: 129 KVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGD 188
           +V   PGH+PGH+ ++N +      GD LF  SIGRTD+  GD+  LI+SI NK+    D
Sbjct: 128 EVLFLPGHAPGHIGFMNEKEKVFIGGDVLFDGSIGRTDLPGGDHDTLISSIQNKLFKYHD 187

Query: 189 EISFVCGHGPNSTIGRERRLNPF 211
           ++   CGHGP +T+G+E+  NPF
Sbjct: 188 DVKVYCGHGPETTLGKEKVSNPF 210


>gi|300856532|ref|YP_003781516.1| putative Zn-dependent hydrolase [Clostridium ljungdahlii DSM 13528]
 gi|300436647|gb|ADK16414.1| putative Zn-dependent hydrolase [Clostridium ljungdahlii DSM 13528]
          Length = 199

 Score =  124 bits (312), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 70/210 (33%), Positives = 107/210 (50%), Gaps = 12/210 (5%)

Query: 3   KLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHV 62
           KL+  IV V  +  NC  L DE+  ++VV+DPG D+  I D I +    V+ I +THGH 
Sbjct: 2   KLTKVIVGV--YAANCYILADEKEGKSVVIDPGDDVKDIIDAIDASKTKVEYILLTHGHA 59

Query: 63  DHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLL 122
           DH   A +++   +  I    +D   M  +     +L+           D +++D     
Sbjct: 60  DHTSAAEEIRNKYNAPIAISREDYNMMKSRELMYGKLID--------EVDIYIEDNQVFE 111

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
            G    K  + PGH+PG V ++    N    GDTLF+ S+GRTD   GD+  ++ SI N+
Sbjct: 112 FGNIKLKALYTPGHTPGGVSFLG--ENMVFTGDTLFKRSVGRTDFTGGDFNAIMGSIKNR 169

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           ++ L DE+    GHG  ++I  E+  NPFL
Sbjct: 170 LMTLPDEMVVFPGHGSKTSIKEEKMYNPFL 199


>gi|229146847|ref|ZP_04275212.1| Metallo-beta-lactamase [Bacillus cereus BDRD-ST24]
 gi|228636675|gb|EEK93140.1| Metallo-beta-lactamase [Bacillus cereus BDRD-ST24]
          Length = 239

 Score =  124 bits (311), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 67/204 (32%), Positives = 110/204 (53%), Gaps = 7/204 (3%)

Query: 13  PFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLK 72
           P + N   L +++  E ++ DPG + + +   +Q        + +TH H DH+G    ++
Sbjct: 40  PLQTNAYILMNDQK-ECIIFDPGHEGEKLVTYLQEEQLKPLAVLLTHAHFDHIGAVDAVR 98

Query: 73  EDLSLTIIGPHKDDAAMMGKVD---EQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFK 129
           +   + +   HK++A  +G       Q  +++  + A+ A  D  +    TL +G   F+
Sbjct: 99  DAFHIPVY-VHKEEADWLGDATVNGSQIFMMNRSITAKPA--DHIIDAEGTLTIGLFNFE 155

Query: 130 VFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDE 189
           +F  PGHSPG + Y + E N    GD LF+ SIGRTD+  G + +LI SI  K+  L DE
Sbjct: 156 IFETPGHSPGSISYYSKEANAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKLFVLPDE 215

Query: 190 ISFVCGHGPNSTIGRERRLNPFLK 213
            + +CGHGP ++IG E+  NPFL+
Sbjct: 216 TAVLCGHGPETSIGFEKENNPFLQ 239


>gi|228980949|ref|ZP_04141252.1| Metallo-beta-lactamase [Bacillus thuringiensis Bt407]
 gi|228778740|gb|EEM27004.1| Metallo-beta-lactamase [Bacillus thuringiensis Bt407]
          Length = 239

 Score =  124 bits (311), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 66/204 (32%), Positives = 111/204 (54%), Gaps = 7/204 (3%)

Query: 13  PFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLK 72
           P + N   L +++  E ++ DPG + + +   +Q        + +TH H DH+G    ++
Sbjct: 40  PLQTNAYILMNDQK-ECIIFDPGHEGEKLVTYLQEEQLKPLAVLLTHAHFDHIGAVDAVR 98

Query: 73  EDLSLTIIGPHKDDAAMMGKVD---EQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFK 129
           +   + +   HK++A  +G       Q  +++  + A+ A  D  +    TL +G+  F+
Sbjct: 99  DAFHIPVY-VHKEEADWLGDATVNGSQIFMMNRSITAKPA--DHIIDAEGTLTIGSFNFE 155

Query: 130 VFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDE 189
           +F  PGHSPG + Y + E N    GD LF+ SIGRTD+  G + +LI SI  K+  L DE
Sbjct: 156 IFETPGHSPGSISYYSKEANAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKLFVLPDE 215

Query: 190 ISFVCGHGPNSTIGRERRLNPFLK 213
            + +CGHGP ++IG E+  NPF++
Sbjct: 216 TAVLCGHGPETSIGFEKENNPFVQ 239


>gi|296504758|ref|YP_003666458.1| hydroxyacylglutathione hydrolase [Bacillus thuringiensis BMB171]
 gi|296325810|gb|ADH08738.1| hydroxyacylglutathione hydrolase [Bacillus thuringiensis BMB171]
          Length = 209

 Score =  124 bits (311), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 67/204 (32%), Positives = 110/204 (53%), Gaps = 7/204 (3%)

Query: 13  PFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLK 72
           P + N   L +++  E ++ DPG + + +   +Q        + +TH H DH+G    ++
Sbjct: 10  PLQTNAYILMNDQK-ECIIFDPGHEGEKLVTYLQEEQLKPLAVLLTHAHFDHIGAVDAVR 68

Query: 73  EDLSLTIIGPHKDDAAMMGKVD---EQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFK 129
           +   + +   HK++A  +G       Q  +++  + A+ A  D  +    TL +G   F+
Sbjct: 69  DAFHIPVY-VHKEEADWLGDATVNGSQIFMMNRSITAKPA--DHIIDAEGTLTIGLFNFE 125

Query: 130 VFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDE 189
           +F  PGHSPG + Y + E N    GD LF+ SIGRTD+  G + +LI SI  K+  L DE
Sbjct: 126 IFETPGHSPGSISYYSKEANAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKLFVLPDE 185

Query: 190 ISFVCGHGPNSTIGRERRLNPFLK 213
            + +CGHGP ++IG E+  NPFL+
Sbjct: 186 TAVLCGHGPETSIGFEKENNPFLQ 209


>gi|107100289|ref|ZP_01364207.1| hypothetical protein PaerPA_01001314 [Pseudomonas aeruginosa PACS2]
          Length = 197

 Score =  124 bits (311), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 69/197 (35%), Positives = 105/197 (53%), Gaps = 4/197 (2%)

Query: 17  NCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLKEDLS 76
           NCT + D  + +A+VVDPGGD ++I   +      V  I  TH H+DH   + ++K+   
Sbjct: 4   NCTIIGDPLTRKAIVVDPGGDHEMILQRLDRLGLQVVSIIHTHAHLDHFLASGEMKKRTG 63

Query: 77  LTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFKVFHCPGH 136
            ++   HKDD  +   ++ Q +L  +      A  DRWL D + L  G  +    H PGH
Sbjct: 64  ASL-HLHKDDQFLWDNLEMQCQLFGVPYTPVPAP-DRWLADDEELACGCGV--ALHTPGH 119

Query: 137 SPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEISFVCGH 196
           +PG + +          GDTLFR  IGRTD+  GD   +  SI  ++  L ++ + V GH
Sbjct: 120 TPGSMSFWFPRAKLLIAGDTLFRRGIGRTDLWGGDSAAIQRSIRQRLYSLDEDATVVAGH 179

Query: 197 GPNSTIGRERRLNPFLK 213
           GP++T+G E R NPF++
Sbjct: 180 GPDTTLGEEMRENPFVR 196


>gi|228941425|ref|ZP_04103976.1| Metallo-beta-lactamase [Bacillus thuringiensis serovar berliner
           ATCC 10792]
 gi|228974356|ref|ZP_04134925.1| Metallo-beta-lactamase [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228785406|gb|EEM33416.1| Metallo-beta-lactamase [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228818206|gb|EEM64280.1| Metallo-beta-lactamase [Bacillus thuringiensis serovar berliner
           ATCC 10792]
 gi|326942043|gb|AEA17939.1| hydroxyacylglutathione hydrolase [Bacillus thuringiensis serovar
           chinensis CT-43]
          Length = 209

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 66/204 (32%), Positives = 111/204 (54%), Gaps = 7/204 (3%)

Query: 13  PFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLK 72
           P + N   L +++  E ++ DPG + + +   +Q        + +TH H DH+G    ++
Sbjct: 10  PLQTNAYILMNDQK-ECIIFDPGHEGEKLVTYLQEEQLKPLAVLLTHAHFDHIGAVDAVR 68

Query: 73  EDLSLTIIGPHKDDAAMMGKVD---EQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFK 129
           +   + +   HK++A  +G       Q  +++  + A+ A  D  +    TL +G+  F+
Sbjct: 69  DAFHIPVY-VHKEEADWLGDATVNGSQIFMMNRSITAKPA--DHIIDAEGTLTIGSFNFE 125

Query: 130 VFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDE 189
           +F  PGHSPG + Y + E N    GD LF+ SIGRTD+  G + +LI SI  K+  L DE
Sbjct: 126 IFETPGHSPGSISYYSKEANAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKLFVLPDE 185

Query: 190 ISFVCGHGPNSTIGRERRLNPFLK 213
            + +CGHGP ++IG E+  NPF++
Sbjct: 186 TAVLCGHGPETSIGFEKENNPFVQ 209


>gi|78045201|ref|YP_361034.1| metallo-beta-lactamase family protein [Carboxydothermus
           hydrogenoformans Z-2901]
 gi|77997316|gb|ABB16215.1| metallo-beta-lactamase family protein [Carboxydothermus
           hydrogenoformans Z-2901]
          Length = 207

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 72/211 (34%), Positives = 110/211 (52%), Gaps = 6/211 (2%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +    + V     NC   + E++ EAV +DPGGD D I   I      +K I +THGH D
Sbjct: 1   MQIKTLTVGVIAANCHIAWCEKTGEAVAIDPGGDGDKILRFIDQNGLKLKYIVLTHGHGD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNA-RNASSDRWLQDGDTLL 122
           H+    +++      ++  H  DA M+  +D    L      A + A +D+ + DGD ++
Sbjct: 61  HIAAVDEVRNKTGAKVL-IHPKDAPML--LDPSKNLSGFLGGAVKLAPADQEVVDGDEII 117

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
            G    KV H PGH+ G +   + +  F+  GDTLF  S+GR D   G +++L+ SI  K
Sbjct: 118 FGGEKLKVLHTPGHTLGSICLYSCDVLFS--GDTLFFGSVGRVDFPGGSWEKLLKSIREK 175

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           I  L ++   + GHGP +T+G E+  NPFLK
Sbjct: 176 IFTLPEDTRVLPGHGPETTVGYEKEHNPFLK 206


>gi|229025725|ref|ZP_04182129.1| Metallo-beta-lactamase [Bacillus cereus AH1272]
 gi|228735600|gb|EEL86191.1| Metallo-beta-lactamase [Bacillus cereus AH1272]
          Length = 239

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 67/204 (32%), Positives = 111/204 (54%), Gaps = 7/204 (3%)

Query: 13  PFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLK 72
           P + N   L + ++ E ++ DPG + + +   +Q        + +TH H DH+G    ++
Sbjct: 40  PLQTNAYILTNNQN-ECIIFDPGHEGEKLVTYLQEAQLKPLAVLLTHAHFDHIGAVDAVR 98

Query: 73  EDLSLTIIGPHKDDAAMMGKVD---EQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFK 129
           +   + +   HK++A  +G       Q  +++  + A+ A  D+ +    TL +G+  F+
Sbjct: 99  DAFRIPVY-VHKEEADWLGDATVNGSQIFMMNRSITAKPA--DQIIDAEGTLTIGSFNFE 155

Query: 130 VFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDE 189
           +F  PGHSPG + Y   E N    GD LF+ SIGRTD+  G + +LI SI  K+  L DE
Sbjct: 156 IFETPGHSPGSISYYCKEANAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKLFVLPDE 215

Query: 190 ISFVCGHGPNSTIGRERRLNPFLK 213
            + +CGHGP ++IG E+  NPFL+
Sbjct: 216 TAVLCGHGPETSIGFEKENNPFLQ 239


>gi|229019482|ref|ZP_04176303.1| Metallo-beta-lactamase [Bacillus cereus AH1273]
 gi|228741837|gb|EEL92016.1| Metallo-beta-lactamase [Bacillus cereus AH1273]
          Length = 221

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 67/204 (32%), Positives = 111/204 (54%), Gaps = 7/204 (3%)

Query: 13  PFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLK 72
           P + N   L + ++ E ++ DPG + + +   +Q        + +TH H DH+G    ++
Sbjct: 22  PLQTNAYILTNNQN-ECIIFDPGHEGEKLVTYLQEAQLKPLAVLLTHAHFDHIGAVDAVR 80

Query: 73  EDLSLTIIGPHKDDAAMMGKVD---EQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFK 129
           +   + +   HK++A  +G       Q  +++  + A+ A  D+ +    TL +G+  F+
Sbjct: 81  DAFRIPVY-VHKEEADWLGDATVNGSQIFMMNRSITAKPA--DQIIDAEGTLTIGSFNFE 137

Query: 130 VFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDE 189
           +F  PGHSPG + Y   E N    GD LF+ SIGRTD+  G + +LI SI  K+  L DE
Sbjct: 138 IFETPGHSPGSISYYCKEANAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKLFVLPDE 197

Query: 190 ISFVCGHGPNSTIGRERRLNPFLK 213
            + +CGHGP ++IG E+  NPFL+
Sbjct: 198 TAVLCGHGPETSIGFEKENNPFLQ 221


>gi|163942020|ref|YP_001646904.1| beta-lactamase domain-containing protein [Bacillus
           weihenstephanensis KBAB4]
 gi|229135085|ref|ZP_04263888.1| Metallo-beta-lactamase [Bacillus cereus BDRD-ST196]
 gi|163864217|gb|ABY45276.1| beta-lactamase domain protein [Bacillus weihenstephanensis KBAB4]
 gi|228648373|gb|EEL04405.1| Metallo-beta-lactamase [Bacillus cereus BDRD-ST196]
          Length = 209

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 66/204 (32%), Positives = 112/204 (54%), Gaps = 7/204 (3%)

Query: 13  PFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLK 72
           P + N   L ++++ E ++ DPG + + +   +Q        + +TH H DH+G    ++
Sbjct: 10  PLQTNAYILTNDQN-ECIIFDPGHEGEKLVTYLQEAQLKPLAVLLTHAHFDHIGAVDAVR 68

Query: 73  EDLSLTIIGPHKDDAAMMGKVD---EQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFK 129
           +   + +   HK++A  +G       Q  +++  + A+ A  D  + +  TL + +  F+
Sbjct: 69  DAFHIPVY-VHKEEANWLGDATVNGSQIFMMNRSITAKPA--DHIIDEEGTLTISSFSFE 125

Query: 130 VFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDE 189
           +F  PGHSPG + Y + E N    GD LF+ SIGRTD+  G + +LI SI  K+  L DE
Sbjct: 126 IFETPGHSPGSISYYSKEANAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKLFVLPDE 185

Query: 190 ISFVCGHGPNSTIGRERRLNPFLK 213
            + +CGHGP ++IG E+  NPFL+
Sbjct: 186 TAVLCGHGPETSIGFEKENNPFLQ 209


>gi|153806709|ref|ZP_01959377.1| hypothetical protein BACCAC_00980 [Bacteroides caccae ATCC 43185]
 gi|149131386|gb|EDM22592.1| hypothetical protein BACCAC_00980 [Bacteroides caccae ATCC 43185]
          Length = 212

 Score =  123 bits (309), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 67/204 (32%), Positives = 111/204 (54%), Gaps = 6/204 (2%)

Query: 14  FKQNCTFLFDEESLEAVVVDPGG----DLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAA 69
           F  NC  L+D+ + EAVV+DPG     +   +K  I +   +VK +  TH H+DH+ G  
Sbjct: 11  FPVNCYVLWDD-TKEAVVIDPGCFYEEEKQALKKFILTNELNVKHLLNTHLHLDHIFGNP 69

Query: 70  QLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFK 129
            + ++  L+    +K D   + +  +Q+R+   ++  +     ++L DGD++  G    +
Sbjct: 70  FMLKEFGLSAEA-NKADEYWIDEAPKQSRMFGFQLQEKPVPLGKYLHDGDSITFGHTTLE 128

Query: 130 VFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDE 189
             H PGHSPG ++Y   E+N    GD LF+ SIGR D+  G++ +LI  I +++  L +E
Sbjct: 129 AIHVPGHSPGSLVYYCKEDNCMFSGDVLFQGSIGRADLTGGNFDELIEHICSRLFVLPNE 188

Query: 190 ISFVCGHGPNSTIGRERRLNPFLK 213
                GHG  +TIG E+  NPF +
Sbjct: 189 TVVYPGHGAPTTIGMEKAENPFFR 212


>gi|38233947|ref|NP_939714.1| hypothetical protein DIP1361 [Corynebacterium diphtheriae NCTC
           13129]
 gi|38200208|emb|CAE49889.1| Conserved hypothetical protein [Corynebacterium diphtheriae]
          Length = 218

 Score =  123 bits (309), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 82/222 (36%), Positives = 119/222 (53%), Gaps = 17/222 (7%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEES---LEAVVVDPG-GDLDIIKDVIQSRNFHVKQIW 56
           M  LSF      P++ NC  +  EES     A V+DPG    ++I    +     V Q+ 
Sbjct: 4   MEILSF---PAGPYQTNCYVVLSEESEGRRYASVIDPGLRAKELIDQYCEENRVEVVQVL 60

Query: 57  ITHGHVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGK---VDEQARLL--SIRMNARNASS 111
           +THGH+DH   AA L     + +   H+ D   + K   + E +RLL  +  MN  ++ S
Sbjct: 61  LTHGHIDHCRDAAALANGWGVAL-QIHRYDEFFLDKGNGMSEDSRLLFHADAMNLPDSVS 119

Query: 112 DRWLQDGDTLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGD 171
             +L DGD + LG   F V H PGHSPG V++V    +F   GD LF+ SIGRTD+ H D
Sbjct: 120 --YLGDGDEVELGGQRFVVRHAPGHSPGCVLFVG--KDFCFSGDVLFKGSIGRTDLAHSD 175

Query: 172 YQQLINSINNKILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
              + NSI + +L L D ++ + GHGP +T+  E+  NP+L+
Sbjct: 176 PHAMSNSIKSVVLGLEDSLTILPGHGPATTMRAEKASNPYLR 217


>gi|229075966|ref|ZP_04208942.1| Metallo-beta-lactamase [Bacillus cereus Rock4-18]
 gi|229104891|ref|ZP_04235550.1| Metallo-beta-lactamase [Bacillus cereus Rock3-28]
 gi|229117758|ref|ZP_04247127.1| Metallo-beta-lactamase [Bacillus cereus Rock1-3]
 gi|228665735|gb|EEL21208.1| Metallo-beta-lactamase [Bacillus cereus Rock1-3]
 gi|228678521|gb|EEL32739.1| Metallo-beta-lactamase [Bacillus cereus Rock3-28]
 gi|228707281|gb|EEL59478.1| Metallo-beta-lactamase [Bacillus cereus Rock4-18]
          Length = 239

 Score =  123 bits (309), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 67/204 (32%), Positives = 112/204 (54%), Gaps = 7/204 (3%)

Query: 13  PFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLK 72
           P + N   L ++++ E ++ DPG + + +   +Q        + +TH H DH+G    ++
Sbjct: 40  PLQTNAYILTNDQN-ECIIFDPGHEGEKLVTYLQEEQLKPLAVLLTHAHFDHIGAVDAVR 98

Query: 73  EDLSLTIIGPHKDDAAMMGKVD---EQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFK 129
           +   + +   HK++A  +G       Q  +++  + A+ A  D  +    TL +G+  F+
Sbjct: 99  DAFHIPVY-VHKEEADWLGDGTVNGSQIFMMNRSITAKPA--DHIIDAEGTLTVGSFNFE 155

Query: 130 VFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDE 189
           +F  PGHSPG + Y + E N    GD LF+ SIGRTD+  G + +LI SI  K+  L DE
Sbjct: 156 IFETPGHSPGSISYYSKEANAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKLFVLPDE 215

Query: 190 ISFVCGHGPNSTIGRERRLNPFLK 213
            + +CGHGP ++IG E+  NPFL+
Sbjct: 216 TAVLCGHGPETSIGFEKENNPFLQ 239


>gi|154495105|ref|ZP_02034110.1| hypothetical protein PARMER_04152 [Parabacteroides merdae ATCC
           43184]
 gi|154085655|gb|EDN84700.1| hypothetical protein PARMER_04152 [Parabacteroides merdae ATCC
           43184]
          Length = 212

 Score =  123 bits (309), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 71/203 (34%), Positives = 112/203 (55%), Gaps = 6/203 (2%)

Query: 14  FKQNCTFLFDEESLEAVVVDPGG----DLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAA 69
           F++N TFL  +++ EAV++D G     +   + D I      +K +  TH HVDHV G  
Sbjct: 12  FQEN-TFLLYDDTREAVLIDCGCCRKEEEKELTDFILENKLTLKHLLCTHLHVDHVFGNG 70

Query: 70  QLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFK 129
            + +   L     +K D   +   DEQA+L  +R +  N   ++++  G+ +  GT   +
Sbjct: 71  FIYKTYGLKPEA-NKQDVEKLPSPDEQAKLFGLRQHVENVPVEKYIVGGEIIKFGTSELQ 129

Query: 130 VFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDE 189
           V   PGHSPG + + N +N FA +GD LF  SIGRTD+  G+ + L+ +I++K+L L DE
Sbjct: 130 VLTVPGHSPGSIAFYNKKNGFAIVGDALFAGSIGRTDLWGGNQEVLVAAIHDKLLSLPDE 189

Query: 190 ISFVCGHGPNSTIGRERRLNPFL 212
                GHGP + +  E+  NP+L
Sbjct: 190 TVIYPGHGPETRVIDEKFNNPYL 212


>gi|42783387|ref|NP_980634.1| metallo-beta-lactamase family protein [Bacillus cereus ATCC 10987]
 gi|206977971|ref|ZP_03238857.1| metallo-beta-lactamase family protein [Bacillus cereus H3081.97]
 gi|217961752|ref|YP_002340322.1| metallo-beta-lactamase family protein [Bacillus cereus AH187]
 gi|222097706|ref|YP_002531763.1| metallo-beta-lactamase family protein [Bacillus cereus Q1]
 gi|42739315|gb|AAS43242.1| metallo-beta-lactamase family protein [Bacillus cereus ATCC 10987]
 gi|206743771|gb|EDZ55192.1| metallo-beta-lactamase family protein [Bacillus cereus H3081.97]
 gi|217067370|gb|ACJ81620.1| metallo-beta-lactamase family protein [Bacillus cereus AH187]
 gi|221241765|gb|ACM14475.1| metallo-beta-lactamase family protein [Bacillus cereus Q1]
 gi|324328167|gb|ADY23427.1| metallo-beta-lactamase family protein [Bacillus thuringiensis
           serovar finitimus YBT-020]
          Length = 209

 Score =  123 bits (309), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 67/204 (32%), Positives = 110/204 (53%), Gaps = 7/204 (3%)

Query: 13  PFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLK 72
           P + N   L +E++ E ++ DPG + + +   +Q        + +TH H DH+G    ++
Sbjct: 10  PLQTNAYILTNEQN-ECIIFDPGHEGEKLVTYLQEEQLKPLAVLLTHAHFDHIGAVDAVR 68

Query: 73  EDLSLTIIGPHKDDAAMMGKVD---EQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFK 129
           +   + +   HK++A  +G       Q  +++  + A+ A  D  +     L +G+  F+
Sbjct: 69  DAFHIPVY-VHKEEADWLGDATVNGSQIFMMNRSITAKPA--DHIIDAEGALAIGSFNFE 125

Query: 130 VFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDE 189
           +F  PGHSPG + Y   E N    GD LF+ SIGRTD+  G + +LI SI  K+  L DE
Sbjct: 126 IFETPGHSPGSISYYCKEANAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKLFVLPDE 185

Query: 190 ISFVCGHGPNSTIGRERRLNPFLK 213
            + +CGHGP ++IG E+  NPFL+
Sbjct: 186 TAVLCGHGPETSIGFEKENNPFLQ 209


>gi|114566346|ref|YP_753500.1| beta-lactamase-like protein [Syntrophomonas wolfei subsp. wolfei
           str. Goettingen]
 gi|114337281|gb|ABI68129.1| beta-lactamase-like protein [Syntrophomonas wolfei subsp. wolfei
           str. Goettingen]
          Length = 207

 Score =  123 bits (309), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 76/207 (36%), Positives = 116/207 (56%), Gaps = 9/207 (4%)

Query: 9   VQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGA 68
           ++++    NC  +  EE+ E  V+DPGG+   I ++++      + I  THGH+DH+G  
Sbjct: 6   LELSSMMVNCYIVGCEETKEVAVIDPGGNARAILNLLEEDGLKTQYIINTHGHIDHIGAN 65

Query: 69  AQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNAS--SDRWLQDGDTLLLGTH 126
             +K+     I+  H++DA M+  V+  +   S  M ++  S  +D+ +Q+GD + +G  
Sbjct: 66  QAIKDATDAKIL-IHENDAKML--VNPVSNF-SFMMGSKVISPPADQLIQEGDIIKIGNT 121

Query: 127 I-FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILP 185
           +  +V H PGHS G V       N   +GDTLF+ SIGRTD   G Y+QLI +I  K+L 
Sbjct: 122 VELEVIHTPGHSQGGVCLK--IGNIIFVGDTLFQGSIGRTDFPGGSYKQLIQNIKEKLLR 179

Query: 186 LGDEISFVCGHGPNSTIGRERRLNPFL 212
             D+     GHGP +TIG ER  NPFL
Sbjct: 180 YDDDTICYPGHGPATTIGFERMHNPFL 206


>gi|110639608|ref|YP_679818.1| metallo-beta-lactamase family protein [Cytophaga hutchinsonii ATCC
           33406]
 gi|110282289|gb|ABG60475.1| metallo-beta-lactamase family protein [Cytophaga hutchinsonii ATCC
           33406]
          Length = 213

 Score =  123 bits (309), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 75/211 (35%), Positives = 112/211 (53%), Gaps = 9/211 (4%)

Query: 7   HIVQVT--PFKQNCTFLFDEESLEAVVVDPGG----DLDIIKDVIQSRNFHVKQIWITHG 60
           HI  +T  P ++N   ++DE   + ++VDPG     +   + D I  +   V+ +  THG
Sbjct: 3   HIETLTFNPLQENTYIVYDEAG-DCMIVDPGCYEAYEQKELTDFIAKKKLTVRLLVNTHG 61

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DHV G   +KE   +     H D AA +  V   A           A+ DR L++GD 
Sbjct: 62  HIDHVLGNYFVKETYKVPFEIFHLD-AATLQAVGAYAPNYGF-FQYTPATPDRLLKEGDA 119

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           +++G+  F +   PGH+PGH+ +VN        GD LFRSSIGR D+  G+Y  LI+SI 
Sbjct: 120 VIVGSMKFDILFVPGHAPGHIAFVNTAEKICLSGDVLFRSSIGRADLPGGNYDTLIHSIK 179

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPF 211
            K+  L D+     GHGP +TI  E++ NP+
Sbjct: 180 TKLFLLPDDTIVYPGHGPTTTIQFEKKHNPY 210


>gi|229098733|ref|ZP_04229673.1| Metallo-beta-lactamase [Bacillus cereus Rock3-29]
 gi|228684812|gb|EEL38750.1| Metallo-beta-lactamase [Bacillus cereus Rock3-29]
          Length = 239

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 64/202 (31%), Positives = 110/202 (54%), Gaps = 3/202 (1%)

Query: 13  PFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLK 72
           P + N   L ++++ E ++ DPG + + +   +Q        + +TH H DH+G    ++
Sbjct: 40  PLQTNAYILTNDQN-ECIIFDPGHEGEKLVTYLQEEQLKPLAVLLTHAHFDHIGAVDAVR 98

Query: 73  EDLSLTIIGPHKDDAAMMGK-VDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFKVF 131
           +   + +   HK++A  +G      +++  +  +     +D  +    TL +G+  F++F
Sbjct: 99  DAFHIPVY-VHKEEADWLGDGTVNGSQIFMMNRSITAKPADHIIDAEGTLTVGSFNFEIF 157

Query: 132 HCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEIS 191
             PGHSPG + Y + E N    GD LF+ SIGRTD+  G + +LI SI  K+  L DE +
Sbjct: 158 ETPGHSPGSISYYSKEANAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKLFVLPDETA 217

Query: 192 FVCGHGPNSTIGRERRLNPFLK 213
            +CGHGP ++IG E+  NPFL+
Sbjct: 218 VLCGHGPETSIGFEKENNPFLQ 239


>gi|229140997|ref|ZP_04269540.1| Metallo-beta-lactamase [Bacillus cereus BDRD-ST26]
 gi|229198389|ref|ZP_04325095.1| Metallo-beta-lactamase [Bacillus cereus m1293]
 gi|228585089|gb|EEK43201.1| Metallo-beta-lactamase [Bacillus cereus m1293]
 gi|228642430|gb|EEK98718.1| Metallo-beta-lactamase [Bacillus cereus BDRD-ST26]
          Length = 239

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 67/204 (32%), Positives = 110/204 (53%), Gaps = 7/204 (3%)

Query: 13  PFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLK 72
           P + N   L +E++ E ++ DPG + + +   +Q        + +TH H DH+G    ++
Sbjct: 40  PLQTNAYILTNEQN-ECIIFDPGHEGEKLVTYLQEEQLKPLAVLLTHAHFDHIGAVDAVR 98

Query: 73  EDLSLTIIGPHKDDAAMMGKVD---EQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFK 129
           +   + +   HK++A  +G       Q  +++  + A+ A  D  +     L +G+  F+
Sbjct: 99  DAFHIPVY-VHKEEADWLGDATVNGSQIFMMNRSITAKPA--DHIIDAEGALAIGSFNFE 155

Query: 130 VFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDE 189
           +F  PGHSPG + Y   E N    GD LF+ SIGRTD+  G + +LI SI  K+  L DE
Sbjct: 156 IFETPGHSPGSISYYCKEANAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKLFVLPDE 215

Query: 190 ISFVCGHGPNSTIGRERRLNPFLK 213
            + +CGHGP ++IG E+  NPFL+
Sbjct: 216 TAVLCGHGPETSIGFEKENNPFLQ 239


>gi|153854671|ref|ZP_01995921.1| hypothetical protein DORLON_01919 [Dorea longicatena DSM 13814]
 gi|149752775|gb|EDM62706.1| hypothetical protein DORLON_01919 [Dorea longicatena DSM 13814]
          Length = 207

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 66/197 (33%), Positives = 105/197 (53%), Gaps = 4/197 (2%)

Query: 17  NCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLKEDLS 76
           NC  + +EE+ + V+VDPG     +K+ ++ +   +K + +TH H DH+ G + + ED+ 
Sbjct: 14  NCYLVINEETKDTVMVDPGAYPAKLKNAVKEQGLKLKAVLLTHAHFDHIMGLSDVMEDIK 73

Query: 77  LTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRW-LQDGDTLLLGTHIFKVFHCPG 135
           + +     D   MM   D ++ L S  M      +D   ++DG  L +    F+V H PG
Sbjct: 74  VPVYVEEADLPMMM---DGESNLSSGYMRGGYQFADAVPVRDGQQLQIAGFQFRVIHTPG 130

Query: 136 HSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEISFVCG 195
           H+PG   Y   + +    GDTLFR+S+GR+D   G    L+ S+  K+L L +E     G
Sbjct: 131 HTPGGCCYYMEQEDVLFSGDTLFRTSVGRSDFPGGSASALVRSVKEKLLILPEETHVYPG 190

Query: 196 HGPNSTIGRERRLNPFL 212
           H   +TIG E+R NPF+
Sbjct: 191 HMEETTIGYEKRHNPFV 207


>gi|289523396|ref|ZP_06440250.1| metallo-beta-lactamase family protein [Anaerobaculum
           hydrogeniformans ATCC BAA-1850]
 gi|289503088|gb|EFD24252.1| metallo-beta-lactamase family protein [Anaerobaculum
           hydrogeniformans ATCC BAA-1850]
          Length = 214

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 75/200 (37%), Positives = 115/200 (57%), Gaps = 12/200 (6%)

Query: 17  NCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLKEDLS 76
           N   ++DE+   A  VDPGGD D +  VI+  +  +K I +THGHVDH+ G   L++   
Sbjct: 14  NGYLVYDEDG-NAFFVDPGGDPDDVIAVIEGNSLELKIILLTHGHVDHIAGVKALQDRYD 72

Query: 77  LTIIGPHKDDAAMMG---KVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFKVFHC 133
              +  H+DD+ M+    K   Q    S++++ R     + L DG+++ +G+ + +V H 
Sbjct: 73  CP-VAVHEDDSGMLANPMKNLSQFAGESVKVDGRV----KPLSDGESINIGSILIRVIHT 127

Query: 134 PGHSPGHVIYVNFENNFAHL--GDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEIS 191
           PGH+PG V Y         L  GDT+F  S+GRTD+  GD+  L +S+  K+  L D++ 
Sbjct: 128 PGHTPGSVCYRASHEGEEVLFSGDTIFALSVGRTDLPGGDFAALESSL-RKLDYLPDDLK 186

Query: 192 FVCGHGPNSTIGRERRLNPF 211
            + GHGP +T+GRERR NPF
Sbjct: 187 VLPGHGPETTLGRERRENPF 206


>gi|291535023|emb|CBL08135.1| Zn-dependent hydrolases, including glyoxylases [Roseburia
           intestinalis M50/1]
          Length = 209

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 75/214 (35%), Positives = 107/214 (50%), Gaps = 7/214 (3%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M+ L      V P + NC F  ++++ E +V+DPG   D +   I+        I +THG
Sbjct: 1   MAPLKVEQYVVGPVQTNCYFAINDDTKEVLVIDPGASADQLAKKIRQEKLTPIAILLTHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNAS-SDRWLQDGD 119
           H DH GGA +L +   + I     +   +    D  +  LS     +    +D +L++  
Sbjct: 61  HFDHAGGAEELAKHFDIKIYAEEHEKETL----DTPSLNLSGWEGVQKTYHADVFLKNEQ 116

Query: 120 TL-LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINS 178
            + L G HI +VFH PGH+ G   Y     N    GDTLF +S+GRTD   G   Q+I S
Sbjct: 117 EIDLAGFHI-RVFHTPGHTVGGCCYYFPYQNVVFSGDTLFCTSVGRTDFPKGSAAQIIRS 175

Query: 179 INNKILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           I  K+LPL DE +   GH   +TIG ER  NP+L
Sbjct: 176 IKEKLLPLPDETTVYTGHNDITTIGAERMYNPYL 209


>gi|304316997|ref|YP_003852142.1| beta-lactamase [Thermoanaerobacterium thermosaccharolyticum DSM
           571]
 gi|302778499|gb|ADL69058.1| beta-lactamase domain protein [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
          Length = 210

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 76/202 (37%), Positives = 110/202 (54%), Gaps = 7/202 (3%)

Query: 13  PFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLK 72
           PF+ NC  L  ++S E V+VDPG     I++ I+  N  +K I +THGH DH+GG    +
Sbjct: 14  PFQSNCYVLSIKDSNECVMVDPGIPAKEIENYIEKNNLSLKYILVTHGHFDHIGGVDFFR 73

Query: 73  EDLSLTIIGPHKDDAAMMGKVDEQARLLSIR-MNARNASSDRWLQDGDTLLLGTHI-FKV 130
           +  +  +     DD+ ++         +S + +  +NA  D  L D DTL L   I   V
Sbjct: 74  DRFNAKVC-ISADDSVLLSDTRLNLSEISFKKIVVKNA--DILLNDDDTLKLNNDITISV 130

Query: 131 FHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEI 190
            H PGH+PG + Y    +     GDTLF+ SIGRTD   G+Y ++I+SI NK+  L D++
Sbjct: 131 IHTPGHTPGGLCYK--VDGVCFSGDTLFKGSIGRTDFPGGNYSEIIDSIKNKLFVLDDDL 188

Query: 191 SFVCGHGPNSTIGRERRLNPFL 212
               GHG  +TI  E+  NPFL
Sbjct: 189 LVYPGHGDITTIKEEKLHNPFL 210


>gi|49480959|ref|YP_038321.1| metallo-beta-lactamase family protein [Bacillus thuringiensis
           serovar konkukian str. 97-27]
 gi|196041608|ref|ZP_03108900.1| metallo-beta-lactamase family protein [Bacillus cereus NVH0597-99]
 gi|49332515|gb|AAT63161.1| metallo-beta-lactamase family protein [Bacillus thuringiensis
           serovar konkukian str. 97-27]
 gi|196027596|gb|EDX66211.1| metallo-beta-lactamase family protein [Bacillus cereus NVH0597-99]
          Length = 209

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 68/204 (33%), Positives = 110/204 (53%), Gaps = 7/204 (3%)

Query: 13  PFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLK 72
           P + N   L ++++ E V+ DPG + + +   +Q        + +TH H DH+G    ++
Sbjct: 10  PLQTNAYILKNDQN-ECVIFDPGHEGEKLVTYLQEEQLKPLAVLLTHAHFDHIGAVDAVR 68

Query: 73  EDLSLTIIGPHKDDAAMMGKVD---EQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFK 129
           E   + +   HK++   +G       Q  +++  + A+ A  D  +    TL +G+  F+
Sbjct: 69  EAFHIPVY-VHKEEEDWLGDATVNGSQIFMMNRSITAKPA--DHIIDAEGTLAIGSFNFE 125

Query: 130 VFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDE 189
           +F  PGHSPG + Y   E N    GD LF+ SIGRTD+  G + +LI SI  K+  L DE
Sbjct: 126 IFETPGHSPGSISYYCKEANAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKLFVLPDE 185

Query: 190 ISFVCGHGPNSTIGRERRLNPFLK 213
            + +CGHGP ++IG E+  NPFL+
Sbjct: 186 TAVLCGHGPETSIGFEKENNPFLQ 209


>gi|313902175|ref|ZP_07835584.1| Putative metal-binding hydrolase [Thermaerobacter subterraneus DSM
           13965]
 gi|313467575|gb|EFR63080.1| Putative metal-binding hydrolase [Thermaerobacter subterraneus DSM
           13965]
          Length = 220

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 73/203 (35%), Positives = 106/203 (52%), Gaps = 7/203 (3%)

Query: 13  PFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLK 72
           P + N   L D+    AV+VD   D D + + +  R + V  + +TH H DH+GG   +K
Sbjct: 14  PVQANGYVLLDDAGKVAVLVDAPHDPDPMLEAV--RGYRVAAVLLTHAHFDHIGGLQAIK 71

Query: 73  EDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFKVFH 132
           E     +   H+++A+ +G  D Q  L           +D  L+ G+ L  G+  F+V  
Sbjct: 72  EATGAPVW-IHRNEASWLG--DPQLNLSVWLEPVVAPPADHLLEGGERLAFGSMEFEVRF 128

Query: 133 CPGHSPGHVIYVN--FENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEI 190
            PGHSPGHV+YV           GDTLF   IGRTD+  GD + L+ SI+ +++ L D  
Sbjct: 129 TPGHSPGHVVYVGRGAAEGLVLAGDTLFAGGIGRTDLPGGDLETLLQSIHRELMVLPDAT 188

Query: 191 SFVCGHGPNSTIGRERRLNPFLK 213
             + GHGP + IG ER  NPFL+
Sbjct: 189 RVLPGHGPETRIGTERVANPFLR 211


>gi|229093330|ref|ZP_04224439.1| Metallo-beta-lactamase [Bacillus cereus Rock3-42]
 gi|228690054|gb|EEL43853.1| Metallo-beta-lactamase [Bacillus cereus Rock3-42]
          Length = 221

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 68/204 (33%), Positives = 110/204 (53%), Gaps = 7/204 (3%)

Query: 13  PFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLK 72
           P + N   L ++++ E V+ DPG + + +   +Q        + +TH H DH+G    ++
Sbjct: 22  PLQTNAYILKNDQN-ECVIFDPGHEGEKLVTYLQEEQLKPLAVLLTHAHFDHIGAVDAVR 80

Query: 73  EDLSLTIIGPHKDDAAMMGKVD---EQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFK 129
           E   + +   HK++   +G       Q  +++  + A+ A  D  +    TL +G+  F+
Sbjct: 81  EAFHIPVY-VHKEEEDWLGDATVNGSQIFMMNRSITAKPA--DHIIDAEGTLAIGSFNFE 137

Query: 130 VFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDE 189
           +F  PGHSPG + Y   E N    GD LF+ SIGRTD+  G + +LI SI  K+  L DE
Sbjct: 138 IFETPGHSPGSISYYCKEANAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKLFVLPDE 197

Query: 190 ISFVCGHGPNSTIGRERRLNPFLK 213
            + +CGHGP ++IG E+  NPFL+
Sbjct: 198 TAVLCGHGPETSIGFEKENNPFLQ 221


>gi|226306421|ref|YP_002766381.1| hypothetical protein RER_29340 [Rhodococcus erythropolis PR4]
 gi|226185538|dbj|BAH33642.1| conserved hypothetical protein [Rhodococcus erythropolis PR4]
          Length = 226

 Score =  122 bits (307), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 77/210 (36%), Positives = 111/210 (52%), Gaps = 12/210 (5%)

Query: 14  FKQNCTFLFDEESLEAVVVDPGGDL-DIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLK 72
           F+ NC  L  +++ E VVVDPG D  + + + + S++  V  + +THGH+DHV  A ++ 
Sbjct: 11  FQTNCYILAQDDACECVVVDPGQDAAEPLFEYLDSKDMSVNAVLLTHGHLDHVWSAREVC 70

Query: 73  EDLSLTIIGPHKDDAAMMGK----VDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIF 128
           E  S+     H DD  M+      +    +     M          L DGD +      F
Sbjct: 71  ERYSVPAY-IHPDDRYMLSDPARGIGPTMKEFIQGMTFVEPDEVIELSDGDKITEAGMTF 129

Query: 129 KVFHCPGHSPGHVIYVNFEN------NFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
            V H PGH+ G V++    N      + A  GDTLF+ SIGR+D+  G+++QL+ SI  K
Sbjct: 130 VVDHTPGHTQGSVVFRTQANTESGPVDLAFTGDTLFQGSIGRSDLPGGNHEQLLASIARK 189

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           +L LGDE   + GHG NS+IG ER  NPFL
Sbjct: 190 LLVLGDETVVLPGHGGNSSIGAERSSNPFL 219


>gi|299142646|ref|ZP_07035776.1| metallo-beta-lactamase family protein [Prevotella oris C735]
 gi|298575861|gb|EFI47737.1| metallo-beta-lactamase family protein [Prevotella oris C735]
          Length = 214

 Score =  122 bits (307), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 110/204 (53%), Gaps = 8/204 (3%)

Query: 14  FKQNCTFLFDEESLEAVVVDPGG----DLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAA 69
            ++NC ++  +E+ E V++D G     DL  IKD IQ        +  THGH+DH  G  
Sbjct: 12  LQENC-YVVSDETDECVIIDCGAFYEEDLAAIKDYIQFEGLKPVHLLATHGHIDHNFGNG 70

Query: 70  QLKEDLSLTIIGPHKDDAAMMGKVDEQA-RLLSIRMNARNASSDRWLQDGDTLLLGTHIF 128
            + ++  L +   H+ D  +M K+ EQA ++  +++     S  ++L   DT+  G+H+F
Sbjct: 71  MIYKEYGLKV-EVHEGDKPLMLKLKEQALQIAGVKLEEDLPSVGKYLTGKDTIAFGSHVF 129

Query: 129 KVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGD 188
            +   PGHS G V + + E + A  GDTLF+ SIGRTD   G   Q+I S+   +  L D
Sbjct: 130 AIIETPGHSHGSVFFYDEEEHVAFTGDTLFQRSIGRTDFEGGSMFQMIQSL-RIVCQLPD 188

Query: 189 EISFVCGHGPNSTIGRERRLNPFL 212
           +     GHGP +TIG E   NP+L
Sbjct: 189 DTRVYPGHGPETTIGAELATNPYL 212


>gi|304408481|ref|ZP_07390124.1| beta-lactamase domain protein [Paenibacillus curdlanolyticus YK9]
 gi|304342540|gb|EFM08391.1| beta-lactamase domain protein [Paenibacillus curdlanolyticus YK9]
          Length = 213

 Score =  122 bits (306), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 70/213 (32%), Positives = 111/213 (52%), Gaps = 5/213 (2%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M+KL+    Q+ P + NC  L DE     +++DPG     + + I   N  ++ I +TH 
Sbjct: 1   MAKLNIQTFQLGPLQTNCYLLTDEAGERGIIIDPGMQPKRLLERIA--NIEIEAIVLTHA 58

Query: 61  HVDHVGGAAQLKEDLSLTI-IGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGD 119
           H DH+GG  ++++     + I   + D     +++   R   +        ++  L +G 
Sbjct: 59  HFDHMGGVDEVRKAKGCPVYIHDLEADWLTNAQLNGSGRWKDVTPPLTTDPAEYALDEGQ 118

Query: 120 TLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSI 179
           TL    H F V H PGHSPG V  +   + F+  GD LFRSS+GRTD+  G  + L +SI
Sbjct: 119 TLSFIGHQFSVMHTPGHSPGSVSLLCGSDLFS--GDVLFRSSVGRTDLPGGRERDLYDSI 176

Query: 180 NNKILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
             K+  L D+++   GHGP +TIG E+  NP++
Sbjct: 177 QLKLFKLADDVTVYSGHGPKTTIGYEKANNPYV 209


>gi|240143889|ref|ZP_04742490.1| metallo-beta-lactamase family protein [Roseburia intestinalis
           L1-82]
 gi|257204081|gb|EEV02366.1| metallo-beta-lactamase family protein [Roseburia intestinalis
           L1-82]
          Length = 209

 Score =  122 bits (306), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 75/214 (35%), Positives = 107/214 (50%), Gaps = 7/214 (3%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M+ L      V P + NC F  ++++ E +V+DPG   D +   I+        I +THG
Sbjct: 1   MAPLKVEQYVVGPVQTNCYFAINDDTKEVLVIDPGASADQLAKKIRQEKLIPIAILLTHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNAS-SDRWLQDGD 119
           H DH GGA +L +   + I     +   +    D  +  LS     +    +D +L++  
Sbjct: 61  HFDHAGGAEELAKHFDIKIYAEEHEKETL----DTPSLNLSGWEGVQKTYHADVFLKNEQ 116

Query: 120 TL-LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINS 178
            + L G HI +VFH PGH+ G   Y     N    GDTLF +S+GRTD   G   Q+I S
Sbjct: 117 EIDLAGFHI-RVFHTPGHTVGGCCYYFPYQNVVFSGDTLFCTSVGRTDFPKGSAAQIIRS 175

Query: 179 INNKILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           I  K+LPL DE +   GH   +TIG ER  NP+L
Sbjct: 176 IKEKLLPLPDETTVYTGHNDITTIGTERMYNPYL 209


>gi|152976694|ref|YP_001376211.1| beta-lactamase domain-containing protein [Bacillus cereus subsp.
           cytotoxis NVH 391-98]
 gi|152025446|gb|ABS23216.1| beta-lactamase domain protein [Bacillus cytotoxicus NVH 391-98]
          Length = 209

 Score =  122 bits (306), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 67/202 (33%), Positives = 105/202 (51%), Gaps = 3/202 (1%)

Query: 13  PFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLK 72
           P + N   L +++  E V+ DPG + + +   +Q        I +TH H DH+G    ++
Sbjct: 10  PLQTNAYILSNDQK-ECVIFDPGSEGEKLVTYLQQEGLKPLAILLTHAHFDHIGAVDAVR 68

Query: 73  EDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGD-TLLLGTHIFKVF 131
           E   + +   HK++A  +G        + +   +  A    +  DG+ TL +G   F++F
Sbjct: 69  EAFRIPVY-VHKEEAEWLGDPAVNGSQIFMMNRSITAKPADYRIDGEGTLTIGPFTFEMF 127

Query: 132 HCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEIS 191
             PGHSPG + Y   E N    GD LF+ SIGRTD+  G   +L+ SI  K+  L D+ +
Sbjct: 128 ETPGHSPGSISYYCKEVNAVFSGDVLFQMSIGRTDLPGGSLTELMGSIEEKLFMLPDDTT 187

Query: 192 FVCGHGPNSTIGRERRLNPFLK 213
            +CGHGP + IG E+  NPFL+
Sbjct: 188 VLCGHGPETNIGFEKENNPFLQ 209


>gi|297584589|ref|YP_003700369.1| beta-lactamase domain-containing protein [Bacillus selenitireducens
           MLS10]
 gi|297143046|gb|ADH99803.1| beta-lactamase domain protein [Bacillus selenitireducens MLS10]
          Length = 220

 Score =  122 bits (305), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 65/210 (30%), Positives = 110/210 (52%), Gaps = 4/210 (1%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + ++ + P + N   L ++   +A+++DPGGD D +  ++ S +  +K+IW+TH H D
Sbjct: 9   MKWQMISLGPLQTNGFILKNDG--QAIMIDPGGDADRVNTLLDSESLTLKEIWLTHAHFD 66

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMG-KVDEQARLLSIRMNARNASSDRWLQDGDTLL 122
           H+G    L+E     +     +   +    ++     + I   A   + D  +++  +  
Sbjct: 67  HIGAVQDLRERWKCPVYLHDAEREWLTNPSLNGSGLFMGIEKTAAEPA-DVLIKEEGSFG 125

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
            G    ++FH PGHSPG V +   E N    GD LFR  +GRTD+  GD++ L+  I  K
Sbjct: 126 SGDFRCELFHTPGHSPGSVSFYFPEANVIFSGDVLFRGGVGRTDLPGGDHETLLRVIEEK 185

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
            L L D  +   GHGP +TIG E++ NPF+
Sbjct: 186 FLSLPDGTTVANGHGPITTIGEEKKTNPFI 215


>gi|289423125|ref|ZP_06424940.1| metallo-beta-lactamase domain protein [Peptostreptococcus
           anaerobius 653-L]
 gi|289156456|gb|EFD05106.1| metallo-beta-lactamase domain protein [Peptostreptococcus
           anaerobius 653-L]
          Length = 208

 Score =  122 bits (305), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 67/202 (33%), Positives = 116/202 (57%), Gaps = 9/202 (4%)

Query: 14  FKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLKE 73
            ++N    +DE++ +AV+VDP  +     D I+  +  VK I +THGH DH+G   +LKE
Sbjct: 11  MQENTYVYYDEQTRQAVIVDPALNFKDAVDTIKRLDLDVKYILLTHGHADHIGDVEKLKE 70

Query: 74  DLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNAS--SDRWLQDGDTLLLGTHIFKVF 131
                I+  H D+  M+   ++ ++ LS++    +    +D +++D D L +G + F  F
Sbjct: 71  YTGAKIVA-HIDEKEML---NDASKNLSVQFYPESIEFDADIYVKDRDKLKMGENTFSFF 126

Query: 132 HCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEIS 191
             PGH+ G +      + F   GDTLF+ SIGRTD+  GDY Q++ S+  K+  + D+I+
Sbjct: 127 ATPGHTKGGMCIRCGMDMFT--GDTLFKDSIGRTDLYGGDYNQILKSL-KKLSKMEDDIT 183

Query: 192 FVCGHGPNSTIGRERRLNPFLK 213
              GHGP + +G E+++N +++
Sbjct: 184 VYPGHGPATKLGIEKKVNYYMQ 205


>gi|333030418|ref|ZP_08458479.1| beta-lactamase domain protein [Bacteroides coprosuis DSM 18011]
 gi|332741015|gb|EGJ71497.1| beta-lactamase domain protein [Bacteroides coprosuis DSM 18011]
          Length = 217

 Score =  122 bits (305), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 67/203 (33%), Positives = 105/203 (51%), Gaps = 6/203 (2%)

Query: 14  FKQNCTFLFDEESLEAVVVDPGGDLDI----IKDVIQSRNFHVKQIWITHGHVDHVGGAA 69
           F  N   L+D+ + EAVV+DPG   D     +K  I      +K +  TH H+DH+ G  
Sbjct: 11  FPVNSYVLWDD-TKEAVVIDPGVFFDTEKEQLKKFIADNGLKIKHLLNTHLHLDHILGNT 69

Query: 70  QLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFK 129
            + ++  +       D+  + G V +Q R+    +N       ++L++GD +  G     
Sbjct: 70  FMFQEYGIKAEASQDDEYWLEG-VAQQGRMFGFEVNDEPVPLGKYLKEGDQIHFGNQTLD 128

Query: 130 VFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDE 189
           +F  PGHSPG +++ N     A  GD LF+ S+GR D+  G++  L  +I  K+  L DE
Sbjct: 129 IFQVPGHSPGSLVFYNQATGDAFSGDVLFQGSVGRADLQGGNFTALKENIIKKLFILPDE 188

Query: 190 ISFVCGHGPNSTIGRERRLNPFL 212
                GHGP++TIGRE++ NPF 
Sbjct: 189 TVVHAGHGPSTTIGREKKYNPFF 211


>gi|218779831|ref|YP_002431149.1| beta-lactamase domain protein [Desulfatibacillum alkenivorans
           AK-01]
 gi|218761215|gb|ACL03681.1| beta-lactamase domain protein [Desulfatibacillum alkenivorans
           AK-01]
          Length = 221

 Score =  122 bits (305), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 76/217 (35%), Positives = 114/217 (52%), Gaps = 10/217 (4%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +    + V  ++ NC  +   +++EAVV+DPG +   I   ++    +VK I  THGH D
Sbjct: 8   MDIKTLAVGAYQANCYIVACLKTMEAVVIDPGAEEARIAAAVKMMGCNVKMILATHGHGD 67

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HV GA  L + L++  I  H+DD +    +    R  S   ++R   +D   +DG    +
Sbjct: 68  HVMGAKGLADMLNVP-IAMHEDDVSFFQGI-YMDRPPS--QSSRYPQTDIQFKDGRIFEI 123

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   FKV H PGHSPG   ++    ++   GDTLF   +GRTD+     Q L+NS+ +KI
Sbjct: 124 GELQFKVLHTPGHSPGSCCFLC--GDYLFTGDTLFVEGVGRTDMGGMTLQDLLNSVESKI 181

Query: 184 LPLGDEISFVCGH----GPNSTIGRERRLNPFLKSNI 216
           LPL  E   + GH     P STI RE+  NP+++  I
Sbjct: 182 LPLPGETIILPGHDYGPAPTSTIAREKANNPYIRDFI 218


>gi|291539587|emb|CBL12698.1| Zn-dependent hydrolases, including glyoxylases [Roseburia
           intestinalis XB6B4]
          Length = 209

 Score =  122 bits (305), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 75/214 (35%), Positives = 106/214 (49%), Gaps = 7/214 (3%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M+ L      V P + NC F  ++++ E +V+DPG   D +   I         I +THG
Sbjct: 1   MAPLKVEQYVVGPVQTNCYFAINDDTKEVLVIDPGASADQLAKKICQEKLTPIAILLTHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNAS-SDRWLQDGD 119
           H DH GGA +L +   + I     +   +    D  +  LS     +    +D +L++  
Sbjct: 61  HFDHAGGAEELAKHFDIKIYAEEHEKETL----DTPSLNLSGWEGVQKTYHADVFLKNEQ 116

Query: 120 TL-LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINS 178
            + L G HI +VFH PGH+ G   Y     N    GDTLF +S+GRTD   G   Q+I S
Sbjct: 117 EIDLAGFHI-RVFHTPGHTVGGCCYYFPYQNVVFSGDTLFCTSVGRTDFPKGSAAQIIRS 175

Query: 179 INNKILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           I  K+LPL DE +   GH   +TIG ER  NP+L
Sbjct: 176 IKEKLLPLPDETTVYTGHNDITTIGTERMYNPYL 209


>gi|229163206|ref|ZP_04291161.1| Metallo-beta-lactamase [Bacillus cereus R309803]
 gi|228620269|gb|EEK77140.1| Metallo-beta-lactamase [Bacillus cereus R309803]
          Length = 209

 Score =  122 bits (305), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 66/204 (32%), Positives = 109/204 (53%), Gaps = 7/204 (3%)

Query: 13  PFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLK 72
           P + N   L ++++ E ++ DPG +   +   +Q        + +TH H DH+G    ++
Sbjct: 10  PLQTNAYILMNDQN-ECIIFDPGHEGSKLVTYLQEEQLKPLAVLLTHAHFDHIGAVDAVR 68

Query: 73  EDLSLTIIGPHKDDAAMMGKVD---EQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFK 129
           +   + +   HK++A  +G       Q  +++  + A+ A  D  +     L +G+  F+
Sbjct: 69  DAFHIPVY-VHKEEADWLGDATVNGSQIFMMNRSITAKPA--DHIIDAEGALTIGSFNFE 125

Query: 130 VFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDE 189
           +F  PGHSPG + Y   E N    GD LF+ SIGRTD+  G + +LI SI  K+  L DE
Sbjct: 126 IFETPGHSPGSISYYCKEANAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKLFVLPDE 185

Query: 190 ISFVCGHGPNSTIGRERRLNPFLK 213
            + +CGHGP ++IG E+  NPFL+
Sbjct: 186 TAVLCGHGPETSIGFEKENNPFLQ 209


>gi|229031910|ref|ZP_04187897.1| Metallo-beta-lactamase [Bacillus cereus AH1271]
 gi|228729374|gb|EEL80364.1| Metallo-beta-lactamase [Bacillus cereus AH1271]
          Length = 239

 Score =  122 bits (305), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 66/204 (32%), Positives = 110/204 (53%), Gaps = 7/204 (3%)

Query: 13  PFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLK 72
           P + N   L ++++ E ++ DPG + + +   +Q        + +TH H DH+G    ++
Sbjct: 40  PLQTNAYILTNDQN-ECIIFDPGHEGEKLVTYLQEEQLKPLAVLLTHAHFDHIGAVDAVR 98

Query: 73  EDLSLTIIGPHKDDAAMMGKVD---EQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFK 129
           +   + +   HK++A  +G       Q  +++  + A+ A  D  +     L +G+  F+
Sbjct: 99  DAFHIPVY-VHKEEADWLGDATVNGSQIFMMNRSITAKPA--DHIIDAEGALAIGSFNFE 155

Query: 130 VFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDE 189
           +F  PGHSPG + Y   E N    GD LF+ SIGRTD+  G + +LI SI  K+  L DE
Sbjct: 156 IFETPGHSPGSISYYCKEANAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKLFVLPDE 215

Query: 190 ISFVCGHGPNSTIGRERRLNPFLK 213
            + +CGHGP ++IG E+  NPFL+
Sbjct: 216 TAVLCGHGPETSIGFEKENNPFLQ 239


>gi|229174936|ref|ZP_04302456.1| Metallo-beta-lactamase [Bacillus cereus MM3]
 gi|228608604|gb|EEK65906.1| Metallo-beta-lactamase [Bacillus cereus MM3]
          Length = 221

 Score =  121 bits (304), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 66/204 (32%), Positives = 110/204 (53%), Gaps = 7/204 (3%)

Query: 13  PFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLK 72
           P + N   L ++++ E ++ DPG + + +   +Q        + +TH H DH+G    ++
Sbjct: 22  PLQTNAYILTNDQN-ECIIFDPGHEGEKLVTYLQEEQLKPLAVLLTHAHFDHIGAVDAVR 80

Query: 73  EDLSLTIIGPHKDDAAMMGKVD---EQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFK 129
           +   + +   HK++A  +G       Q  +++  + A+ A  D  +     L +G+  F+
Sbjct: 81  DAFHIPVY-VHKEEADWLGDATVNGSQIFMMNRSITAKPA--DHIINAEGALAIGSFNFE 137

Query: 130 VFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDE 189
           +F  PGHSPG + Y   E N    GD LF+ SIGRTD+  G + +LI SI  K+  L DE
Sbjct: 138 IFETPGHSPGSISYYCKEANAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKLFVLPDE 197

Query: 190 ISFVCGHGPNSTIGRERRLNPFLK 213
            + +CGHGP ++IG E+  NPFL+
Sbjct: 198 TAVLCGHGPETSIGFEKENNPFLQ 221


>gi|325283829|ref|YP_004256370.1| beta-lactamase domain-containing protein [Deinococcus proteolyticus
           MRP]
 gi|324315638|gb|ADY26753.1| beta-lactamase domain protein [Deinococcus proteolyticus MRP]
          Length = 215

 Score =  121 bits (304), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 68/205 (33%), Positives = 107/205 (52%), Gaps = 5/205 (2%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           ++   P ++NC  +   E  +  ++DPG D   I  ++ +    V+ I +THGH DH+G 
Sbjct: 16  LLPTGPLQENCYLVAGPEH-QGFLIDPGEDAAGILALVDASGVQVQAILLTHGHFDHIGA 74

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
              ++E L + +   H   AA      ++A L  + +  + A+ D  +  G     G+  
Sbjct: 75  VQAVREALGVPVY-LHPGSAADYDSGQQRAALFGLPLT-QPAAPDHAIAQGQLFTAGSLR 132

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
                 PGH+ GHV++V   + F   GDTLF  SIGRTD+  G++ QL+  I  ++L L 
Sbjct: 133 LMARDLPGHAQGHVVFVG--DGFVLAGDTLFAGSIGRTDLPGGNHPQLLAGIEAELLTLD 190

Query: 188 DEISFVCGHGPNSTIGRERRLNPFL 212
            E +   GHGP +TI RER+ NPFL
Sbjct: 191 GETAVYPGHGPATTIARERQTNPFL 215


>gi|227824348|ref|ZP_03989180.1| beta-lactamase [Acidaminococcus sp. D21]
 gi|226904847|gb|EEH90765.1| beta-lactamase [Acidaminococcus sp. D21]
          Length = 207

 Score =  121 bits (304), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 69/211 (32%), Positives = 117/211 (55%), Gaps = 5/211 (2%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGD-LDIIKDVIQSRNFHVKQIWITHGHV 62
           +  + + V P ++NC  + +EE+ E +++DPG + L I++ V ++    +  I+ITHGH 
Sbjct: 1   MKLYRIVVGPIQENCYLIKNEETGEGIIIDPGDEALKIMEAVKKAGIKKITAIFITHGHG 60

Query: 63  DHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLL 122
           DH+    ++K+ L+   +   ++DA M+ +V   +   S   +      D + +DG T+ 
Sbjct: 61  DHISALDEVKK-LTGAKVYMSREDAPML-RVWNSSLSYSTDRDKTFDPPDVYFEDGMTVT 118

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
                F +   PGH+ G V  +   +    +GDT+F  SIGRTD+  G Y  ++ SI  K
Sbjct: 119 EAGLTFTIAATPGHTLGGVCIIG--DGVVFVGDTIFLESIGRTDLPGGSYDDILTSIKTK 176

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           +L L D+     GHGP++T+G ERR NPFL+
Sbjct: 177 LLTLPDDYRLFPGHGPDTTVGWERRRNPFLQ 207


>gi|254518563|ref|ZP_05130619.1| metallo-beta-lactamase [Clostridium sp. 7_2_43FAA]
 gi|226912312|gb|EEH97513.1| metallo-beta-lactamase [Clostridium sp. 7_2_43FAA]
          Length = 200

 Score =  121 bits (304), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 70/208 (33%), Positives = 107/208 (51%), Gaps = 13/208 (6%)

Query: 8   IVQVTPF---KQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDH 64
           IV+  P    + NC  + DE + +A V+DPG +   +   I++    ++ I +TH H DH
Sbjct: 2   IVKTYPLGSLQTNCYLVIDENTNKAAVIDPGAEASYLIKEIEALGIKIEVILLTHCHFDH 61

Query: 65  VGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLG 124
            G   +LK+         +K D  +    +E   + S  +  +  +  +++ +GD + +G
Sbjct: 62  NGAVEELKDK--------YKVDVYLNKADEEYMEMDSTGIFGKLPNIYKYINEGDEIKVG 113

Query: 125 THIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKIL 184
              FK    PGH+ G   Y+  +  F   GDTLF  SIGRTD L G Y +LI SI  K++
Sbjct: 114 KLTFKAIFTPGHTKGGTCYLVEDKVFT--GDTLFNGSIGRTDFLGGSYNELIESIETKLM 171

Query: 185 PLGDEISFVCGHGPNSTIGRERRLNPFL 212
            L +++    GHGP STI  ER  NPFL
Sbjct: 172 VLDNDVEVYPGHGPKSTIIFERMRNPFL 199


>gi|53713315|ref|YP_099307.1| putative metallo-beta-lactamase [Bacteroides fragilis YCH46]
 gi|253565294|ref|ZP_04842749.1| conserved hypothetical protein [Bacteroides sp. 3_2_5]
 gi|265763390|ref|ZP_06091958.1| conserved hypothetical protein [Bacteroides sp. 2_1_16]
 gi|52216180|dbj|BAD48773.1| putative metallo-beta-lactamase [Bacteroides fragilis YCH46]
 gi|251945573|gb|EES85980.1| conserved hypothetical protein [Bacteroides sp. 3_2_5]
 gi|263255998|gb|EEZ27344.1| conserved hypothetical protein [Bacteroides sp. 2_1_16]
          Length = 212

 Score =  121 bits (303), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 67/204 (32%), Positives = 109/204 (53%), Gaps = 6/204 (2%)

Query: 14  FKQNCTFLFDEESLEAVVVDPGGDLD----IIKDVIQSRNFHVKQIWITHGHVDHVGGAA 69
           F  NC  L+DE + EAVV+DPG   D     +K+ I + N ++K +  TH H+DH+ G  
Sbjct: 11  FPVNCYVLWDETN-EAVVIDPGCFYDEEKQALKNFIVTNNLNIKHLLNTHLHLDHIFGNP 69

Query: 70  QLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFK 129
            +  +  L+    ++ D   + +  +Q+R+   ++N       ++L DGD +  G    +
Sbjct: 70  FMLREFGLSAEA-NQADEYWIDEAPKQSRMFGFQLNEAPVPLGKYLHDGDIITFGNTTLE 128

Query: 130 VFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDE 189
             H PGHSPG ++Y    +N    GD LF+ SIGR D+  G++ +L   I +++  L +E
Sbjct: 129 AIHVPGHSPGSLVYYCRADNCMFSGDVLFQGSIGRADLAGGNFDELKEHICSRLFVLPNE 188

Query: 190 ISFVCGHGPNSTIGRERRLNPFLK 213
                GHG  +TIG E+  NPF +
Sbjct: 189 TIVYPGHGAPTTIGIEKAENPFFR 212


>gi|60681564|ref|YP_211708.1| putative metallo-beta-lactamase [Bacteroides fragilis NCTC 9343]
 gi|60492998|emb|CAH07777.1| putative metallo-beta-lactamase [Bacteroides fragilis NCTC 9343]
 gi|301163120|emb|CBW22669.1| putative metallo-beta-lactamase [Bacteroides fragilis 638R]
          Length = 203

 Score =  121 bits (303), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 67/204 (32%), Positives = 109/204 (53%), Gaps = 6/204 (2%)

Query: 14  FKQNCTFLFDEESLEAVVVDPGGDLD----IIKDVIQSRNFHVKQIWITHGHVDHVGGAA 69
           F  NC  L+DE + EAVV+DPG   D     +K+ I + N ++K +  TH H+DH+ G  
Sbjct: 2   FPVNCYVLWDETN-EAVVIDPGCFYDEEKQALKNFIVTNNLNIKHLLNTHLHLDHIFGNP 60

Query: 70  QLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFK 129
            +  +  L+    ++ D   + +  +Q+R+   ++N       ++L DGD +  G    +
Sbjct: 61  FMLREFGLSAEA-NQADEYWIDEAPKQSRMFGFQLNEAPVPLGKYLHDGDIITFGNTTLE 119

Query: 130 VFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDE 189
             H PGHSPG ++Y    +N    GD LF+ SIGR D+  G++ +L   I +++  L +E
Sbjct: 120 AIHVPGHSPGSLVYYCRADNCMFSGDVLFQGSIGRADLAGGNFDELKEHICSRLFVLPNE 179

Query: 190 ISFVCGHGPNSTIGRERRLNPFLK 213
                GHG  +TIG E+  NPF +
Sbjct: 180 TIVYPGHGAPTTIGIEKAENPFFR 203


>gi|320107117|ref|YP_004182707.1| metallo-beta-lactamase family protein [Terriglobus saanensis
           SP1PR4]
 gi|319925638|gb|ADV82713.1| metallo-beta-lactamase family protein [Terriglobus saanensis
           SP1PR4]
          Length = 210

 Score =  121 bits (303), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 66/206 (32%), Positives = 113/206 (54%), Gaps = 2/206 (0%)

Query: 7   HIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVG 66
            +  V P + NC+ + DE + EA+VVDPGGDL  I+ V++++     QI +TH H+DH+ 
Sbjct: 4   EVFPVGPLQCNCSIVGDETTGEAMVVDPGGDLVRIRAVLEAKKLRCTQIVVTHAHLDHIA 63

Query: 67  GAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTH 126
           GA +L +     +   ++ D  ++  +D+QA  + + +    A  D   ++G  + +G  
Sbjct: 64  GARRLSQMTGAPVFY-NQLDLPLVEIMDQQAEWMGVAL-PEVAPPDASAEEGMKISVGGV 121

Query: 127 IFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPL 186
             +V H PGH+ G +            GDTLF+  IGRTD+  GD ++++ S+  +++ L
Sbjct: 122 TAEVMHTPGHTEGSLCLYFPNERLLLAGDTLFKGGIGRTDLPGGDARKILVSLQERLMGL 181

Query: 187 GDEISFVCGHGPNSTIGRERRLNPFL 212
            ++   V GHG  + IG E   NP+L
Sbjct: 182 PEQTIVVPGHGALTNIGDELENNPWL 207


>gi|118479436|ref|YP_896587.1| metallo-beta-lactamase family protein [Bacillus thuringiensis str.
           Al Hakam]
 gi|118418661|gb|ABK87080.1| metallo-beta-lactamase family protein [Bacillus thuringiensis str.
           Al Hakam]
          Length = 239

 Score =  121 bits (303), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 67/204 (32%), Positives = 109/204 (53%), Gaps = 7/204 (3%)

Query: 13  PFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLK 72
           P + N   L ++++ E V+ DPG + + +   +Q        + +TH H DH+G    ++
Sbjct: 40  PLQTNAYILKNDQN-ECVIFDPGHEGEKLVTYLQEEQLKPLAVLLTHAHFDHIGAVDAVR 98

Query: 73  EDLSLTIIGPHKDDAAMMGKVD---EQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFK 129
           E   + +   HK++   +G       Q  +++  + A+ A  D  +     L +G+  F+
Sbjct: 99  EAFHIPVY-VHKEEEDWLGDATVNGSQIFMMNRSITAKPA--DHIIDAEGKLAIGSFNFE 155

Query: 130 VFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDE 189
           +F  PGHSPG + Y   E N    GD LF+ SIGRTD+  G + +LI SI  K+  L DE
Sbjct: 156 IFETPGHSPGSISYYCKEANAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKLFVLPDE 215

Query: 190 ISFVCGHGPNSTIGRERRLNPFLK 213
            + +CGHGP ++IG E+  NPFL+
Sbjct: 216 TAVLCGHGPETSIGFEKENNPFLQ 239


>gi|229491977|ref|ZP_04385794.1| putative metallo-beta-lactamase domain protein [Rhodococcus
           erythropolis SK121]
 gi|229321109|gb|EEN86913.1| putative metallo-beta-lactamase domain protein [Rhodococcus
           erythropolis SK121]
          Length = 226

 Score =  121 bits (303), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 75/210 (35%), Positives = 111/210 (52%), Gaps = 12/210 (5%)

Query: 14  FKQNCTFLFDEESLEAVVVDPGGDL-DIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLK 72
           F+ NC  L  +++ E VVVDPG D  + + + + S++  V  + +THGH+DHV  A ++ 
Sbjct: 11  FQTNCYILAQDDACECVVVDPGQDAAEPLFEYLDSKDMSVTAVLLTHGHLDHVWSAREVC 70

Query: 73  EDLSLTIIGPHKDDAAMMGK----VDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIF 128
           E  S+     H +D  M+      +    +     M          L DGD +      F
Sbjct: 71  ERYSVPAY-IHPEDRYMLSDPARGIGPTMKEFIQGMTFVEPDEVIELADGDKITEAGMTF 129

Query: 129 KVFHCPGHSPGHVIYVNFEN------NFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
            V H PGH+ G V++    N      + A  GDTLF+ S+GR+D+  G+++QL+ SI  K
Sbjct: 130 VVDHTPGHTQGSVVFRTQANTESGPVDLAFTGDTLFQGSVGRSDLPGGNHEQLLASIARK 189

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           +L LGDE   + GHG NS+IG ER  NPFL
Sbjct: 190 LLVLGDETVVLPGHGGNSSIGAERSSNPFL 219


>gi|300776219|ref|ZP_07086078.1| metallo-beta-lactamase [Chryseobacterium gleum ATCC 35910]
 gi|300505352|gb|EFK36491.1| metallo-beta-lactamase [Chryseobacterium gleum ATCC 35910]
          Length = 235

 Score =  121 bits (303), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 67/207 (32%), Positives = 108/207 (52%), Gaps = 6/207 (2%)

Query: 11  VTPFKQNCTFLFDEESLEAVVVDPGG----DLDIIKDVIQSRNFHVKQIWITHGHVDHVG 66
           V  F    T++   E+  A ++DPG     +   I + I  +   +++I +TH H+DHV 
Sbjct: 31  VFNFASENTYIIYNENKNAWLIDPGNMNAQETQAIDNFITEKGLKIQKILLTHAHIDHVF 90

Query: 67  GAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTH 126
           G  Q   D     +  H++D  ++  +        ++++      + ++++G+ L L   
Sbjct: 91  GL-QWAFDTFKVPVNMHQEDQEVLDMLQASGVRFGMKIDPVKVEIE-YIKEGEELDLDGE 148

Query: 127 IFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPL 186
            FK++H PGHSPG V+Y N    F   GD LF  SIGRTD+  G+Y QLI  I  K+  L
Sbjct: 149 KFKIYHVPGHSPGSVVYHNENQKFMISGDVLFEGSIGRTDLYKGNYDQLIEGIRTKLFIL 208

Query: 187 GDEISFVCGHGPNSTIGRERRLNPFLK 213
            ++     GHG  ++IG E++ NPFLK
Sbjct: 209 DNDTQVFSGHGNPTSIGFEKQYNPFLK 235


>gi|196046331|ref|ZP_03113557.1| metallo-beta-lactamase family protein [Bacillus cereus 03BB108]
 gi|225866243|ref|YP_002751621.1| metallo-beta-lactamase family protein [Bacillus cereus 03BB102]
 gi|196022801|gb|EDX61482.1| metallo-beta-lactamase family protein [Bacillus cereus 03BB108]
 gi|225788102|gb|ACO28319.1| metallo-beta-lactamase family protein [Bacillus cereus 03BB102]
          Length = 209

 Score =  120 bits (302), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 67/204 (32%), Positives = 109/204 (53%), Gaps = 7/204 (3%)

Query: 13  PFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLK 72
           P + N   L ++++ E V+ DPG + + +   +Q        + +TH H DH+G    ++
Sbjct: 10  PLQTNAYILKNDQN-ECVIFDPGHEGEKLVTYLQEEQLKPLAVLLTHAHFDHIGAVDAVR 68

Query: 73  EDLSLTIIGPHKDDAAMMGKVD---EQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFK 129
           E   + +   HK++   +G       Q  +++  + A+ A  D  +     L +G+  F+
Sbjct: 69  EAFHIPVY-VHKEEEDWLGDATVNGSQIFMMNRSITAKPA--DHIIDAEGKLAIGSFNFE 125

Query: 130 VFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDE 189
           +F  PGHSPG + Y   E N    GD LF+ SIGRTD+  G + +LI SI  K+  L DE
Sbjct: 126 IFETPGHSPGSISYYCKEANAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKLFVLPDE 185

Query: 190 ISFVCGHGPNSTIGRERRLNPFLK 213
            + +CGHGP ++IG E+  NPFL+
Sbjct: 186 TAVLCGHGPETSIGFEKENNPFLQ 209


>gi|167629915|ref|YP_001680414.1| metallo-beta-lactamase family protein, putative [Heliobacterium
           modesticaldum Ice1]
 gi|167592655|gb|ABZ84403.1| metallo-beta-lactamase family protein, putative [Heliobacterium
           modesticaldum Ice1]
          Length = 208

 Score =  120 bits (302), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 75/202 (37%), Positives = 107/202 (52%), Gaps = 9/202 (4%)

Query: 14  FKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLKE 73
              NC  +   E+ EA ++DPGGD +++    +     +  I  THGH DH+     +K+
Sbjct: 11  LAANCYLVQCPETGEAALIDPGGDGEMLLRRAEEAKAKIVAIINTHGHSDHIAANGDIKK 70

Query: 74  DLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNAS--SDRWLQDGDTLLLGTHI-FKV 130
               TI+  H+ +AA    +    + LS+ + A   S  +DR L+DGD L +G  +  +V
Sbjct: 71  ATGATILC-HEAEAA---SIISPGKNLSLYIGASITSPPADRLLKDGDVLTIGRTVRLEV 126

Query: 131 FHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEI 190
            H PGH+ G +            GDTLF  SIGRTD+  G Y Q+++SI  K+L L D+ 
Sbjct: 127 LHTPGHTVGGICLRG--QGVVFTGDTLFHGSIGRTDLPGGSYNQILHSIREKLLALPDDT 184

Query: 191 SFVCGHGPNSTIGRERRLNPFL 212
               GHGP STIG ER  NPFL
Sbjct: 185 VVYPGHGPESTIGFERVNNPFL 206


>gi|237716319|ref|ZP_04546800.1| conserved hypothetical protein [Bacteroides sp. D1]
 gi|237721002|ref|ZP_04551483.1| conserved hypothetical protein [Bacteroides sp. 2_2_4]
 gi|262407922|ref|ZP_06084470.1| conserved hypothetical protein [Bacteroides sp. 2_1_22]
 gi|293373033|ref|ZP_06619402.1| metallo-beta-lactamase domain protein [Bacteroides ovatus SD CMC
           3f]
 gi|294646732|ref|ZP_06724355.1| metallo-beta-lactamase domain protein [Bacteroides ovatus SD CC 2a]
 gi|294807739|ref|ZP_06766532.1| metallo-beta-lactamase domain protein [Bacteroides xylanisolvens SD
           CC 1b]
 gi|298484214|ref|ZP_07002379.1| metallo-beta-lactamase family protein [Bacteroides sp. D22]
 gi|299145413|ref|ZP_07038481.1| metallo-beta-lactamase family protein [Bacteroides sp. 3_1_23]
 gi|315918860|ref|ZP_07915100.1| conserved hypothetical protein [Bacteroides sp. D2]
 gi|229443966|gb|EEO49757.1| conserved hypothetical protein [Bacteroides sp. D1]
 gi|229449837|gb|EEO55628.1| conserved hypothetical protein [Bacteroides sp. 2_2_4]
 gi|262354730|gb|EEZ03822.1| conserved hypothetical protein [Bacteroides sp. 2_1_22]
 gi|292632101|gb|EFF50710.1| metallo-beta-lactamase domain protein [Bacteroides ovatus SD CMC
           3f]
 gi|292637892|gb|EFF56287.1| metallo-beta-lactamase domain protein [Bacteroides ovatus SD CC 2a]
 gi|294445175|gb|EFG13849.1| metallo-beta-lactamase domain protein [Bacteroides xylanisolvens SD
           CC 1b]
 gi|298269627|gb|EFI11223.1| metallo-beta-lactamase family protein [Bacteroides sp. D22]
 gi|298515904|gb|EFI39785.1| metallo-beta-lactamase family protein [Bacteroides sp. 3_1_23]
 gi|313692735|gb|EFS29570.1| conserved hypothetical protein [Bacteroides sp. D2]
          Length = 212

 Score =  120 bits (302), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 67/204 (32%), Positives = 109/204 (53%), Gaps = 6/204 (2%)

Query: 14  FKQNCTFLFDEESLEAVVVDPGG----DLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAA 69
           F  NC  L+D+ + EAVV+DPG     +   +K  I +   +VK +  TH H+DH+ G  
Sbjct: 11  FPVNCYVLWDD-TKEAVVIDPGCFYEEEKQALKKFILTNELNVKHLLNTHLHLDHIFGNP 69

Query: 70  QLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFK 129
            + ++  L+    +K D   + +  +Q+R+   ++        ++L DGD +  G    +
Sbjct: 70  FMLKEFGLSAEA-NKADEYWIDEAPKQSRMFGFQLQEEPVPLGKYLHDGDIITFGHTKLE 128

Query: 130 VFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDE 189
             H PGHSPG ++Y   E+N    GD LF+ SIGR D+  G++ +LI  I +++  L +E
Sbjct: 129 AIHVPGHSPGSLVYYCKEDNCMFSGDVLFQGSIGRADLTGGNFDELIEHICSRLFVLPNE 188

Query: 190 ISFVCGHGPNSTIGRERRLNPFLK 213
                GHG  +TIG E+  NPF +
Sbjct: 189 TVVYPGHGAPTTIGMEKAENPFFR 212


>gi|229186502|ref|ZP_04313664.1| Metallo-beta-lactamase [Bacillus cereus BGSC 6E1]
 gi|228596933|gb|EEK54591.1| Metallo-beta-lactamase [Bacillus cereus BGSC 6E1]
          Length = 221

 Score =  120 bits (302), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 67/204 (32%), Positives = 109/204 (53%), Gaps = 7/204 (3%)

Query: 13  PFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLK 72
           P + N   L ++++ E V+ DPG + + +   +Q        + +TH H DH+G    ++
Sbjct: 22  PLQTNAYILKNDQN-ECVIFDPGHEGEKLVTYLQEEQLKPLAVLLTHAHFDHIGAVDAVR 80

Query: 73  EDLSLTIIGPHKDDAAMMGKVD---EQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFK 129
           E   + +   HK++   +G       Q  +++  + A+ A  D  +     L +G+  F+
Sbjct: 81  EAFHIPVY-VHKEEEDWLGDATVNGSQIFMMNRSITAKPA--DHIIDAEGKLAIGSFNFE 137

Query: 130 VFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDE 189
           +F  PGHSPG + Y   E N    GD LF+ SIGRTD+  G + +LI SI  K+  L DE
Sbjct: 138 IFETPGHSPGSISYYCKEANAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKLFVLPDE 197

Query: 190 ISFVCGHGPNSTIGRERRLNPFLK 213
            + +CGHGP ++IG E+  NPFL+
Sbjct: 198 TAVLCGHGPETSIGFEKENNPFLQ 221


>gi|299144026|ref|ZP_07037106.1| metallo-beta-lactamase family protein [Peptoniphilus sp. oral taxon
           386 str. F0131]
 gi|298518511|gb|EFI42250.1| metallo-beta-lactamase family protein [Peptoniphilus sp. oral taxon
           386 str. F0131]
          Length = 211

 Score =  120 bits (302), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 70/213 (32%), Positives = 117/213 (54%), Gaps = 8/213 (3%)

Query: 4   LSFHIVQVT--PFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGH 61
           + F I+++T   ++ NC  +FD+ +  +V++DPG +   I   I+ RN  V +I +TH H
Sbjct: 1   MDFKIIRLTLGAYQTNCYIIFDKNN-NSVIIDPGAEAKAIIKEIEDRNLTVDKIILTHAH 59

Query: 62  VDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
            DH G    +++  ++       D+  +  +  E   +L ++ N    S+D  ++DGD +
Sbjct: 60  PDHFGALDDVRKHFNVKAFLGRDDNIMLEDRSSELNLVLGLKPNK--ISADVLVEDGDLI 117

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
             G   FKV   PGH+PG +  +    N    GDTLF  SIGRTD+  GDY+ ++ S+  
Sbjct: 118 SFGDKYFKVISTPGHTPGGICLL--IGNVLFSGDTLFCGSIGRTDLPGGDYETILESL-K 174

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
            ++ L D    + GHGP S+I  E++ NPF++S
Sbjct: 175 LLVQLPDNTIVLPGHGPESSIEYEKQNNPFIRS 207


>gi|160886033|ref|ZP_02067036.1| hypothetical protein BACOVA_04039 [Bacteroides ovatus ATCC 8483]
 gi|260170516|ref|ZP_05756928.1| putative metallo-beta-lactamase [Bacteroides sp. D2]
 gi|156108846|gb|EDO10591.1| hypothetical protein BACOVA_04039 [Bacteroides ovatus ATCC 8483]
          Length = 219

 Score =  120 bits (302), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 67/204 (32%), Positives = 109/204 (53%), Gaps = 6/204 (2%)

Query: 14  FKQNCTFLFDEESLEAVVVDPGG----DLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAA 69
           F  NC  L+D+ + EAVV+DPG     +   +K  I +   +VK +  TH H+DH+ G  
Sbjct: 18  FPVNCYVLWDD-TKEAVVIDPGCFYEEEKQALKKFILTNELNVKHLLNTHLHLDHIFGNP 76

Query: 70  QLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFK 129
            + ++  L+    +K D   + +  +Q+R+   ++        ++L DGD +  G    +
Sbjct: 77  FMLKEFGLSAEA-NKADEYWIDEAPKQSRMFGFQLQEEPVPLGKYLHDGDIITFGHTKLE 135

Query: 130 VFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDE 189
             H PGHSPG ++Y   E+N    GD LF+ SIGR D+  G++ +LI  I +++  L +E
Sbjct: 136 AIHVPGHSPGSLVYYCKEDNCMFSGDVLFQGSIGRADLTGGNFDELIEHICSRLFVLPNE 195

Query: 190 ISFVCGHGPNSTIGRERRLNPFLK 213
                GHG  +TIG E+  NPF +
Sbjct: 196 TVVYPGHGAPTTIGMEKAENPFFR 219


>gi|228910095|ref|ZP_04073915.1| Metallo-beta-lactamase [Bacillus thuringiensis IBL 200]
 gi|228849612|gb|EEM94446.1| Metallo-beta-lactamase [Bacillus thuringiensis IBL 200]
          Length = 242

 Score =  120 bits (302), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 67/207 (32%), Positives = 112/207 (54%), Gaps = 10/207 (4%)

Query: 13  PFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQ---IWITHGHVDHVGGAA 69
           P + N   L +++  E ++ DPG + + +   +Q       +   + +TH H DH+G   
Sbjct: 40  PLQTNAYILMNDQK-ECIIFDPGHEGEKLVTYLQEEQLKPLKPLAVLLTHAHFDHIGAVD 98

Query: 70  QLKEDLSLTIIGPHKDDAAMMGKVD---EQARLLSIRMNARNASSDRWLQDGDTLLLGTH 126
            +++   + +   HK++A  +G       Q  +++  + A+ A  D  +    TL +G+ 
Sbjct: 99  AVRDAFHIPVY-VHKEEADWLGDATVNGSQIFMMNRSITAKPA--DHIIDAEGTLTIGSF 155

Query: 127 IFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPL 186
            F++F  PGHSPG + Y + E N    GD LF+ SIGRTD+  G + +LI SI  K+  L
Sbjct: 156 NFEIFETPGHSPGSISYYSKEANAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKLFVL 215

Query: 187 GDEISFVCGHGPNSTIGRERRLNPFLK 213
            DE + +CGHGP ++IG E+  NPFL+
Sbjct: 216 PDETAVLCGHGPETSIGFEKENNPFLQ 242


>gi|258515500|ref|YP_003191722.1| beta-lactamase domain-containing protein [Desulfotomaculum
           acetoxidans DSM 771]
 gi|257779205|gb|ACV63099.1| beta-lactamase domain protein [Desulfotomaculum acetoxidans DSM
           771]
          Length = 205

 Score =  120 bits (302), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 71/197 (36%), Positives = 103/197 (52%), Gaps = 6/197 (3%)

Query: 17  NCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLKEDLS 76
           NC  +  EE+ EA V+DPG +   I   +       + I +THGHVDH+G   Q+++   
Sbjct: 14  NCYIIGCEETKEACVIDPGDEDKKILSKLVKHGLTCRYIVLTHGHVDHIGALEQVQKATG 73

Query: 77  LTIIGPHKDDAAMM-GKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFKVFHCPG 135
             ++  H+DDA M+       +  + ++M    A  D  L D D + +G    +V H PG
Sbjct: 74  ARVL-IHRDDADMLTNPAKNLSSFMGLQMQFEPA--DVKLGDKDVIEVGKLKLEVIHTPG 130

Query: 136 HSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEISFVCG 195
           H+PG +     +      GDTLF  S+GR+D   G + QLI SI NK+L   D      G
Sbjct: 131 HTPGGICLKTGDCLIT--GDTLFAGSVGRSDFPGGSHSQLIASIKNKLLNFPDNTRVFSG 188

Query: 196 HGPNSTIGRERRLNPFL 212
           HGP ++IG E+R NPFL
Sbjct: 189 HGPETSIGTEKRTNPFL 205


>gi|307243804|ref|ZP_07525935.1| metallo-beta-lactamase domain protein [Peptostreptococcus stomatis
           DSM 17678]
 gi|306492807|gb|EFM64829.1| metallo-beta-lactamase domain protein [Peptostreptococcus stomatis
           DSM 17678]
          Length = 208

 Score =  120 bits (302), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 72/200 (36%), Positives = 111/200 (55%), Gaps = 9/200 (4%)

Query: 16  QNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLKEDL 75
           +N    +DEE+LEAVV+DP   +D  K  I+ +N  VK I +THGH DH+G   +LK+ L
Sbjct: 13  ENTYICYDEETLEAVVIDPSLSIDEEKKFIKDKNLDVKYIMLTHGHADHIGDVLELKK-L 71

Query: 76  SLTIIGPHKDDAAMMGKVDEQA--RLLSIRMNARNASSDRWLQDGDTLLLGTHIFKVFHC 133
           +   I  H+D+  M+   ++     L   R+      +D ++ D + L +G H F     
Sbjct: 72  TGAKILAHQDEKEMLNDANKNMSHELFRRRIEFE---ADVYVTDKEKLKVGNHTFTFIAT 128

Query: 134 PGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEISFV 193
           PGH+ G +      + F   GDTLF  SIGRTD   GDY+ ++ S+  K+  + +++   
Sbjct: 129 PGHTKGGMCIRIGMDMFT--GDTLFAGSIGRTDFYGGDYKVILKSL-KKLSKMENDLVVY 185

Query: 194 CGHGPNSTIGRERRLNPFLK 213
            GHGP STIG E++ N ++K
Sbjct: 186 PGHGPVSTIGIEKQENYYMK 205


>gi|317503187|ref|ZP_07961248.1| metallo-beta-lactamase [Prevotella salivae DSM 15606]
 gi|315665690|gb|EFV05296.1| metallo-beta-lactamase [Prevotella salivae DSM 15606]
          Length = 214

 Score =  120 bits (302), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 71/204 (34%), Positives = 110/204 (53%), Gaps = 8/204 (3%)

Query: 14  FKQNCTFLFDEESLEAVVVDPGG----DLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAA 69
            ++NC ++  +E+ E V++D G     +  +I+D I S       +  THGH+DH  G  
Sbjct: 12  LQENC-YVVSDETNECVIIDCGAMDEEEFSLIRDYIVSEELTPVHLLATHGHIDHNFGNV 70

Query: 70  QLKEDLSLTIIGPHKDDAAMMGKVDEQA-RLLSIRMNARNASSDRWLQDGDTLLLGTHIF 128
            + ++  L +   H++D ++M K+ +QA ++  I++     S  ++L D D +  G+H F
Sbjct: 71  MVYKEYGLKV-EVHENDKSLMAKLAQQALQMTGIKLQDDFPSVGKYLHDNDKVSFGSHAF 129

Query: 129 KVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGD 188
            V   PGHS G V + + E + A  GDTLF+ SIGRTD   G   Q+I S+   I  L D
Sbjct: 130 TVIETPGHSRGSVFFYDEEEHVAFSGDTLFQRSIGRTDFEGGSMFQMIQSL-RMICQLPD 188

Query: 189 EISFVCGHGPNSTIGRERRLNPFL 212
                 GHGP +TIG E   NP+L
Sbjct: 189 TTRVYPGHGPETTIGAELASNPYL 212


>gi|118444608|ref|YP_877919.1| metallo-beta-lactamase family protein [Clostridium novyi NT]
 gi|118135064|gb|ABK62108.1| metallo-beta-lactamase family protein [Clostridium novyi NT]
          Length = 199

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 74/199 (37%), Positives = 109/199 (54%), Gaps = 10/199 (5%)

Query: 14  FKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLKE 73
           +  NC  L D    E  ++DPGGD D++   I + N  VK I +THGH+DH GG  +LK+
Sbjct: 11  YGANCYILIDGN--EGCIIDPGGDADMLIRNIDALNIDVKFILLTHGHMDHTGGVQELKD 68

Query: 74  DLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFKVFHC 133
             ++ +   +++D  +M K    +++     N      D+ ++DGD L LG    K    
Sbjct: 69  RYNVPVY-INENDLELMRK---HSQVFGPIWN--ETEEDKTIKDGDVLKLGNLEIKCLET 122

Query: 134 PGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEISFV 193
           PGH+PG + +V  +  F   GDTLFR S+GRTD   GD+  LI SI  K++ L D+   +
Sbjct: 123 PGHTPGGMSFVVKDVVFT--GDTLFRGSVGRTDFPGGDHSALIRSIKEKLIVLDDDTVVL 180

Query: 194 CGHGPNSTIGRERRLNPFL 212
            GH   S I  E++ NPFL
Sbjct: 181 PGHEGESNIKFEKQYNPFL 199


>gi|228993006|ref|ZP_04152929.1| Metallo-beta-lactamase [Bacillus pseudomycoides DSM 12442]
 gi|228999056|ref|ZP_04158638.1| Metallo-beta-lactamase [Bacillus mycoides Rock3-17]
 gi|229006604|ref|ZP_04164239.1| Metallo-beta-lactamase [Bacillus mycoides Rock1-4]
 gi|228754653|gb|EEM04063.1| Metallo-beta-lactamase [Bacillus mycoides Rock1-4]
 gi|228760673|gb|EEM09637.1| Metallo-beta-lactamase [Bacillus mycoides Rock3-17]
 gi|228766654|gb|EEM15294.1| Metallo-beta-lactamase [Bacillus pseudomycoides DSM 12442]
          Length = 209

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 64/204 (31%), Positives = 109/204 (53%), Gaps = 7/204 (3%)

Query: 13  PFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLK 72
           P + N   L +++  E ++ DPG + + +   +Q        + +TH H DH+G    ++
Sbjct: 10  PLQTNAYILSNDQK-ECIIFDPGSEGEKLVTYLQEEQLKPLAVLLTHAHFDHIGAVDAVR 68

Query: 73  EDLSLTIIGPHKDDAAMMGKVD---EQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFK 129
           +   + +   HK++   +G       Q  +++  + A+ A  D+ ++    L +G+  F+
Sbjct: 69  DAFHIPVY-VHKEEVDWLGDATVNGSQIFMMNRSITAKPA--DQIIEGEGMLTIGSFTFE 125

Query: 130 VFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDE 189
           +F  PGHSPG + Y   E N    GD LF+ SIGRTD+  G + +LI SI  K+  L D+
Sbjct: 126 MFETPGHSPGSISYYCKEANAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKLFVLPDD 185

Query: 190 ISFVCGHGPNSTIGRERRLNPFLK 213
            + +CGHGP + IG E+  NPFL+
Sbjct: 186 TAVLCGHGPETNIGFEKENNPFLQ 209


>gi|312898879|ref|ZP_07758267.1| metallo-beta-lactamase domain protein [Megasphaera micronuciformis
           F0359]
 gi|310620041|gb|EFQ03613.1| metallo-beta-lactamase domain protein [Megasphaera micronuciformis
           F0359]
          Length = 211

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 71/221 (32%), Positives = 110/221 (49%), Gaps = 28/221 (12%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + +  + + P + NC  ++D+   EA ++DP  D + I   +      ++ +++THGH D
Sbjct: 3   IQYKTLPLGPLETNCYIVYDDVEKEAFLIDPAWDYEQIDKALDVLGVTLRFVFLTHGHAD 62

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARN------------ASS 111
           H+G   +++          HKD    +GK D     + +  N+RN             S 
Sbjct: 63  HIGALQEVRN---------HKDVPVYIGKGD-----VDLIANSRNNLSMFLGKEIVITSP 108

Query: 112 DRWLQDGDTLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGD 171
           +  + DG+ +      FKV   PGH+PG +        FA  GDTLFR S+GRTD   GD
Sbjct: 109 EHIVTDGEVINFAGVPFKVIETPGHTPGGLCLYGAGLLFA--GDTLFRCSVGRTDFYGGD 166

Query: 172 YQQLINSINNKILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
              L++SI  K++ L D+   + GHGP + IG ERR NPFL
Sbjct: 167 SHVLVSSIEEKLMKLPDDTVVLPGHGPATDIGYERRNNPFL 207


>gi|320161011|ref|YP_004174235.1| hypothetical protein ANT_16090 [Anaerolinea thermophila UNI-1]
 gi|319994864|dbj|BAJ63635.1| hypothetical protein ANT_16090 [Anaerolinea thermophila UNI-1]
          Length = 211

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 67/205 (32%), Positives = 103/205 (50%), Gaps = 4/205 (1%)

Query: 10  QVTPFKQNCTFLFDEESLEAVVVDPG-GDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGA 68
           ++ P   N   + D ES  A+++DP  G   ++K  ++ +   ++ IWITH H DH+GG 
Sbjct: 9   ELGPLSNNTYLVADSESHTAIIIDPAFGSSAVVKTCLE-KQLTIQGIWITHAHFDHIGGV 67

Query: 69  AQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIF 128
             +++      I  H  D ++  +    ++L    M    A  +  L    TL LGT  F
Sbjct: 68  EAVRKHFPQAQIALHPLDQSLW-QDGGGSQLFGFHMKPLPAP-EVLLNHKQTLPLGTTFF 125

Query: 129 KVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGD 188
           +V H PGH+PGHV +V         GD +F   +GRTD+  GD +QL  SI   I  L  
Sbjct: 126 EVLHTPGHTPGHVCFVLHSQKVVFTGDLIFYRGVGRTDLPGGDPKQLYQSIREHIYTLPS 185

Query: 189 EISFVCGHGPNSTIGRERRLNPFLK 213
           +     GHGP++T+  ER  NP++ 
Sbjct: 186 DYHLFSGHGPSTTVEEERIENPYIS 210


>gi|255994168|ref|ZP_05427303.1| metallo-beta-lactamase family protein [Eubacterium saphenum ATCC
           49989]
 gi|255993836|gb|EEU03925.1| metallo-beta-lactamase family protein [Eubacterium saphenum ATCC
           49989]
          Length = 217

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 71/209 (33%), Positives = 109/209 (52%), Gaps = 16/209 (7%)

Query: 11  VTPFKQNCTFL-FDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAA 69
           VT F Q  T+L +DE++LE  ++D G  L  I D ++    ++K I +THGH DH GG  
Sbjct: 15  VTGFLQINTYLVYDEDTLEGFIIDIGKYLKDITDFVKKERIYIKYIIVTHGHDDHTGGVN 74

Query: 70  QLKEDLSLTIIGPHK------DDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
             ++D     +  HK      +D  + G ++   +  +I++       D ++ DGDTL +
Sbjct: 75  DQRKDFPDAKVVAHKGDIDWYNDPRLNGSIEISGKPNTIKI-------DEYVSDGDTLTV 127

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     + H PGH+PG +    +  N    GDTLF  SIGRTD   G ++ +  SI  K+
Sbjct: 128 GNMKLDIIHTPGHTPGGICI--YTPNALFSGDTLFSHSIGRTDFTGGSFEDITRSIREKL 185

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
             L D+     GH   +TIG E++ NPF+
Sbjct: 186 YKLPDDTEVYPGHMGTTTIGIEKKNNPFV 214


>gi|94986360|ref|YP_605724.1| beta-lactamase-like protein [Deinococcus geothermalis DSM 11300]
 gi|94556641|gb|ABF46555.1| beta-lactamase-like protein [Deinococcus geothermalis DSM 11300]
          Length = 219

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 69/209 (33%), Positives = 108/209 (51%), Gaps = 6/209 (2%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           ++   P ++N   L   ++ E  +VDPG D + +  +++     V+ I +TH H DH+G 
Sbjct: 14  VLPTGPLQENA-LLVAGQAGEGFLVDPGDDAEQVLALVRDSGVKVRGILLTHAHFDHIGA 72

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
              ++E L++ +   H  D ++  + +  A    +      A  D  +  G T   G   
Sbjct: 73  VQPVREALAVPVYL-HPADLSIYQQGEASAARWGLPFTQPEAP-DVEIAQGQTFTAGDLR 130

Query: 128 FKVFHCPGHSPGHVIYV---NFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKIL 184
                 PGH+PGHV++V     E  F   GDTLF+ SIGRTD+  G++ QLI  I  ++L
Sbjct: 131 LTARELPGHAPGHVVFVAQSGEEPGFVVAGDTLFQGSIGRTDLPGGNHPQLIAGIRRELL 190

Query: 185 PLGDEISFVCGHGPNSTIGRERRLNPFLK 213
            L DE +   GHGP +T+G ERR N FL+
Sbjct: 191 SLPDETAIYPGHGPATTVGAERRTNLFLR 219


>gi|332976211|gb|EGK13075.1| metallo-beta-lactamase [Desmospora sp. 8437]
          Length = 228

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 63/204 (30%), Positives = 106/204 (51%), Gaps = 3/204 (1%)

Query: 13  PFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLK 72
           P   NC  ++ E+    +V+DPG   + + + I+  +  ++ I +TH H DH+GG  +++
Sbjct: 27  PVMTNCYLVYKEKGGAGLVIDPGTGPEEVVERIRDLDLKIEAILLTHAHFDHIGGVEEVR 86

Query: 73  EDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFKVFH 132
                 +   H+++A  + + +     L          +++ ++ G+ L L    F V H
Sbjct: 87  AATGAPVY-IHQEEAEWLLQPELNGSTLFPVEEVSCRPAEKIVEGGEQLTLLGETFAVLH 145

Query: 133 CPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEISF 192
            PGHSPG V Y      F+  GD LF  SIGRTD   GDY+ L+ +I+  ++ L +E   
Sbjct: 146 TPGHSPGSVSYRTGSVIFS--GDVLFSGSIGRTDFPGGDYKTLMQTIHQVMMELPEETVV 203

Query: 193 VCGHGPNSTIGRERRLNPFLKSNI 216
             GHGP +TIGRE+  NP++   +
Sbjct: 204 YSGHGPVTTIGREQDTNPYVTGGL 227


>gi|323706436|ref|ZP_08117998.1| beta-lactamase domain-containing protein [Thermoanaerobacterium
           xylanolyticum LX-11]
 gi|323534221|gb|EGB24010.1| beta-lactamase domain-containing protein [Thermoanaerobacterium
           xylanolyticum LX-11]
          Length = 213

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 78/207 (37%), Positives = 111/207 (53%), Gaps = 9/207 (4%)

Query: 10  QVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAA 69
            V  F+ NC  +  + S E ++VD G  +  ++D +   +F +K I ITHGH DH+GG  
Sbjct: 11  SVGRFQANCYIVSAKGSHECIMVDAGNFVPEVEDYLIDNDFRLKYILITHGHFDHIGGID 70

Query: 70  QLKEDLSLTI-IGPHKDDAAMMGKVDEQARLLSI-RMNARNASSDRWLQDGDTLLLGTHI 127
             ++     + IG   DDA M+             ++ +++A  D  L+DGDTL  G  I
Sbjct: 71  YFRDKFGAKVCIG--TDDAEMLKNPAMNLSEFGFGKIISKDA--DILLRDGDTLSFGEGI 126

Query: 128 F-KVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPL 186
           F    H PGH+PG V Y   +  F   GDTLF+ SIGRTD   GD+ ++INSI NK+  L
Sbjct: 127 FITTIHTPGHTPGGVCYKIDDACFT--GDTLFKESIGRTDFPGGDFNEIINSIKNKLFML 184

Query: 187 GDEISFVCGHGPNSTIGRERRLNPFLK 213
            D      GHG  +TI  E+  NPF++
Sbjct: 185 PDTTLVFPGHGDITTIKDEKLKNPFVR 211


>gi|47567823|ref|ZP_00238531.1| hydroxyacylglutathione hydrolase [Bacillus cereus G9241]
 gi|47555500|gb|EAL13843.1| hydroxyacylglutathione hydrolase [Bacillus cereus G9241]
          Length = 209

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 66/204 (32%), Positives = 110/204 (53%), Gaps = 7/204 (3%)

Query: 13  PFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLK 72
           P + N   L ++++ E ++ DPG + + +   +Q        + +TH H DH+G    ++
Sbjct: 10  PLQTNAYILTNDQN-ECIIFDPGHEGEKLVTYLQEEQLKPLAVLLTHAHFDHIGAVDAVR 68

Query: 73  EDLSLTIIGPHKDDAAMMGKVD---EQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFK 129
           +   + +   HK++   +G       Q  +++  + A+ A  D  +    TL +G+  F+
Sbjct: 69  DAFHIPVY-VHKEEEDWLGDATVNGSQIFMMNRSITAKPA--DHIIDAEGTLAIGSFNFE 125

Query: 130 VFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDE 189
           VF  PGHSPG + Y   E +    GD LF+ SIGRTD+  G + +LI SI  K+  L DE
Sbjct: 126 VFETPGHSPGSISYYCKEASAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKLFVLPDE 185

Query: 190 ISFVCGHGPNSTIGRERRLNPFLK 213
            + +CGHGP ++IG E+  NPFL+
Sbjct: 186 TAVLCGHGPETSIGFEKENNPFLQ 209


>gi|295397618|ref|ZP_06807693.1| beta-lactamase family protein [Aerococcus viridans ATCC 11563]
 gi|294974081|gb|EFG49833.1| beta-lactamase family protein [Aerococcus viridans ATCC 11563]
          Length = 201

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 71/213 (33%), Positives = 115/213 (53%), Gaps = 14/213 (6%)

Query: 6   FHIVQVT--PFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
            H+ Q+T  P +++  F+  + + + +++DPG   + I+ +I     +   I +TH H D
Sbjct: 1   MHVYQLTVGPVQEHPYFIV-KGNKDTLIIDPGDQTETIEQLIAENQLNPVAILLTHAHFD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G    ++E  ++ +   H  +A  +   D+Q R+           +  W + G   + 
Sbjct: 60  HIGAVEDIRERYNIDVW-QHIIEADWLK--DKQTRM-------PKTHTHYWDKMGQQSVA 109

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   FK  H PGHSPG V+Y+  E+ F   GDTLF+ +IGRTD+ HGD   LI  I   +
Sbjct: 110 G-FTFKTAHVPGHSPGSVVYIFEEDGFVVAGDTLFKGTIGRTDLDHGDKDALITGIKRHL 168

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           L L DE+  + GHG  +TIG+E+  NPFL+ N+
Sbjct: 169 LTLRDEMQVLPGHGEITTIGQEKTTNPFLQGNL 201


>gi|160893487|ref|ZP_02074272.1| hypothetical protein CLOL250_01038 [Clostridium sp. L2-50]
 gi|156864882|gb|EDO58313.1| hypothetical protein CLOL250_01038 [Clostridium sp. L2-50]
          Length = 210

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 69/213 (32%), Positives = 110/213 (51%), Gaps = 5/213 (2%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M++L   + Q+     NC  + ++E+ EA+VVDP  + D I   +         I++THG
Sbjct: 1   MAELEVKLYQLGDLGTNCYIVSNQETKEAIVVDPADNADFIYKSLTDAGLTCVGIFLTHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDG-D 119
           H DH+G    L++   LT +  +  +            L ++  +    S+D +LQDG +
Sbjct: 61  HYDHIGALDDLRK---LTGVKAYASEDEKQVLESRTGNLSAMFGHPLETSADIYLQDGQE 117

Query: 120 TLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSI 179
             +LGT + +    PGH+ G + Y   E +    GDTLF SS+GR+D   G+ Q L+ +I
Sbjct: 118 VAVLGT-VVRCISVPGHTVGGMCYYFAEGHLLFTGDTLFASSVGRSDFPTGNEQDLLEAI 176

Query: 180 NNKILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
             K+L L +E +   GH   S IGRE++ NPF 
Sbjct: 177 ETKLLVLPEETAVYPGHNGTSRIGREKKFNPFF 209


>gi|169824505|ref|YP_001692116.1| putative zinc-dependent hydrolase [Finegoldia magna ATCC 29328]
 gi|167831310|dbj|BAG08226.1| putative zinc-dependent hydrolase [Finegoldia magna ATCC 29328]
          Length = 202

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 69/210 (32%), Positives = 107/210 (50%), Gaps = 8/210 (3%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           ++   +  T + +N   L   E  +  VVDPG   D I + I++RN  ++ I ITHGH D
Sbjct: 1   MTLDKIVTTKYGENMYIL--SEDNKCFVVDPGAQADDICEYIKNRNLEIQFILITHGHFD 58

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+  A +LK  L+  I  P K+   +        R +    N    ++D ++++GDT+  
Sbjct: 59  HIFAAEELKNKLNTVIYAPEKEKDLLEDPEKNYTRKVG---NPITLTADYYVKEGDTIEF 115

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
                 V   PGH+ G   Y+  +  F+  GD LF++SIGR D+    Y+ + NSI  K+
Sbjct: 116 NDSKISVLETPGHTYGSCCYIYKDIMFS--GDMLFKNSIGRYDLPTASYEDIKNSI-EKL 172

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
             L D I    GHGP + IG E++ NP+ K
Sbjct: 173 KLLNDNIKVYPGHGPETNIGDEKKYNPYFK 202


>gi|83814910|ref|YP_446192.1| metallo-beta-lactamase family protein [Salinibacter ruber DSM
           13855]
 gi|294508119|ref|YP_003572177.1| metallo-beta-lactamase family protein [Salinibacter ruber M8]
 gi|83756304|gb|ABC44417.1| metallo-beta-lactamase family protein [Salinibacter ruber DSM
           13855]
 gi|294344447|emb|CBH25225.1| metallo-beta-lactamase family protein [Salinibacter ruber M8]
          Length = 216

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 66/194 (34%), Positives = 104/194 (53%), Gaps = 7/194 (3%)

Query: 28  EAVVVDPG----GDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLKEDLSLTIIGPH 83
           EAV+VD       + + +  VI+ +   V+ + +TH HVDH+ G    +E         H
Sbjct: 23  EAVLVDASCETEAECEQVMTVIEEQGLDVQHLLLTHAHVDHIFGCTFFEEAFGQRFKA-H 81

Query: 84  KDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFKVFHCPGHSPGHVIY 143
           +     + + +EQA    + ++  +  +   L +GDT+  G    +V H PGHSP  + +
Sbjct: 82  EAAVPFIERAEEQATAFGVEVDPPSVPT-AHLAEGDTVSFGDVTLEVLHTPGHSPDSISF 140

Query: 144 VNFENNFAHLGDTLFRSSIGRTDIL-HGDYQQLINSINNKILPLGDEISFVCGHGPNSTI 202
           V+     A  GD LF++SIGRT  L      QL+NS+   +LPLGD+++   GHGP +TI
Sbjct: 141 VDRPGRQALTGDVLFQNSIGRTQGLPETSRAQLLNSVTETLLPLGDDVTIYPGHGPATTI 200

Query: 203 GRERRLNPFLKSNI 216
           GRER  NPF++  +
Sbjct: 201 GRERAQNPFVQEAL 214


>gi|228967325|ref|ZP_04128360.1| Metallo-beta-lactamase [Bacillus thuringiensis serovar sotto str.
           T04001]
 gi|228792360|gb|EEM39927.1| Metallo-beta-lactamase [Bacillus thuringiensis serovar sotto str.
           T04001]
          Length = 191

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 63/189 (33%), Positives = 103/189 (54%), Gaps = 6/189 (3%)

Query: 28  EAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLKEDLSLTIIGPHKDDA 87
           E ++ DPG + + +   +Q        + +TH H DH+G    +++   + +   HK++A
Sbjct: 6   ECIIFDPGHEGEKLVTYLQEEQLKPLAVLLTHAHFDHIGAVDAVRDAFYIPVY-VHKEEA 64

Query: 88  AMMGKVD---EQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFKVFHCPGHSPGHVIYV 144
             +G       Q  +++  + A+ A  D  +    TL + +  F++F  PGHSPG + Y 
Sbjct: 65  DWLGDATVNGSQIFMMNRSITAKPA--DHIIDAEGTLTIESFNFEIFETPGHSPGSISYY 122

Query: 145 NFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEISFVCGHGPNSTIGR 204
           + E N    GD LF+ SIGRTD+  G + +LI SI  K+  L DE + +CGHGP ++IG 
Sbjct: 123 SKEANAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKLFVLPDETAVLCGHGPETSIGF 182

Query: 205 ERRLNPFLK 213
           E+  NPFL+
Sbjct: 183 EKENNPFLQ 191


>gi|229157873|ref|ZP_04285948.1| Metallo-beta-lactamase [Bacillus cereus ATCC 4342]
 gi|228625830|gb|EEK82582.1| Metallo-beta-lactamase [Bacillus cereus ATCC 4342]
          Length = 239

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 65/204 (31%), Positives = 110/204 (53%), Gaps = 7/204 (3%)

Query: 13  PFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLK 72
           P + N   L ++++ E ++ DPG + + +   +Q        + +TH H DH+G    ++
Sbjct: 40  PLQTNAYILTNDQN-ECIIFDPGHEGEKLVTYLQEEQLKPLAVLLTHAHFDHIGAVDAVR 98

Query: 73  EDLSLTIIGPHKDDAAMMGKVD---EQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFK 129
           +   + +   HK++   +G       Q  +++  + A+ A  D  +    TL +G+  F+
Sbjct: 99  DAFHIPVY-VHKEEEDWLGDATVNGSQIFMMNRSITAKPA--DHIIDAEGTLAIGSFNFE 155

Query: 130 VFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDE 189
           +F  PGHSPG + Y   E +    GD LF+ SIGRTD+  G + +LI SI  K+  L DE
Sbjct: 156 IFETPGHSPGSISYYCKEASAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKLFVLPDE 215

Query: 190 ISFVCGHGPNSTIGRERRLNPFLK 213
            + +CGHGP ++IG E+  NPFL+
Sbjct: 216 TAVLCGHGPETSIGFEKENNPFLQ 239


>gi|258512472|ref|YP_003185906.1| beta-lactamase domain-containing protein [Alicyclobacillus
           acidocaldarius subsp. acidocaldarius DSM 446]
 gi|257479198|gb|ACV59517.1| beta-lactamase domain protein [Alicyclobacillus acidocaldarius
           subsp. acidocaldarius DSM 446]
          Length = 214

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 76/205 (37%), Positives = 101/205 (49%), Gaps = 7/205 (3%)

Query: 11  VTPFKQNCTFLFD--EESLEAVVVDPGG-DLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           ++P + NC  + +  E    AVV+DPG   LD +   I      +   W THGH DHV G
Sbjct: 8   ISPIQSNCYVIAESWERGANAVVIDPGDLALDPVFSFIDEMGLKLVANWNTHGHFDHVIG 67

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           A +L++   +     H+DD     +     R             D WLQDGD L LG   
Sbjct: 68  ADRLRQRYGVPSY-LHRDDLVTWNRAPHWYRAYLADDAPDLRQPDAWLQDGDELTLGDET 126

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
           F V+H PGHSPG V  V     F+  GDTLF  +IGR D+   D + +  S+  +IL   
Sbjct: 127 FTVWHTPGHSPGSVCLVGKRVVFS--GDTLFAGTIGRVDLEGSDPEAMQASL-KRILEWP 183

Query: 188 DEISFVCGHGPNSTIGRERRLNPFL 212
           DE+    GHGP + +G ERR N FL
Sbjct: 184 DELEIYPGHGPATRMGHERRHNRFL 208


>gi|52141236|ref|YP_085592.1| metallo-beta-lactamase family protein [Bacillus cereus E33L]
 gi|51974705|gb|AAU16255.1| metallo-beta-lactamase family protein [Bacillus cereus E33L]
          Length = 209

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 66/204 (32%), Positives = 110/204 (53%), Gaps = 7/204 (3%)

Query: 13  PFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLK 72
           P + N   L ++++ E V+ DPG + + +   +Q        + +TH H DH+G    ++
Sbjct: 10  PLQTNAYILKNDQN-ECVIFDPGHEGEKLVTYLQEEQLKPLAVLLTHAHFDHIGAVDTVR 68

Query: 73  EDLSLTIIGPHKDDAAMMGKVD---EQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFK 129
           +   + +   HK++   +G       Q  +++  + A+ A  D  +    TL +G+  F+
Sbjct: 69  DAFHIPVY-VHKEEEDWLGDATVNGSQIFMMNRSITAKPA--DHIIDAEGTLAIGSFNFE 125

Query: 130 VFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDE 189
           +F  PGHSPG + Y   E +    GD LF+ SIGRTD+  G + +LI SI  K+  L DE
Sbjct: 126 IFETPGHSPGSISYYCKEASAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKLFVLPDE 185

Query: 190 ISFVCGHGPNSTIGRERRLNPFLK 213
            + +CGHGP ++IG E+  NPFL+
Sbjct: 186 TAVLCGHGPETSIGFEKENNPFLQ 209


>gi|302038659|ref|YP_003798981.1| putative beta-lactamase-like hydrolase [Candidatus Nitrospira
           defluvii]
 gi|300606723|emb|CBK43056.1| putative Hydrolase, beta-lactamase-like [Candidatus Nitrospira
           defluvii]
          Length = 209

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 66/203 (32%), Positives = 101/203 (49%), Gaps = 2/203 (0%)

Query: 11  VTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQ 70
           V P   NC+ + D  + +A+VVDPGG  + I   +++    V  I  TH H DH   +  
Sbjct: 8   VPPLGCNCSIIGDPITKQAIVVDPGGAPERILQEVRAMGLTVVSIVHTHAHFDHFLASGA 67

Query: 71  LKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFKV 130
           +K+     +   H DD  +   ++ Q R+  +         D WL+D + L +G      
Sbjct: 68  MKQATGAALCL-HPDDFPLWDILEMQCRMFGVPY-VPAPPPDYWLKDEERLAIGELEGIA 125

Query: 131 FHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEI 190
            H PGH+PG + +          GDTLFR  IGRTD+  GD+  +  SI  ++  L ++ 
Sbjct: 126 LHTPGHTPGSMCFHFPAAKVVLAGDTLFRGGIGRTDLWGGDFDAIEQSIRERLYTLDEQT 185

Query: 191 SFVCGHGPNSTIGRERRLNPFLK 213
           + V GHGP + IGRER  N F++
Sbjct: 186 AVVTGHGPETEIGRERETNSFVR 208


>gi|284048849|ref|YP_003399188.1| beta-lactamase domain-containing protein [Acidaminococcus
           fermentans DSM 20731]
 gi|283953070|gb|ADB47873.1| beta-lactamase domain-containing protein [Acidaminococcus
           fermentans DSM 20731]
          Length = 207

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 68/211 (32%), Positives = 111/211 (52%), Gaps = 5/211 (2%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFH-VKQIWITHGHV 62
           +  + V V P ++NC  + +E + + ++VDPG + + I D +       V  I+ITHGH 
Sbjct: 1   MKIYRVVVGPIQENCYIIKNEANNQGIIVDPGDEANRIMDAVAKAGIEKVPAIFITHGHG 60

Query: 63  DHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLL 122
           DHV    ++K      +    ++DA M+ +V   +   S   + +    D +  DG+ L 
Sbjct: 61  DHVSALDEVKAATCAKVYM-SREDAPML-RVWNSSLSYSTNRDKKFDPPDEYFTDGEKLN 118

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
           +    F +   PGH+ G V  +   +     GDT+F  SIGRTD+  G Y  +++SI  K
Sbjct: 119 VAGMDFTIAATPGHTAGGVCIIG--DGVVFCGDTVFLESIGRTDLPGGSYDAILDSIKTK 176

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           +L L D+   + GHGP +T+G E+R NPFL+
Sbjct: 177 LLVLPDDYKLLPGHGPATTVGWEKRRNPFLQ 207


>gi|308275026|emb|CBX31625.1| hypothetical protein N47_E51370 [uncultured Desulfobacterium sp.]
          Length = 189

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 70/203 (34%), Positives = 100/203 (49%), Gaps = 20/203 (9%)

Query: 11  VTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQ 70
           + P++ NC  L    + + +++DPGG+   I  V+   N +++ I +TH H DH  GA +
Sbjct: 7   INPYQSNCYILGCNNTKQGLIIDPGGEPLRIIKVVTQLNLNIRYILLTHFHFDHTSGANE 66

Query: 71  LKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFKV 130
           ++ +++   +  HK DA  +                 +   D  + DG  + LG     V
Sbjct: 67  IR-NITKAPVWIHKLDAQGL-----------------DFKPDGDIADGQIIALGNFNITV 108

Query: 131 FHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEI 190
            H PGHSPG V +          GD LF  S+GRTD   GD+  LI  I  KI PLGD +
Sbjct: 109 IHTPGHSPGGVCF--HAPGVVFTGDALFAGSVGRTDFSGGDHNGLIRGIKQKIFPLGDGL 166

Query: 191 SFVCGHGPNSTIGRERRLNPFLK 213
               GHGP STIG ER  NPF +
Sbjct: 167 RVYPGHGPQSTIGHERTTNPFFR 189


>gi|228935582|ref|ZP_04098398.1| Metallo-beta-lactamase [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|228824120|gb|EEM69936.1| Metallo-beta-lactamase [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
          Length = 221

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 66/204 (32%), Positives = 110/204 (53%), Gaps = 7/204 (3%)

Query: 13  PFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLK 72
           P + N   L ++++ E V+ DPG + + +   +Q        + +TH H DH+G    ++
Sbjct: 22  PLQTNAYILKNDQN-ECVIFDPGHEGEKLVTYLQEEQLKPLAVLLTHAHFDHIGAVDAVR 80

Query: 73  EDLSLTIIGPHKDDAAMMGKVD---EQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFK 129
           +   + +   HK++   +G       Q  +++  + A+ A  D  +    TL +G+  F+
Sbjct: 81  DAFHIPVY-VHKEEEDWLGDATVNGSQIFMMNRSITAKPA--DHIIDAEGTLAIGSFNFE 137

Query: 130 VFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDE 189
           +F  PGHSPG + Y   E +    GD LF+ SIGRTD+  G + +LI SI  K+  L DE
Sbjct: 138 IFETPGHSPGSISYYCKEASAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKLFVLPDE 197

Query: 190 ISFVCGHGPNSTIGRERRLNPFLK 213
            + +CGHGP ++IG E+  NPFL+
Sbjct: 198 TAVLCGHGPETSIGFEKENNPFLQ 221


>gi|226227392|ref|YP_002761498.1| hydrolase [Gemmatimonas aurantiaca T-27]
 gi|226090583|dbj|BAH39028.1| hydrolase [Gemmatimonas aurantiaca T-27]
          Length = 220

 Score =  119 bits (298), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 70/210 (33%), Positives = 110/210 (52%), Gaps = 5/210 (2%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L    + V P ++NC  L D  S +AV+VDPG +++ +   + +    ++ IW+TH H D
Sbjct: 8   LKVQQLTVGPLEENCWLLADPASGKAVLVDPGDEVERLLAAVDATGCTLEAIWLTHAHFD 67

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG  A L  +  + +   H  D  + G     A    I +     +++  L +G  + L
Sbjct: 68  HVGAVAPLLRERPVPVWL-HPLDLPLYGNAATSAARWGISIETPTGATEP-LAEGSVVSL 125

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   F+V+H PGH+PGHV ++   +     GD +F  SIGRTD+   D + +  S+  +I
Sbjct: 126 GRFQFEVWHVPGHAPGHVAFLG--HGLCISGDLVFAGSIGRTDLPLCDPRAMQASL-MRI 182

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
             L D    + GHG  +TIG+ER  NPFL+
Sbjct: 183 TTLDDGTRVLPGHGVTTTIGQERLSNPFLR 212


>gi|220918723|ref|YP_002494027.1| beta-lactamase domain protein [Anaeromyxobacter dehalogenans 2CP-1]
 gi|219956577|gb|ACL66961.1| beta-lactamase domain protein [Anaeromyxobacter dehalogenans 2CP-1]
          Length = 218

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 71/205 (34%), Positives = 99/205 (48%), Gaps = 2/205 (0%)

Query: 11  VTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQ 70
           V PF  NC       + EAV+VDPG ++     +     + + +I+ THGH+DHVGG A+
Sbjct: 9   VGPFAANCWLAACGRTGEAVLVDPGAEVHRALALADPSGWRITRIFCTHGHIDHVGGGAE 68

Query: 71  LKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFKV 130
            +      +   H  D A +  +  QA +            D    DG+   +G    +V
Sbjct: 69  ARAATGAPLQ-IHAADDAWLAALPRQAEMFGFD-PVEAPEVDHHHVDGEAFRVGDCEAQV 126

Query: 131 FHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEI 190
            H PGHS G              GDTLF  S+GRTD+  GD+  L  SI  ++ PLGD +
Sbjct: 127 IHTPGHSAGSCSLWFPGEQILFTGDTLFAGSVGRTDLPGGDFDALERSIKERLFPLGDAV 186

Query: 191 SFVCGHGPNSTIGRERRLNPFLKSN 215
            F  GHGP  T+G ERR NPF+  +
Sbjct: 187 RFHPGHGPAGTLGEERRANPFVGES 211


>gi|29346556|ref|NP_810059.1| putative metallo-beta-lactamase [Bacteroides thetaiotaomicron
           VPI-5482]
 gi|29338452|gb|AAO76253.1| putative metallo-beta-lactamase [Bacteroides thetaiotaomicron
           VPI-5482]
          Length = 203

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 67/204 (32%), Positives = 108/204 (52%), Gaps = 6/204 (2%)

Query: 14  FKQNCTFLFDEESLEAVVVDPGG----DLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAA 69
           F  NC  L+D+ + EAVV+DPG     +   +K  I +    VK +  TH H+DH+ G  
Sbjct: 2   FPVNCYVLWDD-TKEAVVIDPGCFYEEEKQALKKFILTNELTVKHLLNTHLHLDHIFGNP 60

Query: 70  QLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFK 129
            + ++  L+    +K D   + +  +Q+R+   ++        ++L DGD +  G    +
Sbjct: 61  FMLKEFGLSAEA-NKADEFWIDEAPKQSRMFGFQLQEEPVPLGKYLHDGDIITFGHTKLE 119

Query: 130 VFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDE 189
             H PGHSPG ++Y   E N    GD LF+ SIGR D+  G++ +LI+ I +++  L +E
Sbjct: 120 AIHVPGHSPGSLVYYCKEENCMFSGDVLFQGSIGRADLSGGNFDELIDHICSRLFVLPNE 179

Query: 190 ISFVCGHGPNSTIGRERRLNPFLK 213
                GHG  +TIG E+  NPF +
Sbjct: 180 TVVYPGHGAPTTIGMEKAENPFFR 203


>gi|228916895|ref|ZP_04080457.1| Metallo-beta-lactamase [Bacillus thuringiensis serovar pulsiensis
           BGSC 4CC1]
 gi|228929306|ref|ZP_04092331.1| Metallo-beta-lactamase [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|228830320|gb|EEM75932.1| Metallo-beta-lactamase [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|228842719|gb|EEM87805.1| Metallo-beta-lactamase [Bacillus thuringiensis serovar pulsiensis
           BGSC 4CC1]
          Length = 239

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 66/204 (32%), Positives = 110/204 (53%), Gaps = 7/204 (3%)

Query: 13  PFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLK 72
           P + N   L ++++ E V+ DPG + + +   +Q        + +TH H DH+G    ++
Sbjct: 40  PLQTNAYILKNDKN-ECVIFDPGHEGEKLVTYLQEEQLKPLAVLLTHAHFDHIGAVDAVR 98

Query: 73  EDLSLTIIGPHKDDAAMMGKVD---EQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFK 129
           +   + +   HK++   +G       Q  +++  + A+ A  D  +    TL +G+  F+
Sbjct: 99  DAFHIPVY-VHKEEEDWLGDATVNGSQIFMMNRSITAKPA--DHIIDAEGTLAIGSFNFE 155

Query: 130 VFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDE 189
           +F  PGHSPG + Y   E +    GD LF+ SIGRTD+  G + +LI SI  K+  L DE
Sbjct: 156 IFETPGHSPGSISYYCKEASAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKLFVLPDE 215

Query: 190 ISFVCGHGPNSTIGRERRLNPFLK 213
            + +CGHGP ++IG E+  NPFL+
Sbjct: 216 TAVLCGHGPETSIGFEKENNPFLQ 239


>gi|255008943|ref|ZP_05281069.1| putative metallo-beta-lactamase [Bacteroides fragilis 3_1_12]
 gi|313146686|ref|ZP_07808879.1| conserved hypothetical protein [Bacteroides fragilis 3_1_12]
 gi|313135453|gb|EFR52813.1| conserved hypothetical protein [Bacteroides fragilis 3_1_12]
          Length = 212

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 67/204 (32%), Positives = 108/204 (52%), Gaps = 6/204 (2%)

Query: 14  FKQNCTFLFDEESLEAVVVDPGGDLD----IIKDVIQSRNFHVKQIWITHGHVDHVGGAA 69
           F  NC  L+DE + EAVV+DPG   D     +K+ I + + +VK +  TH H+DH+ G  
Sbjct: 11  FPVNCYVLWDETN-EAVVIDPGCFYDEEKQALKNFIVTNHLNVKHLLNTHLHLDHIFGNP 69

Query: 70  QLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFK 129
            +  +  L+    ++ D   + +  +Q+R+   ++N       ++L DGD +  G    +
Sbjct: 70  FMLREFGLSAEA-NQADEYWIDEAPKQSRMFGFQLNEAPVPLGKYLHDGDIITFGNTTLE 128

Query: 130 VFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDE 189
             H PGHSPG ++Y     N    GD LF+ SIGR D+  G++ +L   I +++  L +E
Sbjct: 129 AIHVPGHSPGSLVYYCQAENCMFSGDVLFQGSIGRADLTGGNFDELKEHICSRLFVLPNE 188

Query: 190 ISFVCGHGPNSTIGRERRLNPFLK 213
                GHG  +TIG E+  NPF +
Sbjct: 189 TIVYPGHGAPTTIGIEKAENPFFR 212


>gi|253568082|ref|ZP_04845493.1| conserved hypothetical protein [Bacteroides sp. 1_1_6]
 gi|298387714|ref|ZP_06997265.1| metallo-beta-lactamase family protein [Bacteroides sp. 1_1_14]
 gi|251842155|gb|EES70235.1| conserved hypothetical protein [Bacteroides sp. 1_1_6]
 gi|298259570|gb|EFI02443.1| metallo-beta-lactamase family protein [Bacteroides sp. 1_1_14]
          Length = 212

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 67/204 (32%), Positives = 108/204 (52%), Gaps = 6/204 (2%)

Query: 14  FKQNCTFLFDEESLEAVVVDPGG----DLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAA 69
           F  NC  L+D+ + EAVV+DPG     +   +K  I +    VK +  TH H+DH+ G  
Sbjct: 11  FPVNCYVLWDD-TKEAVVIDPGCFYEEEKQALKKFILTNELTVKHLLNTHLHLDHIFGNP 69

Query: 70  QLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFK 129
            + ++  L+    +K D   + +  +Q+R+   ++        ++L DGD +  G    +
Sbjct: 70  FMLKEFGLSAEA-NKADEFWIDEAPKQSRMFGFQLQEEPVPLGKYLHDGDIITFGHTKLE 128

Query: 130 VFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDE 189
             H PGHSPG ++Y   E N    GD LF+ SIGR D+  G++ +LI+ I +++  L +E
Sbjct: 129 AIHVPGHSPGSLVYYCKEENCMFSGDVLFQGSIGRADLSGGNFDELIDHICSRLFVLPNE 188

Query: 190 ISFVCGHGPNSTIGRERRLNPFLK 213
                GHG  +TIG E+  NPF +
Sbjct: 189 TVVYPGHGAPTTIGMEKAENPFFR 212


>gi|196035030|ref|ZP_03102437.1| metallo-beta-lactamase family protein [Bacillus cereus W]
 gi|218905397|ref|YP_002453231.1| metallo-beta-lactamase family protein [Bacillus cereus AH820]
 gi|254721855|ref|ZP_05183644.1| metallo-beta-lactamase family protein [Bacillus anthracis str.
           A1055]
 gi|195992569|gb|EDX56530.1| metallo-beta-lactamase family protein [Bacillus cereus W]
 gi|218535728|gb|ACK88126.1| metallo-beta-lactamase family protein [Bacillus cereus AH820]
          Length = 209

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 66/204 (32%), Positives = 110/204 (53%), Gaps = 7/204 (3%)

Query: 13  PFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLK 72
           P + N   L ++++ E V+ DPG + + +   +Q        + +TH H DH+G    ++
Sbjct: 10  PLQTNAYILKNDKN-ECVIFDPGHEGEKLVTYLQEEQLKPLAVLLTHAHFDHIGAVDAVR 68

Query: 73  EDLSLTIIGPHKDDAAMMGKVD---EQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFK 129
           +   + +   HK++   +G       Q  +++  + A+ A  D  +    TL +G+  F+
Sbjct: 69  DAFHIPVY-VHKEEEDWLGDATVNGSQIFMMNRSITAKPA--DHIIDAEGTLAIGSFNFE 125

Query: 130 VFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDE 189
           +F  PGHSPG + Y   E +    GD LF+ SIGRTD+  G + +LI SI  K+  L DE
Sbjct: 126 IFETPGHSPGSISYYCKEASAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKLFVLPDE 185

Query: 190 ISFVCGHGPNSTIGRERRLNPFLK 213
            + +CGHGP ++IG E+  NPFL+
Sbjct: 186 TAVLCGHGPETSIGFEKENNPFLQ 209


>gi|229013481|ref|ZP_04170618.1| Metallo-beta-lactamase [Bacillus mycoides DSM 2048]
 gi|228747893|gb|EEL97759.1| Metallo-beta-lactamase [Bacillus mycoides DSM 2048]
          Length = 209

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 65/204 (31%), Positives = 110/204 (53%), Gaps = 7/204 (3%)

Query: 13  PFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLK 72
           P + N   L ++++ E ++ DPG + + +   +Q        + +TH H DH+G    ++
Sbjct: 10  PLQTNAYILTNDQN-ECIIFDPGHEGEKLVTYLQEAQLKPLAVLLTHAHFDHIGAVDAVR 68

Query: 73  EDLSLTIIGPHKDDAAMMGKVD---EQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFK 129
           +   + +   HK++A  +G       Q  +++  + A+ A  D  +    TL +G+  F+
Sbjct: 69  DAFHIPVY-VHKEEADWLGDATVNGSQIFMMNRSITAKPA--DHIIDAEGTLTIGSFSFE 125

Query: 130 VFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDE 189
           +F  PGHSPG + Y +   N    GD LF+ SIGRTD+  G + +LI SI  K+  L DE
Sbjct: 126 IFETPGHSPGSISYYSKAANAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKLFVLPDE 185

Query: 190 ISFVCGHGPNSTIGRERRLNPFLK 213
            + +CGHGP ++I  E+  NPFL+
Sbjct: 186 TAVLCGHGPETSIRFEKENNPFLQ 209


>gi|301055754|ref|YP_003793965.1| metallo-beta-lactamase family protein [Bacillus anthracis CI]
 gi|300377923|gb|ADK06827.1| metallo-beta-lactamase family protein [Bacillus cereus biovar
           anthracis str. CI]
          Length = 209

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 66/204 (32%), Positives = 109/204 (53%), Gaps = 7/204 (3%)

Query: 13  PFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLK 72
           P + N   L ++++ E V+ DPG + + +   +Q        + +TH H DH+G    ++
Sbjct: 10  PLQTNAYILKNDQN-ECVIFDPGHEGEKLVTYLQEEQLKPLAVLLTHAHFDHIGAVDAVR 68

Query: 73  EDLSLTIIGPHKDDAAMMGKVD---EQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFK 129
           E   + +   HK++   +G       Q  +++  + A+ A  D  +     L +G+  F+
Sbjct: 69  EAFHIPVY-VHKEEEDWLGDATVNGSQIFMMNRSITAKPA--DHIIDAEGKLAIGSFNFE 125

Query: 130 VFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDE 189
           +F  PGHSPG + Y   E +    GD LF+ SIGRTD+  G + +LI SI  K+  L DE
Sbjct: 126 IFETPGHSPGSISYYCKEASAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKLFVLPDE 185

Query: 190 ISFVCGHGPNSTIGRERRLNPFLK 213
            + +CGHGP ++IG E+  NPFL+
Sbjct: 186 TAVLCGHGPETSIGFEKENNPFLQ 209


>gi|310658607|ref|YP_003936328.1| beta-lactamase domain-containing protein [Clostridium sticklandii
           DSM 519]
 gi|308825385|emb|CBH21423.1| Beta-lactamase domain protein [Clostridium sticklandii]
          Length = 211

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 68/205 (33%), Positives = 115/205 (56%), Gaps = 5/205 (2%)

Query: 9   VQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGA 68
           ++V  ++ NC  + D+ S+ A V+DPG D + I+D+I+   F +K I +TH H DH+G  
Sbjct: 6   LEVGVYRVNCYVIADKNSMSAAVIDPGADFENIRDIIEDNGFDLKYIILTHAHGDHIGAI 65

Query: 69  AQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIF 128
             LK+  +  I+  + +   +       ++ L   MN+ ++++D  L DGDTL LG    
Sbjct: 66  NYLKDTYNPKIVIHYLEKEILENPDYNFSKQLG--MNSVSSNADLMLHDGDTLELGDLKL 123

Query: 129 KVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGD 188
           ++ H PGH+ G +  +  E  F+  GDTLF  S+GRTD+  GD  ++  S+  K+  L  
Sbjct: 124 EIMHTPGHTKGSMCILVNEIMFS--GDTLFAGSMGRTDLYSGDSDRMKASL-KKLKQLTI 180

Query: 189 EISFVCGHGPNSTIGRERRLNPFLK 213
             + + GHG  +T+  E+  NPF++
Sbjct: 181 NYTVLPGHGAATTLEYEKTSNPFMR 205


>gi|164687519|ref|ZP_02211547.1| hypothetical protein CLOBAR_01160 [Clostridium bartlettii DSM
           16795]
 gi|164603293|gb|EDQ96758.1| hypothetical protein CLOBAR_01160 [Clostridium bartlettii DSM
           16795]
          Length = 207

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 71/207 (34%), Positives = 110/207 (53%), Gaps = 21/207 (10%)

Query: 16  QNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLKEDL 75
           +N   L DE++ +  V+DPGG +  I ++I+     V+ I +THGH DH+    ++K   
Sbjct: 13  ENTYILGDEKTKKCAVIDPGGSIIDIFNIIKQHGLTVEYIILTHGHGDHICRVPEIKS-- 70

Query: 76  SLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNA--------SSDRWLQDGDTLLLGTHI 127
                   K +A ++  V+E+  L+    N             +D ++Q+GD + LG+  
Sbjct: 71  --------KTNAKIVAHVNEEEVLIDRNKNLSAQLPGPLVEFDADEYVQEGDIIELGSLK 122

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
            KV H PGH+ G +     E+ F   GDTLF  SIGRTD   GDY+Q++ S+  K+    
Sbjct: 123 LKVIHTPGHTKGGMCIKVGEHIFT--GDTLFAGSIGRTDFYGGDYKQIMKSL-RKLAKYD 179

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLKS 214
           D      GHGP STIG E+R+NP+++ 
Sbjct: 180 DNAVVYPGHGPTSTIGVEKRMNPYMQQ 206


>gi|308070715|ref|YP_003872320.1| hypothetical protein PPE_04002 [Paenibacillus polymyxa E681]
 gi|305859994|gb|ADM71782.1| Conserved hypothetical protein [Paenibacillus polymyxa E681]
          Length = 209

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 67/211 (31%), Positives = 110/211 (52%), Gaps = 5/211 (2%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           LS     + P + N   L  ++   AV++DPG +   +   I+     ++ I +TH H D
Sbjct: 3   LSIRSFNLGPLQTNAYLLQGDDPQRAVIIDPGMNPGPLLRAIEP--LTIEAILLTHAHFD 60

Query: 64  HVGGAAQLKEDLSLTI-IGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLL 122
           H+GG  +++      + +   + D     K++                ++  L +G  L 
Sbjct: 61  HIGGVEEIRNTKGCPVYLHALEQDWLTSPKLNGSLMWPEASPPISTEPAEYDLAEGQQLH 120

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
           L  H FKVFH PGHSPG V ++  ++ F+  GD LFR  +GRTD+  G  + L +SI NK
Sbjct: 121 LIGHTFKVFHTPGHSPGSVSFLCGKDLFS--GDVLFRQGVGRTDLTGGRERDLYDSIQNK 178

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           + PLGD+++   GHGP ++IG E+  NP+++
Sbjct: 179 LFPLGDDVTVYSGHGPKTSIGYEKANNPYIR 209


>gi|85858796|ref|YP_460998.1| hydroxyacylglutathione hydrolase W [Syntrophus aciditrophicus SB]
 gi|85721887|gb|ABC76830.1| hydroxyacylglutathione hydrolase W [Syntrophus aciditrophicus SB]
          Length = 257

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 75/210 (35%), Positives = 110/210 (52%), Gaps = 11/210 (5%)

Query: 9   VQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGA 68
           +QV         + D E+ +A+V+DP  ++D I    +  N  +K I  THGH+DH+ G 
Sbjct: 54  MQVGSMAVFAYLVGDSETGDALVIDPADNIDGILATAEKNNLRIKYIVNTHGHIDHISGN 113

Query: 69  AQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIF 128
            ++K      II  H+ DA M+G  +    LL +     +  +D  ++DGDT+ +G    
Sbjct: 114 REMKSRTDAPII-IHEGDARMLG--NTSPMLLHMFGAEDSPPADMTVKDGDTITVGKISL 170

Query: 129 KVFHCPGHSPGHV-IYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
           KV H PGHSPG + +Y+     F   GDTLF  S+GRTD+      Q+  SI  K+L L 
Sbjct: 171 KVIHTPGHSPGGMCLYI---KGFVFTGDTLFVESVGRTDLNGSSASQMFRSIREKLLTLP 227

Query: 188 DEISFVCGHG----PNSTIGRERRLNPFLK 213
           D+   + GH       STIG E+  NPFL+
Sbjct: 228 DDTQVLPGHNYGRTSTSTIGHEKIYNPFLQ 257


>gi|229123800|ref|ZP_04252994.1| Metallo-beta-lactamase [Bacillus cereus 95/8201]
 gi|228659621|gb|EEL15267.1| Metallo-beta-lactamase [Bacillus cereus 95/8201]
          Length = 221

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 66/204 (32%), Positives = 110/204 (53%), Gaps = 7/204 (3%)

Query: 13  PFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLK 72
           P + N   L ++++ E V+ DPG + + +   +Q        + +TH H DH+G    ++
Sbjct: 22  PLQTNAYILKNDKN-ECVIFDPGHEGEKLVTYLQEEQLKPLAVLLTHAHFDHIGAVDAVR 80

Query: 73  EDLSLTIIGPHKDDAAMMGKVD---EQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFK 129
           +   + +   HK++   +G       Q  +++  + A+ A  D  +    TL +G+  F+
Sbjct: 81  DAFHIPVY-VHKEEEDWLGDATVNGSQIFMMNRSITAKPA--DHIIDAEGTLAIGSFNFE 137

Query: 130 VFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDE 189
           +F  PGHSPG + Y   E +    GD LF+ SIGRTD+  G + +LI SI  K+  L DE
Sbjct: 138 IFETPGHSPGSISYYCKEASAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKLFVLPDE 197

Query: 190 ISFVCGHGPNSTIGRERRLNPFLK 213
            + +CGHGP ++IG E+  NPFL+
Sbjct: 198 TAVLCGHGPETSIGFEKENNPFLQ 221


>gi|228987509|ref|ZP_04147628.1| Metallo-beta-lactamase [Bacillus thuringiensis serovar tochigiensis
           BGSC 4Y1]
 gi|228772241|gb|EEM20688.1| Metallo-beta-lactamase [Bacillus thuringiensis serovar tochigiensis
           BGSC 4Y1]
          Length = 239

 Score =  119 bits (297), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 65/204 (31%), Positives = 109/204 (53%), Gaps = 7/204 (3%)

Query: 13  PFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLK 72
           P + N   L ++++ E ++ DPG + +     +Q        + +TH H DH+G    ++
Sbjct: 40  PLQTNAYILTNDQN-ECIIFDPGHEGEKFVTYLQEEQLKPLAVLLTHAHFDHIGAVDAVR 98

Query: 73  EDLSLTIIGPHKDDAAMMGKVD---EQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFK 129
           +   + +   HK++   +G       Q  +++  + A+ A  D  +    TL +G+  F+
Sbjct: 99  DAFHIPVY-VHKEEEDWLGDATVNGSQIFMMNRSITAKPA--DHIIDAEGTLAIGSFNFE 155

Query: 130 VFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDE 189
           +F  PGHSPG + Y   E +    GD LF+ SIGRTD+  G + +LI SI  K+  L DE
Sbjct: 156 IFETPGHSPGSISYYCKEASAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKLFVLPDE 215

Query: 190 ISFVCGHGPNSTIGRERRLNPFLK 213
            + +CGHGP ++IG E+  NPFL+
Sbjct: 216 TAVLCGHGPETSIGFEKENNPFLQ 239


>gi|268315818|ref|YP_003289537.1| beta-lactamase domain-containing protein [Rhodothermus marinus DSM
           4252]
 gi|262333352|gb|ACY47149.1| beta-lactamase domain protein [Rhodothermus marinus DSM 4252]
          Length = 215

 Score =  119 bits (297), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 70/213 (32%), Positives = 110/213 (51%), Gaps = 8/213 (3%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPG----GDLDIIKDVIQSRNFHVKQIWITH 59
           +  H     PF+ NC    D +  EAV++DP      +   + D ++     ++ + +TH
Sbjct: 1   MKIHRFTFNPFQTNCYICHDGD--EAVLIDPSCHTRAEQQAVVDYLERNGLRLRHLLLTH 58

Query: 60  GHVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGD 119
           GH+DH+ G     E  +      H+ D   + + + Q +   + +         +L +GD
Sbjct: 59  GHIDHIFGCRFFSE-YAGKGFWMHRADVPFLEQAEAQGQFFGVSVEPPPPPEG-FLDEGD 116

Query: 120 TLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSI 179
           T+  G   + V H PGHSPG + + + ++    +GD LF+ SIGRTD+  G    L+ SI
Sbjct: 117 TITFGQTTWTVLHTPGHSPGSISFYDEKHKLVIVGDVLFQGSIGRTDLPGGSLPVLMQSI 176

Query: 180 NNKILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
             K++PLGD+     GHGP +TIGRERR NPFL
Sbjct: 177 FQKLVPLGDDTRVYPGHGPETTIGRERRHNPFL 209


>gi|319947809|ref|ZP_08022003.1| hydrolase [Dietzia cinnamea P4]
 gi|319438533|gb|EFV93459.1| hydrolase [Dietzia cinnamea P4]
          Length = 221

 Score =  119 bits (297), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 76/214 (35%), Positives = 115/214 (53%), Gaps = 19/214 (8%)

Query: 14  FKQNCTFLFDEESLEAVVVDPGGDLD-IIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLK 72
           F+ NC ++  +++ + V+VDPG D +  ++  I       + + +THGH+DH+  A Q+ 
Sbjct: 11  FQTNC-YIVSDDAGDCVIVDPGQDAEEQVRRQISEAGLRPRAVLLTHGHLDHIWNARQVA 69

Query: 73  EDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNA-------RNASSDRWLQDGDTLLLGT 125
           +   +     H DD  M+    +  + LS+ ++A          +    + DGDTL  G+
Sbjct: 70  DHYRVPAY-IHPDDRPMLS---DPGKGLSLDLSAMLKDMTFTEPAEVVEVFDGDTLRFGS 125

Query: 126 HIFKVFHCPGHSPGHV---IYVNFENNFAHL---GDTLFRSSIGRTDILHGDYQQLINSI 179
             F V H PGHSPG V   I V  E     +   GD LF+  +GRTD+  GD + L+ SI
Sbjct: 126 MTFDVDHAPGHSPGSVSFRITVQTEEGPRMVVLGGDVLFQDGVGRTDLPAGDTEVLMQSI 185

Query: 180 NNKILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
             K L L D+   + GHGP++TIGRERR NPFL+
Sbjct: 186 AKKFLVLDDDAVVLPGHGPSTTIGRERRSNPFLR 219


>gi|163814887|ref|ZP_02206275.1| hypothetical protein COPEUT_01038 [Coprococcus eutactus ATCC 27759]
 gi|158449826|gb|EDP26821.1| hypothetical protein COPEUT_01038 [Coprococcus eutactus ATCC 27759]
          Length = 218

 Score =  119 bits (297), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 65/215 (30%), Positives = 116/215 (53%), Gaps = 5/215 (2%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M++L+    ++  F+ NC  + + ++ EA+V+DP  +   IK  +  R      I++THG
Sbjct: 6   MAELNIDAYELGGFQTNCYIVSNADTGEAIVIDPSWNAAFIKGRLDERKLKCVGIYLTHG 65

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMG--KVDEQARLLSIRMNARNASSDRWLQDG 118
           H+DH+    +++E L+       +D+  ++G  KV+  A + ++        +D +L +G
Sbjct: 66  HIDHMAAMDEIRE-LTGAPTYASEDEEEVLGSSKVNLSAMMTAVFGKVVETKADNYLTEG 124

Query: 119 DTL-LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLIN 177
           D   +LGT + +    PGH+ G + Y   E +    GDTLF+ S+GR+D   GD   L+ 
Sbjct: 125 DVKKILGTEM-RCISVPGHTKGGMCYYFDEQHILFSGDTLFKYSVGRSDFPTGDEHALLE 183

Query: 178 SINNKILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           +I  K+  L D+     GHG  + IG+E+++NPF 
Sbjct: 184 NIREKLFVLPDDTVVYPGHGDKTQIGKEKKMNPFF 218


>gi|331662342|ref|ZP_08363265.1| putative Metallo-beta-lactamase [Escherichia coli TA143]
 gi|331060764|gb|EGI32728.1| putative Metallo-beta-lactamase [Escherichia coli TA143]
          Length = 120

 Score =  119 bits (297), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 51/107 (47%), Positives = 75/107 (70%)

Query: 110 SSDRWLQDGDTLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILH 169
           + DRWL +GDT+ +G    +V HCPGH+PGHV++ +        GD +F+  +GR+D   
Sbjct: 11  TPDRWLNEGDTISIGNVALQVLHCPGHTPGHVVFFDDRAKLLISGDVIFKGGVGRSDFPR 70

Query: 170 GDYQQLINSINNKILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           GD+ QLI+SI +K+LPLGD+++F+ GHGP ST+G ER  NPFL+  +
Sbjct: 71  GDHNQLISSIKDKLLPLGDDVTFIPGHGPLSTLGYERLHNPFLQDEM 117


>gi|30264333|ref|NP_846710.1| metallo-beta-lactamase family protein [Bacillus anthracis str.
           Ames]
 gi|47529780|ref|YP_021129.1| metallo-beta-lactamase family protein [Bacillus anthracis str.
           'Ames Ancestor']
 gi|49187160|ref|YP_030412.1| metallo-beta-lactamase family protein [Bacillus anthracis str.
           Sterne]
 gi|165872070|ref|ZP_02216710.1| metallo-beta-lactamase family protein [Bacillus anthracis str.
           A0488]
 gi|167634677|ref|ZP_02392997.1| metallo-beta-lactamase family protein [Bacillus anthracis str.
           A0442]
 gi|167638646|ref|ZP_02396922.1| metallo-beta-lactamase family protein [Bacillus anthracis str.
           A0193]
 gi|170687412|ref|ZP_02878629.1| metallo-beta-lactamase family protein [Bacillus anthracis str.
           A0465]
 gi|170707422|ref|ZP_02897876.1| metallo-beta-lactamase family protein [Bacillus anthracis str.
           A0389]
 gi|177655038|ref|ZP_02936704.1| metallo-beta-lactamase family protein [Bacillus anthracis str.
           A0174]
 gi|190566061|ref|ZP_03018980.1| metallo-beta-lactamase family protein [Bacillus anthracis
           Tsiankovskii-I]
 gi|227817036|ref|YP_002817045.1| metallo-beta-lactamase family protein [Bacillus anthracis str. CDC
           684]
 gi|229603832|ref|YP_002868551.1| metallo-beta-lactamase family protein [Bacillus anthracis str.
           A0248]
 gi|254684020|ref|ZP_05147880.1| metallo-beta-lactamase family protein [Bacillus anthracis str.
           CNEVA-9066]
 gi|254736369|ref|ZP_05194075.1| metallo-beta-lactamase family protein [Bacillus anthracis str.
           Western North America USA6153]
 gi|254741406|ref|ZP_05199093.1| metallo-beta-lactamase family protein [Bacillus anthracis str.
           Kruger B]
 gi|254753958|ref|ZP_05205993.1| metallo-beta-lactamase family protein [Bacillus anthracis str.
           Vollum]
 gi|254757829|ref|ZP_05209856.1| metallo-beta-lactamase family protein [Bacillus anthracis str.
           Australia 94]
 gi|30258978|gb|AAP28196.1| metallo-beta-lactamase family protein [Bacillus anthracis str.
           Ames]
 gi|47504928|gb|AAT33604.1| metallo-beta-lactamase family protein [Bacillus anthracis str.
           'Ames Ancestor']
 gi|49181087|gb|AAT56463.1| metallo-beta-lactamase family protein [Bacillus anthracis str.
           Sterne]
 gi|164712201|gb|EDR17738.1| metallo-beta-lactamase family protein [Bacillus anthracis str.
           A0488]
 gi|167513494|gb|EDR88864.1| metallo-beta-lactamase family protein [Bacillus anthracis str.
           A0193]
 gi|167530129|gb|EDR92864.1| metallo-beta-lactamase family protein [Bacillus anthracis str.
           A0442]
 gi|170127666|gb|EDS96539.1| metallo-beta-lactamase family protein [Bacillus anthracis str.
           A0389]
 gi|170668607|gb|EDT19353.1| metallo-beta-lactamase family protein [Bacillus anthracis str.
           A0465]
 gi|172080299|gb|EDT65388.1| metallo-beta-lactamase family protein [Bacillus anthracis str.
           A0174]
 gi|190562980|gb|EDV16946.1| metallo-beta-lactamase family protein [Bacillus anthracis
           Tsiankovskii-I]
 gi|227007663|gb|ACP17406.1| metallo-beta-lactamase family protein [Bacillus anthracis str. CDC
           684]
 gi|229268240|gb|ACQ49877.1| metallo-beta-lactamase family protein [Bacillus anthracis str.
           A0248]
          Length = 208

 Score =  119 bits (297), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 62/201 (30%), Positives = 107/201 (53%), Gaps = 2/201 (0%)

Query: 13  PFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLK 72
           P + N   L ++++ E V+ DPG + + +   +Q        + +TH H DH+G    ++
Sbjct: 10  PLQTNAYILKNDKN-ECVIFDPGHEGEKLVTYLQEEQLKPLAVLLTHAHFDHIGAVDAVR 68

Query: 73  EDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFKVFH 132
           +   + +   HK++  +       +++  +  +     +D  +    TL +G+  F++F 
Sbjct: 69  DAFHIPVY-VHKEEDWLGDATVNGSQIFMMNRSITAKPADHIIDAEGTLAIGSFNFEIFE 127

Query: 133 CPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEISF 192
            PGHSPG + Y   E +    GD LF+ SIGRTD+  G + +LI SI  K+  L DE + 
Sbjct: 128 TPGHSPGSISYYCKEASAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKLFVLPDETAV 187

Query: 193 VCGHGPNSTIGRERRLNPFLK 213
           +CGHGP ++IG E+  NPFL+
Sbjct: 188 LCGHGPETSIGFEKENNPFLQ 208


>gi|329121019|ref|ZP_08249650.1| metallo-beta-lactamase [Dialister micraerophilus DSM 19965]
 gi|327471181|gb|EGF16635.1| metallo-beta-lactamase [Dialister micraerophilus DSM 19965]
          Length = 211

 Score =  119 bits (297), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 71/213 (33%), Positives = 105/213 (49%), Gaps = 17/213 (7%)

Query: 9   VQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGA 68
           V + P + N   ++ E   E VV+DP  D++ I   I+  N  +K I +TH H+DH+ G 
Sbjct: 6   VILGPLQNNTYIIYFENINEVVVIDPSFDVENILSEIKKSNIKIKAILLTHAHIDHIAGI 65

Query: 69  AQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNA--------SSDRWLQDGDT 120
            ++KE           D    MG+  EQ  LL+   N              D  L+DG+ 
Sbjct: 66  LKIKESFP--------DAKVYMGE-KEQKTLLNSNFNLSYLFPGTLIYDKVDFLLKDGEK 116

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           L  G   F++   PGH+ G + Y     N    GDTLF  +IGR+D   G++ QL+NSI 
Sbjct: 117 LNFGNVEFEIITTPGHTIGSICYYIKSENILFTGDTLFYKTIGRSDFPGGNFIQLVNSIV 176

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           N++  L D    + GHG  ++I  ER  NPF++
Sbjct: 177 NRLFTLPDNTDVMPGHGITTSIKFERENNPFVR 209


>gi|310643939|ref|YP_003948697.1| beta-lactamase domain-containing protein [Paenibacillus polymyxa
           SC2]
 gi|309248889|gb|ADO58456.1| Beta-lactamase domain-containing protein [Paenibacillus polymyxa
           SC2]
          Length = 209

 Score =  119 bits (297), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 67/211 (31%), Positives = 110/211 (52%), Gaps = 5/211 (2%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           LS     + P + N   L  ++   AV++DPG +   +   I+S    ++ I +TH H D
Sbjct: 3   LSIRSFNLGPLQTNAYLLQGDDPQRAVIIDPGMNPGPLLRAIES--LTIEAILLTHAHFD 60

Query: 64  HVGGAAQLKEDLSLTI-IGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLL 122
           H+GG  +++      + +   + D     K++                ++  L +G  L 
Sbjct: 61  HIGGVEEIRNAKGCPVYLHALEQDWLTSPKLNGSLMWPEASPPISTGPAEYDLAEGQQLK 120

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
           L  H FKV H PGHSPG V ++  ++ F+  GD LFR  +GRTD+  G  + L +SI NK
Sbjct: 121 LIGHTFKVLHTPGHSPGSVSFLCGKDLFS--GDVLFRQGVGRTDLTGGRERDLYDSIQNK 178

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           + PLGD+++   GHGP ++IG E+  NP+++
Sbjct: 179 LFPLGDDVTVYPGHGPKTSIGYEKANNPYIR 209


>gi|228947975|ref|ZP_04110261.1| Metallo-beta-lactamase [Bacillus thuringiensis serovar monterrey
           BGSC 4AJ1]
 gi|228811665|gb|EEM58000.1| Metallo-beta-lactamase [Bacillus thuringiensis serovar monterrey
           BGSC 4AJ1]
          Length = 239

 Score =  119 bits (297), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 66/204 (32%), Positives = 110/204 (53%), Gaps = 7/204 (3%)

Query: 13  PFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLK 72
           P + N   L ++++ E V+ DPG + + +   +Q        + +TH H DH+G    ++
Sbjct: 40  PLQTNAYILKNDKN-ECVIFDPGHEGEKLVTYLQEEQLKPLAVLLTHAHFDHIGAVDAVR 98

Query: 73  EDLSLTIIGPHKDDAAMMGKVD---EQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFK 129
           +   + +   HK++   +G       Q  +++  + A+ A  D  +    TL +G+  F+
Sbjct: 99  DAFHIPVY-VHKEEEDWLGDATVNGSQIFMMNRSITAKPA--DHIIDAEGTLAIGSFNFE 155

Query: 130 VFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDE 189
           +F  PGHSPG + Y   E +    GD LF+ SIGRTD+  G + +LI SI  K+  L DE
Sbjct: 156 IFETPGHSPGSISYYCKEASALFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKLFVLPDE 215

Query: 190 ISFVCGHGPNSTIGRERRLNPFLK 213
            + +CGHGP ++IG E+  NPFL+
Sbjct: 216 TAVLCGHGPETSIGFEKENNPFLQ 239


>gi|302380743|ref|ZP_07269208.1| metallo-beta-lactamase domain protein [Finegoldia magna
           ACS-171-V-Col3]
 gi|303233674|ref|ZP_07320328.1| metallo-beta-lactamase domain protein [Finegoldia magna BVS033A4]
 gi|302311686|gb|EFK93702.1| metallo-beta-lactamase domain protein [Finegoldia magna
           ACS-171-V-Col3]
 gi|302495108|gb|EFL54860.1| metallo-beta-lactamase domain protein [Finegoldia magna BVS033A4]
          Length = 202

 Score =  119 bits (297), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 69/210 (32%), Positives = 106/210 (50%), Gaps = 8/210 (3%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           ++   +  T + +N   L   E  +  VVDPG   D I + I++RN  ++ I ITHGH D
Sbjct: 1   MTLDKIVTTKYGENMYIL--SEDNKCFVVDPGAQADDICEYIKNRNLEIQFILITHGHFD 58

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+  A +LK  L   I  P K+   +        R +    N    ++D ++++GDT+  
Sbjct: 59  HIFAAEELKNKLCTVIYAPEKEKDLLEDPEKNYTRKVG---NPITLTADYYVKEGDTIEF 115

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
                 V   PGH+ G   Y+  +  F+  GD LF++SIGR D+    Y ++ NSI  K+
Sbjct: 116 NDSKISVLETPGHTYGSCCYIYKDIMFS--GDMLFKNSIGRYDLPTASYGEIKNSI-EKL 172

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
             L D I    GHGP + IG E++ NP+ K
Sbjct: 173 KLLNDNIKVYPGHGPETNIGDEKKYNPYFK 202


>gi|313203169|ref|YP_004041826.1| metallO-beta-lactamase [Paludibacter propionicigenes WB4]
 gi|312442485|gb|ADQ78841.1| putative metallo-beta-lactamase [Paludibacter propionicigenes WB4]
          Length = 211

 Score =  118 bits (296), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 71/206 (34%), Positives = 105/206 (50%), Gaps = 10/206 (4%)

Query: 13  PFKQNCTFLFDEESLEAVVVDPGGDLD----IIKDVIQSRNFHVKQIWITHGHVDHVGGA 68
           PF++N   L+DE + EAV+VD G   D    ++K  I+  +  +K++  TH H+DH  G 
Sbjct: 10  PFQENTYLLYDE-TKEAVLVDAGCISDTEKLVLKRFIEENSLILKRVINTHLHLDHQFGN 68

Query: 69  AQLKEDLSLTIIGPH--KDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTH 126
             +     L    P   ++D  ++  V  QAR     +     S   ++ +   +  G  
Sbjct: 69  KFIFNTFGLK---PEACQEDEFLLDNVVAQARSFGFAIEEEAQSLGAYIIEDQEIKFGNS 125

Query: 127 IFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPL 186
             K  H PGHSPG +++ +  +    +GD LFR SIGRTD+  GDY  LI  I  K+LPL
Sbjct: 126 CLKSIHVPGHSPGSMVFYSERDGILLVGDVLFRGSIGRTDLPKGDYATLIQGITKKLLPL 185

Query: 187 GDEISFVCGHGPNSTIGRERRLNPFL 212
            D      GHG  +TIG E+  NP+L
Sbjct: 186 PDSTVVYSGHGSTTTIGYEKTNNPYL 211


>gi|331697362|ref|YP_004333601.1| beta-lactamase domain-containing protein [Pseudonocardia
           dioxanivorans CB1190]
 gi|326952051|gb|AEA25748.1| beta-lactamase domain protein [Pseudonocardia dioxanivorans CB1190]
          Length = 230

 Score =  118 bits (296), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 73/211 (34%), Positives = 108/211 (51%), Gaps = 14/211 (6%)

Query: 14  FKQNCTFLFDEESLEAVVVDPGGD-LDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLK 72
           F+ NC  L  E     +VVDPG D ++ +++++         + +THGH DH    A + 
Sbjct: 11  FQTNCYVLAREAGEACIVVDPGQDAVEPLEELLAEHRLTPVAVLLTHGHFDHTFSVAPVC 70

Query: 73  E--DLSLTIIGPHKDDAAMM-----GKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGT 125
           +  D+   I   H DD  ++     G   E A     R+  R   S   L DG  L L  
Sbjct: 71  DGNDIPAWI---HPDDRELLADPLKGISAESAAFFGGRLELREPRSVELLADGSDLQLAG 127

Query: 126 HIFKVFHCPGHSPGHVIYVNFENNFAHL---GDTLFRSSIGRTDILHGDYQQLINSINNK 182
              +V H PGH+PG V++    ++   +   GDTLF  S+GRTD+  G ++QL+ S+ +K
Sbjct: 128 LTLRVDHTPGHTPGSVVFTTPSDDGTEVILAGDTLFAGSVGRTDLPGGSHRQLLASVRDK 187

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           +L   D    + GHGP +TIGRER  NPFL+
Sbjct: 188 LLVRDDSGFVLPGHGPATTIGRERASNPFLQ 218


>gi|319651536|ref|ZP_08005664.1| YqgX protein [Bacillus sp. 2_A_57_CT2]
 gi|317396851|gb|EFV77561.1| YqgX protein [Bacillus sp. 2_A_57_CT2]
          Length = 211

 Score =  118 bits (296), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 62/209 (29%), Positives = 109/209 (52%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + ++ + + P + NC ++   E+ + ++ DPG +   +  +I+ +      + +TH H D
Sbjct: 1   MEWNQIPLGPLQTNC-YVLSNETKDCLIFDPGEESGKLSGIIEQKGLKPLAVILTHAHFD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G   ++++  S+ +    K+ A +       + L  I    +   +D  +     L +
Sbjct: 60  HIGAVDEIRDAFSIPVYIHEKEAAWLPDPALNGSHLFKIGKLIKARPADHIITGEQELSI 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    K+   PGHSPG +     + +    GD LF  SIGRTD+  G++QQL+ SI+NK+
Sbjct: 120 GEFNLKILETPGHSPGSISLYFEDADLVVAGDALFSGSIGRTDLPGGNHQQLLESIHNKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           L L +E   + GHGP +TIG+E   NPFL
Sbjct: 180 LTLPEETEVLPGHGPVTTIGQEMDSNPFL 208


>gi|255038811|ref|YP_003089432.1| beta-lactamase domain-containing protein [Dyadobacter fermentans
           DSM 18053]
 gi|254951567|gb|ACT96267.1| beta-lactamase domain protein [Dyadobacter fermentans DSM 18053]
          Length = 212

 Score =  118 bits (295), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 69/205 (33%), Positives = 107/205 (52%), Gaps = 7/205 (3%)

Query: 13  PFKQNCTFLFDEESLEAVVVDPG----GDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGA 68
           PF +N T+L  +E+ EA+++DPG     +L+ +   + + +    QI  TH H+DHV G 
Sbjct: 11  PFSEN-TYLLHDETGEAIIIDPGCYDRSELNELVAYVDAHSLKPVQIVNTHAHIDHVLGV 69

Query: 69  AQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIF 128
           A LK    +     HK +  ++  V   A              D ++++G+T+  G    
Sbjct: 70  AALKRKYGIPF-ALHKLEEPVLKAVKSYASNYGFS-TFEEPEIDTFIREGETIEFGNTSL 127

Query: 129 KVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGD 188
           K+   PGH+PGHV +V+  +     GD LFR SIGRTD+  GD+  L+ SI  ++  L D
Sbjct: 128 KIIFVPGHAPGHVAFVSDADKLVIGGDVLFRMSIGRTDLPGGDHATLLRSIREQLFTLPD 187

Query: 189 EISFVCGHGPNSTIGRERRLNPFLK 213
           +     GH   +TIG E++ NPF K
Sbjct: 188 DYQVYAGHMEPTTIGFEKKHNPFFK 212


>gi|188585916|ref|YP_001917461.1| beta-lactamase domain protein [Natranaerobius thermophilus
           JW/NM-WN-LF]
 gi|179350603|gb|ACB84873.1| beta-lactamase domain protein [Natranaerobius thermophilus
           JW/NM-WN-LF]
          Length = 206

 Score =  118 bits (295), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 72/203 (35%), Positives = 110/203 (54%), Gaps = 4/203 (1%)

Query: 11  VTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQ 70
           V     NC  +  +E+ EAV++DPGG+ + I   I+  +     I  THGHVDH+G  + 
Sbjct: 8   VGELGANCYIVGCQETGEAVIIDPGGNGEKIHQQIKELDMTPSMIINTHGHVDHIGANSY 67

Query: 71  LKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFKV 130
           LKE     + G H  DA M+        + + +    + S+D  L DGD++ +G    ++
Sbjct: 68  LKEHTDAEL-GIHPKDAPMLTDPKLNLSMFTGK-EIISPSADIHLNDGDSIKVGNLKGEI 125

Query: 131 FHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEI 190
            + PGH+PG  I +  +NN    GDTLF   IGR D+  G+  +L+ SI  ++  L D++
Sbjct: 126 INTPGHTPGG-ICIKIDNNLFS-GDTLFTEGIGRCDLPGGNQDELLKSIREQLFTLSDDL 183

Query: 191 SFVCGHGPNSTIGRERRLNPFLK 213
               GHG ++TI  E+R NPFLK
Sbjct: 184 VVYPGHGGSTTIAHEKRKNPFLK 206


>gi|218961202|ref|YP_001740977.1| metallo-beta-lactamase family protein [Candidatus Cloacamonas
           acidaminovorans]
 gi|167729859|emb|CAO80771.1| metallo-beta-lactamase family protein [Candidatus Cloacamonas
           acidaminovorans]
          Length = 208

 Score =  118 bits (295), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 76/206 (36%), Positives = 105/206 (50%), Gaps = 8/206 (3%)

Query: 9   VQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGA 68
           V +  F+ N   L+D  S EA ++DP    +     I+     VK I  THGH DH+GG 
Sbjct: 8   VLLESFQTNTYLLWDSISAEAFLIDPAIPSETFLQRIKQLELKVKMIINTHGHADHIGGN 67

Query: 69  AQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNAR-NASSDR-WLQDGDTLLLGTH 126
               + L+  +   H  DA M+      A+  S  M    N S+ +  L DGD L LG+ 
Sbjct: 68  LYFAKALNCPV-AIHLADAEML---TNNAKNFSTYMGFELNLSAPQVILHDGDELFLGSE 123

Query: 127 IFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPL 186
             KV H PGH+ G +  +     +   GDTLF  SIGRTD   G +  +INSI NK+  L
Sbjct: 124 KVKVIHTPGHTEGSICLLT--GKYLISGDTLFEQSIGRTDFPGGSHTAIINSIKNKLFIL 181

Query: 187 GDEISFVCGHGPNSTIGRERRLNPFL 212
            D++    GHGP ++IG E+  NPF+
Sbjct: 182 DDDVLVFPGHGPTTSIGLEKVNNPFV 207


>gi|149182914|ref|ZP_01861372.1| hypothetical protein BSG1_07494 [Bacillus sp. SG-1]
 gi|148849363|gb|EDL63555.1| hypothetical protein BSG1_07494 [Bacillus sp. SG-1]
          Length = 211

 Score =  118 bits (295), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 63/209 (30%), Positives = 108/209 (51%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + +  + + P + NC  +++E+  E V+ DPG +   +   +++       I +TH H D
Sbjct: 1   MKWKRLPLGPLQTNCYCVWNEKK-ECVIFDPGEEAGKLIKWLRTNQLKPLAILLTHAHFD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G   +++E   + +    K+   +M      ++  ++    R   +D  L +  TL +
Sbjct: 60  HIGAVDKVREAFEIPLYVHEKEAKWLMDPSLNGSQFFAMSELVRMKPADYILTNEKTLSV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   F ++  PGHSPG + Y   E      GDTLF  SIGRTD+  G + +L+ SI++ +
Sbjct: 120 GDFTFDLYETPGHSPGSISYYYPEEQVVFSGDTLFMGSIGRTDLPGGHHDELLKSIHDHL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           L L ++   + GHGP +TIG E   NPFL
Sbjct: 180 LNLPEDTIVLSGHGPETTIGNEMDSNPFL 208


>gi|224539433|ref|ZP_03679972.1| hypothetical protein BACCELL_04338 [Bacteroides cellulosilyticus
           DSM 14838]
 gi|224518938|gb|EEF88043.1| hypothetical protein BACCELL_04338 [Bacteroides cellulosilyticus
           DSM 14838]
          Length = 212

 Score =  118 bits (295), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 67/204 (32%), Positives = 108/204 (52%), Gaps = 6/204 (2%)

Query: 14  FKQNCTFLFDEESLEAVVVDPGGDLD----IIKDVIQSRNFHVKQIWITHGHVDHVGGAA 69
           F  NC  L+D+ +LEA V+DPG   +     +K+ I     +VK +  TH H+DH+ G A
Sbjct: 11  FPVNCYVLWDD-TLEAAVIDPGCYYEEEKQALKNFIHKNGLNVKHLLNTHLHLDHIFGNA 69

Query: 70  QLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFK 129
            + ++  L +   +K D   + +  +Q+R+     N   A    +L DGD +  G  + +
Sbjct: 70  FMVKEFGLPVEA-NKADEFWIDEAPKQSRMFGFHWNELPAPIGHYLHDGDIINFGNTMLE 128

Query: 130 VFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDE 189
             H PGHSPG ++Y    ++    GD LF+ SIGR D+  G++ +L   I +++  L +E
Sbjct: 129 AIHVPGHSPGSLVYYCAADHCMFSGDVLFQGSIGRADLTGGNFDELKEHICSRLFILPNE 188

Query: 190 ISFVCGHGPNSTIGRERRLNPFLK 213
                GHG  +TIG E+  NPF +
Sbjct: 189 TIVYPGHGAPTTIGIEKAENPFFR 212


>gi|167762774|ref|ZP_02434901.1| hypothetical protein BACSTE_01132 [Bacteroides stercoris ATCC
           43183]
 gi|167699114|gb|EDS15693.1| hypothetical protein BACSTE_01132 [Bacteroides stercoris ATCC
           43183]
          Length = 212

 Score =  118 bits (295), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 67/204 (32%), Positives = 106/204 (51%), Gaps = 6/204 (2%)

Query: 14  FKQNCTFLFDEESLEAVVVDPGG----DLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAA 69
           F +NC  L+DE +LEAVV+DPG     +   +K+ I S    VK +  TH H+DH+ G  
Sbjct: 11  FPENCYVLWDE-TLEAVVIDPGCFYEEEKQALKNFIISNGLQVKHLLNTHLHLDHIFGNP 69

Query: 70  QLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFK 129
            + ++  L     ++ D   + +  +Q+R+   ++         +L DGD +  G    +
Sbjct: 70  FMLKEFGLKAEA-NQADEFWIDEAPKQSRMFGFQLPEPPVPLGTYLHDGDIITFGHTELE 128

Query: 130 VFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDE 189
             H PGHSPG ++Y     +    GD LF+ SIGR D+  G++ +LI  I +++  L  E
Sbjct: 129 AIHVPGHSPGSLVYYCAAEHCMFSGDVLFQGSIGRADLAGGNFDELIEHICSRLFILPSE 188

Query: 190 ISFVCGHGPNSTIGRERRLNPFLK 213
                GHG  +TIG E+  NPF +
Sbjct: 189 TVVYPGHGAPTTIGTEKAENPFFR 212


>gi|329965432|ref|ZP_08302356.1| metallo-beta-lactamase domain protein [Bacteroides fluxus YIT
           12057]
 gi|328522224|gb|EGF49338.1| metallo-beta-lactamase domain protein [Bacteroides fluxus YIT
           12057]
          Length = 212

 Score =  117 bits (294), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 66/204 (32%), Positives = 107/204 (52%), Gaps = 6/204 (2%)

Query: 14  FKQNCTFLFDEESLEAVVVDPGG----DLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAA 69
           F +NC  L+DE + EAVV+DPG     +   +K+ I S   +VK +  TH H+DH+ G  
Sbjct: 11  FPENCYVLWDE-TYEAVVIDPGCFYEEEKQALKNFIISNGLNVKHLLNTHLHLDHIFGNP 69

Query: 70  QLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFK 129
            + ++  L     ++ D   + +  +Q+R+   ++         +L DGD +  G    +
Sbjct: 70  FMLKEFGLKAEA-NQADEFWIDEAPKQSRMFGFQLQETPVPLGNYLHDGDIITFGNTSLE 128

Query: 130 VFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDE 189
             H PGHSPG ++Y    +     GD LF+ SIGR D+  G++ +LI  I +++  L +E
Sbjct: 129 AIHVPGHSPGSLVYYCAADRCMFSGDVLFQGSIGRADLSGGNFDELIEHICSRLFTLPNE 188

Query: 190 ISFVCGHGPNSTIGRERRLNPFLK 213
                GHG  +TIG E+  NPF +
Sbjct: 189 TIVYPGHGAPTTIGIEKAENPFFR 212


>gi|255325083|ref|ZP_05366189.1| beta-lactamase domain protein [Corynebacterium tuberculostearicum
           SK141]
 gi|255297648|gb|EET76959.1| beta-lactamase domain protein [Corynebacterium tuberculostearicum
           SK141]
          Length = 211

 Score =  117 bits (294), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 74/205 (36%), Positives = 109/205 (53%), Gaps = 11/205 (5%)

Query: 13  PFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLK 72
           PF+ N   +   E   A +VDPG  +D ++ V++  +   + I +THGH+DH   A  L 
Sbjct: 10  PFQTNTYVI--AEGRRAFIVDPG--MDAMEKVLE-HDLDYEAIVLTHGHIDHTRDAGSLA 64

Query: 73  EDLSLTIIGPHKDDAAMMGK---VDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFK 129
           E+L + +   H  D  M+     V  QA+ L    +    S  R L+DG+TL L  H F 
Sbjct: 65  EELDIPVYI-HPADKFMLDSGEGVSPQAQELFDAAHMTPISDLRELRDGETLELIGHTFA 123

Query: 130 VFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDE 189
           + H PGHSPG V+ V+   +FA  GD LF  +IGRTD+ H D   +  S+   +  L D 
Sbjct: 124 LKHAPGHSPGCVMIVS--EDFALTGDVLFAGAIGRTDLPHSDPNAMQKSLAGPVWSLPDN 181

Query: 190 ISFVCGHGPNSTIGRERRLNPFLKS 214
           +  + GHGP +T+ +ER  NPF  +
Sbjct: 182 LDILPGHGPTTTMRKERATNPFFAT 206


>gi|311739544|ref|ZP_07713379.1| metallo-beta-lactamase [Corynebacterium pseudogenitalium ATCC
           33035]
 gi|311305360|gb|EFQ81428.1| metallo-beta-lactamase [Corynebacterium pseudogenitalium ATCC
           33035]
          Length = 229

 Score =  117 bits (293), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 74/205 (36%), Positives = 109/205 (53%), Gaps = 11/205 (5%)

Query: 13  PFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLK 72
           PF+ N   +   E   A +VDPG  +D ++ V++  +   + I +THGH+DH   A  L 
Sbjct: 28  PFQTNTYVI--AEGRRAFIVDPG--MDAMEKVLE-HDLDYEAIVLTHGHIDHTRDAGSLA 82

Query: 73  EDLSLTIIGPHKDDAAMMGK---VDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFK 129
           E+L + +   H  D  M+     V  QA+ L    +    S  R L+DG+TL L  H F 
Sbjct: 83  EELDIPVY-IHPADKFMLDSGEGVSPQAQELFDAAHMTPISDLRELRDGETLELIGHTFA 141

Query: 130 VFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDE 189
           + H PGHSPG V+ V+   +FA  GD LF  +IGRTD+ H D   +  S+   +  L D 
Sbjct: 142 LKHAPGHSPGCVMIVS--EDFALTGDVLFAGAIGRTDLPHSDPNAMQKSLAGPVWSLPDN 199

Query: 190 ISFVCGHGPNSTIGRERRLNPFLKS 214
           +  + GHGP +T+ +ER  NPF  +
Sbjct: 200 LDILPGHGPTTTMRKERATNPFFAT 224


>gi|194017744|ref|ZP_03056354.1| YqgX [Bacillus pumilus ATCC 7061]
 gi|194010644|gb|EDW20216.1| YqgX [Bacillus pumilus ATCC 7061]
          Length = 212

 Score =  117 bits (293), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 60/201 (29%), Positives = 110/201 (54%), Gaps = 5/201 (2%)

Query: 14  FKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLKE 73
           + Q   +++  E  E ++ DPGG+   +   ++ +      + +TH H DH+G A +++ 
Sbjct: 10  YVQANAYIWKNEHGECLIFDPGGEAQKLISYVKEKQLTPLAVLLTHAHFDHIGAADEVRA 69

Query: 74  DLSLTIIGPHKDDAAMM--GKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFKVF 131
           +  + +   H+++   +   +++  ARL+   +  + A  ++ +    TL +G+   ++F
Sbjct: 70  EWGVPLY-VHENEKEWLTNAELNGSARLIGNGITVKEA--EKLITSEGTLQIGSFTLEMF 126

Query: 132 HCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEIS 191
           H PGHSPG V Y + E  F   GDTLF   IGRTD++ G  + L+ SI+NK+L L +   
Sbjct: 127 HTPGHSPGSVSYYSAEEGFVISGDTLFEGGIGRTDLVGGSQEVLLQSIHNKLLSLPESTL 186

Query: 192 FVCGHGPNSTIGRERRLNPFL 212
            + GHG  +T+  E+  NPF+
Sbjct: 187 VLSGHGGETTVLTEQEQNPFI 207


>gi|65321639|ref|ZP_00394598.1| COG0491: Zn-dependent hydrolases, including glyoxylases [Bacillus
           anthracis str. A2012]
          Length = 238

 Score =  117 bits (293), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 62/201 (30%), Positives = 106/201 (52%), Gaps = 2/201 (0%)

Query: 13  PFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLK 72
           P + N   L ++++ E V+ DPG + + +   +Q        + +TH H DH+G     +
Sbjct: 40  PLQTNAYILKNDKN-ECVIFDPGHEGEKLVTYLQEEQLKPLAVLLTHAHFDHIGAVDAXR 98

Query: 73  EDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFKVFH 132
           +   + +   HK++  +       +++  +  +     +D  +    TL +G+  F++F 
Sbjct: 99  DAFHIPVY-VHKEEDWLGDXXVNGSQIFMMNRSITAKPADHIIDAEGTLAIGSFNFEIFE 157

Query: 133 CPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEISF 192
            PGHSPG + Y   E +    GD LF+ SIGRTD+  G + +LI SI  K+  L DE + 
Sbjct: 158 TPGHSPGSISYYCKEASAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKLFVLPDETAV 217

Query: 193 VCGHGPNSTIGRERRLNPFLK 213
           +CGHGP ++IG E+  NPFL+
Sbjct: 218 LCGHGPETSIGFEKENNPFLQ 238


>gi|157692976|ref|YP_001487438.1| hypothetical protein BPUM_2209 [Bacillus pumilus SAFR-032]
 gi|157681734|gb|ABV62878.1| hypothetical protein BPUM_2209 [Bacillus pumilus SAFR-032]
          Length = 214

 Score =  117 bits (293), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 60/201 (29%), Positives = 110/201 (54%), Gaps = 5/201 (2%)

Query: 14  FKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLKE 73
           + Q   +++  E  E ++ DPGG+   +   ++ +      + +TH H DH+G A +++ 
Sbjct: 12  YVQANAYIWKNEHGECLIFDPGGEAQKLISYVKEKQLTPLAVLLTHAHFDHIGAADEVRA 71

Query: 74  DLSLTIIGPHKDDAAMM--GKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFKVF 131
           +  + +   H+++   +   +++  ARL+   +  + A  ++ +    TL +G+   ++F
Sbjct: 72  EWGVPLY-VHENEKEWLTNAELNGSARLIGNGITVKEA--EKLITSEGTLQIGSFTLEMF 128

Query: 132 HCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEIS 191
           H PGHSPG V Y + E  F   GDTLF   IGRTD++ G  + L+ SI+NK+L L +   
Sbjct: 129 HTPGHSPGSVSYYSAEEGFVISGDTLFEGGIGRTDLVGGSQEVLLQSIHNKLLSLPESTL 188

Query: 192 FVCGHGPNSTIGRERRLNPFL 212
            + GHG  +T+  E+  NPF+
Sbjct: 189 VLSGHGDETTVLTEQEQNPFI 209


>gi|298377549|ref|ZP_06987501.1| metallo-beta-lactamase family protein [Bacteroides sp. 3_1_19]
 gi|298265568|gb|EFI07229.1| metallo-beta-lactamase family protein [Bacteroides sp. 3_1_19]
          Length = 212

 Score =  117 bits (293), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 69/207 (33%), Positives = 109/207 (52%), Gaps = 6/207 (2%)

Query: 10  QVTPFKQNCTFLFDEESLEAVVVDPGG----DLDIIKDVIQSRNFHVKQIWITHGHVDHV 65
           +V  F +N   L+D+ + EAV++D G     +   + D I      +K+   TH H+DH+
Sbjct: 8   EVNYFSENTYLLYDD-TKEAVLIDCGCLRKEEQKEVSDFIAQNGLTLKRYLCTHLHLDHI 66

Query: 66  GGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGT 125
            G   + +   L+    HK D   +   +EQA+   + M A++    ++L +G+ +  G 
Sbjct: 67  FGNEFIHDTYGLSPEA-HKADVEGLPSPEEQAKAFGLPMKAKSVPVGKYLVNGEIIKFGK 125

Query: 126 HIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILP 185
               V   PGHSPG V + N +N F  +GD+LF  SIGRTD+  G+   L+ +I +K+L 
Sbjct: 126 SELAVLSVPGHSPGGVAFYNKKNGFVIVGDSLFAGSIGRTDLWGGNQDILLAAIKDKLLS 185

Query: 186 LGDEISFVCGHGPNSTIGRERRLNPFL 212
           L DE     GHGP + I  E+  NP+L
Sbjct: 186 LPDETVVYPGHGPETRIIDEKLNNPYL 212


>gi|189466164|ref|ZP_03014949.1| hypothetical protein BACINT_02534 [Bacteroides intestinalis DSM
           17393]
 gi|189434428|gb|EDV03413.1| hypothetical protein BACINT_02534 [Bacteroides intestinalis DSM
           17393]
          Length = 212

 Score =  117 bits (293), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 67/204 (32%), Positives = 108/204 (52%), Gaps = 6/204 (2%)

Query: 14  FKQNCTFLFDEESLEAVVVDPGGDLD----IIKDVIQSRNFHVKQIWITHGHVDHVGGAA 69
           F  NC  L+D+ +LEA V+DPG   +     +K+ I   + +VK +  TH H+DH+ G A
Sbjct: 11  FPVNCYVLWDD-TLEATVIDPGCYYEEEKQALKNFIIKNSLNVKHLLNTHLHLDHIFGNA 69

Query: 70  QLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFK 129
            + ++  L +   +K D   + +  +Q+R+     N   A    +L DGD +  G    +
Sbjct: 70  FMVKEFGLQVEA-NKADEFWIDEAPKQSRMFGFHWNELPAPIGHYLHDGDIISFGNTTLE 128

Query: 130 VFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDE 189
             H PGHSPG ++Y    ++    GD LF+ SIGR D+  G++ +L   I +++  L +E
Sbjct: 129 AIHVPGHSPGSLVYYCAADHCMFSGDVLFQGSIGRADLTGGNFDELKEHICSRLFVLPNE 188

Query: 190 ISFVCGHGPNSTIGRERRLNPFLK 213
                GHG  +TIG E+  NPF +
Sbjct: 189 TIVYPGHGAPTTIGIEKAENPFFR 212


>gi|227833228|ref|YP_002834935.1| hypothetical protein cauri_1404 [Corynebacterium aurimucosum ATCC
           700975]
 gi|262184214|ref|ZP_06043635.1| hypothetical protein CaurA7_09497 [Corynebacterium aurimucosum ATCC
           700975]
 gi|227454244|gb|ACP32997.1| hypothetical protein cauri_1404 [Corynebacterium aurimucosum ATCC
           700975]
          Length = 214

 Score =  117 bits (292), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 75/218 (34%), Positives = 116/218 (53%), Gaps = 13/218 (5%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGG-DLDIIKDVIQSRNFHVKQIWITH 59
           MS    +     P+K N T++    S  A +VDPG    + ++ + + ++   + + +TH
Sbjct: 1   MSAPEIYGFAAGPYKTN-TYVVANGS-RAFIVDPGMHTREKLEQLAREKSLEFEAVVLTH 58

Query: 60  GHVDHVGGAAQLKEDLSLTIIGPHKDDAAMM---GKVDEQARLLSIRMNARNASSDRWLQ 116
           GH+DH   AA+   DL + I   H DDA M+     V  ++++L    + +  +  R L 
Sbjct: 59  GHIDHTRDAAEF--DLPVYI---HPDDAFMLVDGSGVSPESQMLFAAASMKQVADRRDLI 113

Query: 117 DGDTLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLI 176
            G+TL L    F + H PGHSPG VI V      A  GD LF+ SIGRTD+ H D+  + 
Sbjct: 114 GGETLSLVGLEFDLLHAPGHSPGCVILV--AEGIALTGDVLFKGSIGRTDLPHSDHAAMQ 171

Query: 177 NSINNKILPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
            S+   +  L D ++ + GHGP +T+ RER  NPFL++
Sbjct: 172 RSLRGPVWGLDDSLAILPGHGPTTTMRRERATNPFLRA 209


>gi|198274750|ref|ZP_03207282.1| hypothetical protein BACPLE_00909 [Bacteroides plebeius DSM 17135]
 gi|198272197|gb|EDY96466.1| hypothetical protein BACPLE_00909 [Bacteroides plebeius DSM 17135]
          Length = 213

 Score =  117 bits (292), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 66/204 (32%), Positives = 103/204 (50%), Gaps = 5/204 (2%)

Query: 14  FKQNCTFLFDEESLEAVVVDPGG----DLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAA 69
           F  NC  ++DEE+L+A V+D G     +   +K  I      V  +  TH H+DH+ G A
Sbjct: 11  FPVNCYVVWDEETLQAAVIDAGCYYQEEQQTLKKFIAENGLTVTHLLNTHLHLDHIFGNA 70

Query: 70  QLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFK 129
            +  +  ++     K+D  ++ +  E  R+    +N    +   ++ DGD + +G    K
Sbjct: 71  FMLREFGVSAEA-GKEDEFLLPRTAEYCRMFGFPLNEEPPALGSYVHDGDLIKIGNIELK 129

Query: 130 VFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDE 189
               PGHSPG +++     +    GD LFR SIGR D+  G++ QL  SI  ++L L DE
Sbjct: 130 ALAVPGHSPGSMVFYCEAQHCMFSGDVLFRGSIGRADLEGGNFDQLRESIVARLLTLPDE 189

Query: 190 ISFVCGHGPNSTIGRERRLNPFLK 213
                GHG  +TIG E+  NPF +
Sbjct: 190 TMVYPGHGNPTTIGYEKMNNPFFR 213


>gi|301311211|ref|ZP_07217139.1| metallo-beta-lactamase family protein [Bacteroides sp. 20_3]
 gi|300830785|gb|EFK61427.1| metallo-beta-lactamase family protein [Bacteroides sp. 20_3]
          Length = 212

 Score =  117 bits (292), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 69/207 (33%), Positives = 109/207 (52%), Gaps = 6/207 (2%)

Query: 10  QVTPFKQNCTFLFDEESLEAVVVDPGG----DLDIIKDVIQSRNFHVKQIWITHGHVDHV 65
           +V  F +N   L+D+ + EAV++D G     +   + D I      +K+   TH H+DH+
Sbjct: 8   EVNYFSENTYLLYDD-TKEAVLIDCGCLRKEEQKEVSDFIAQNGLTLKRYLCTHLHLDHI 66

Query: 66  GGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGT 125
            G   + +   L+    HK D   +   +EQA+   + M A++    ++L +G+ +  G 
Sbjct: 67  FGNEFIHDTYGLSPEA-HKADVEGLPSPEEQAKAFGLPMKAKSIPVGKYLVNGEIIKFGK 125

Query: 126 HIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILP 185
               V   PGHSPG V + N +N F  +GD+LF  SIGRTD+  G+   L+ +I +K+L 
Sbjct: 126 SELAVLSVPGHSPGGVAFYNKKNGFVIVGDSLFAGSIGRTDLWGGNQDVLLAAIKDKLLS 185

Query: 186 LGDEISFVCGHGPNSTIGRERRLNPFL 212
           L DE     GHGP + I  E+  NP+L
Sbjct: 186 LPDETVVYPGHGPETRIIDEKLNNPYL 212


>gi|258645311|ref|ZP_05732780.1| metallo-beta-lactamase family protein [Dialister invisus DSM 15470]
 gi|260402660|gb|EEW96207.1| metallo-beta-lactamase family protein [Dialister invisus DSM 15470]
          Length = 211

 Score =  117 bits (292), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 65/208 (31%), Positives = 110/208 (52%), Gaps = 17/208 (8%)

Query: 13  PFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLK 72
           PF  N   ++DE +++AV++DP    + I   +     +VK I++THGHVDH+ G  +LK
Sbjct: 10  PFMTNTYIIYDENTMDAVIIDPSFTPENIIRAVAQLKVNVKGIFLTHGHVDHMAGLNKLK 69

Query: 73  EDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNA--------SSDRWLQDGDTLLLG 124
                   G +K+    M  ++++  L   + N  ++        ++D W+   + + +G
Sbjct: 70  --------GVYKEARVYM-NINDKEYLSDPKKNLSDSFPQPTICKAADYWVSYREHIKVG 120

Query: 125 THIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKIL 184
              F V    GH+PG + +   +      GD+LFR SIGRTD   GD ++L+ +I   + 
Sbjct: 121 KLDFTVLDTSGHTPGGISFYMEKEKVVFTGDSLFRESIGRTDFPGGDIKRLLQTIRKNLF 180

Query: 185 PLGDEISFVCGHGPNSTIGRERRLNPFL 212
            L DE+  + GHG  ++IG E++ NPFL
Sbjct: 181 SLSDEVIVLPGHGEATSIGYEKKHNPFL 208


>gi|218291315|ref|ZP_03495283.1| beta-lactamase domain protein [Alicyclobacillus acidocaldarius
           LAA1]
 gi|218238809|gb|EED06022.1| beta-lactamase domain protein [Alicyclobacillus acidocaldarius
           LAA1]
          Length = 223

 Score =  117 bits (292), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 75/205 (36%), Positives = 100/205 (48%), Gaps = 7/205 (3%)

Query: 11  VTPFKQNCTFLFD--EESLEAVVVDPGG-DLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           ++P + NC  + +  E    AVV+DPG   LD +   I      +   W THGH DHV G
Sbjct: 17  ISPIQSNCYVIAESWEHGANAVVIDPGDLALDPVFSFIDEMGLKLVANWNTHGHFDHVIG 76

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           A +L++   +     H+DD     +     R             D W QDGD L LG   
Sbjct: 77  ADRLRDRYGVPSY-LHRDDLVTWNRAPHWYRAYLADDAPDLRQPDAWFQDGDELKLGDET 135

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
           F V+H PGHSPG V  V     F+  GDTLF  +IGR D+   D + +  S+  +IL   
Sbjct: 136 FTVWHTPGHSPGSVCLVGKRVVFS--GDTLFAGTIGRVDLEGSDPEAMRASL-KRILEWP 192

Query: 188 DEISFVCGHGPNSTIGRERRLNPFL 212
           DE+    GHGP + +G ERR N FL
Sbjct: 193 DELEIYPGHGPATRMGHERRHNRFL 217


>gi|262381121|ref|ZP_06074259.1| metallo-beta-lactamase [Bacteroides sp. 2_1_33B]
 gi|262296298|gb|EEY84228.1| metallo-beta-lactamase [Bacteroides sp. 2_1_33B]
          Length = 212

 Score =  117 bits (292), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 69/207 (33%), Positives = 109/207 (52%), Gaps = 6/207 (2%)

Query: 10  QVTPFKQNCTFLFDEESLEAVVVDPGG----DLDIIKDVIQSRNFHVKQIWITHGHVDHV 65
           +V  F +N   L+D+ + EAV++D G     +   + D I      +K+   TH H+DH+
Sbjct: 8   EVNYFSENTYLLYDD-TKEAVLIDCGCLRKEEQKEVSDFIAQNGLTLKRYLCTHLHLDHI 66

Query: 66  GGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGT 125
            G   + +   L+    HK D   +   +EQA+   + M A++    ++L +G+ +  G 
Sbjct: 67  FGNEFIYDTYGLSPEA-HKADVEGLPSPEEQAKAFGLLMKAKSIPVGKYLVNGEIIKFGK 125

Query: 126 HIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILP 185
               V   PGHSPG V + N +N F  +GD+LF  SIGRTD+  G+   L+ +I +K+L 
Sbjct: 126 SELAVLSVPGHSPGGVAFYNKKNGFVIVGDSLFAGSIGRTDLWGGNQDVLLAAIKDKLLS 185

Query: 186 LGDEISFVCGHGPNSTIGRERRLNPFL 212
           L DE     GHGP + I  E+  NP+L
Sbjct: 186 LPDETVVYPGHGPETRIIDEKLNNPYL 212


>gi|288553364|ref|YP_003425299.1| metallo beta-lactamase [Bacillus pseudofirmus OF4]
 gi|288544524|gb|ADC48407.1| metallo beta-lactamase [Bacillus pseudofirmus OF4]
          Length = 211

 Score =  117 bits (292), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 72/210 (34%), Positives = 107/210 (50%), Gaps = 11/210 (5%)

Query: 9   VQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGA 68
           + + P + N   L +E+  EAV+ DPGG+       +  +      I +TH H DH+G  
Sbjct: 6   IPLGPLQTNAYVLMNEKK-EAVIFDPGGNGPEFIKWLNDQQISPIAILLTHAHFDHIGAV 64

Query: 69  AQLKEDLSLTII--GPHKD---DAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
            +++E  +  +      KD   DAA  G      R L    +    ++D  +Q+  T+ L
Sbjct: 65  DEVREAFNCPVYIHEAEKDWLSDAAKNGS----GRFLG-NASITACAADEIIQEEKTIQL 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G+  F + + PGHSPG V Y +        GD LF+ SIGRTD+  GD+  L+ SI++K+
Sbjct: 120 GSFSFDILYTPGHSPGSVSYYSATEGVVFSGDALFKQSIGRTDLPGGDHNLLLKSIHSKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           L L +E     GHGP +TIG E   NPFL 
Sbjct: 180 LELPEETIVASGHGPVTTIGEEMDGNPFLS 209


>gi|255015261|ref|ZP_05287387.1| metallo-beta-lactamase family protein [Bacteroides sp. 2_1_7]
          Length = 212

 Score =  116 bits (291), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 69/207 (33%), Positives = 108/207 (52%), Gaps = 6/207 (2%)

Query: 10  QVTPFKQNCTFLFDEESLEAVVVDPGG----DLDIIKDVIQSRNFHVKQIWITHGHVDHV 65
           +V  F +N   L+D+ + EAV++D G     +   + D I      +K+   TH H+DH+
Sbjct: 8   EVNYFSENTYLLYDD-TKEAVLIDCGCLRKEEQKEVSDFIAQNGLTLKRYLCTHLHLDHI 66

Query: 66  GGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGT 125
            G   +     L+    HK D   +   +EQA+   + M A++    ++L +G+ +  G 
Sbjct: 67  FGNEFVHNTYGLSPEA-HKADVEGLPSPEEQAKAFGLSMKAKSVPVGKYLVNGEIIKFGK 125

Query: 126 HIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILP 185
               V   PGHSPG V + N +N F  +GD+LF  SIGRTD+  G+   L+ +I +K+L 
Sbjct: 126 SELAVLSVPGHSPGGVAFYNKKNGFVIVGDSLFAGSIGRTDLWGGNQDILLAAIKDKLLS 185

Query: 186 LGDEISFVCGHGPNSTIGRERRLNPFL 212
           L DE     GHGP + I  E+  NP+L
Sbjct: 186 LPDETVVYPGHGPETRIIDEKLNNPYL 212


>gi|317128381|ref|YP_004094663.1| beta-lactamase [Bacillus cellulosilyticus DSM 2522]
 gi|315473329|gb|ADU29932.1| beta-lactamase domain protein [Bacillus cellulosilyticus DSM 2522]
          Length = 212

 Score =  116 bits (291), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 66/212 (31%), Positives = 114/212 (53%), Gaps = 8/212 (3%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + +  + + P + N   ++  E+   V++DPGGD   + + ++S + H++ + +TH H D
Sbjct: 1   MKWKKLPLGPLQTNGYVVY--ENGTGVMIDPGGDEGRLLNWLKSEDIHIQAVLLTHAHFD 58

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQ---ARLLSIRMNARNASSDRWLQDGDT 120
           H+G   ++K++ S  +   HK++   +  VD Q   + L           ++  +     
Sbjct: 59  HIGAVERIKKEFSAPLY-VHKNEQQWL--VDPQLNGSGLFQGITPISVGEAEHLITKEGP 115

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           L +G   F+V+  PGHSPG V Y   E++    GD LF   +GRTD+  G  + L+++I+
Sbjct: 116 LEVGPFTFQVYTTPGHSPGSVSYYLPESHVIFSGDVLFHGGVGRTDLPGGSQETLMDTIH 175

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           NK L L DE     GHGP +TIG E+ +NPF+
Sbjct: 176 NKFLSLPDETIVANGHGPVTTIGEEKEINPFI 207


>gi|313891999|ref|ZP_07825600.1| metallo-beta-lactamase domain protein [Dialister microaerophilus
           UPII 345-E]
 gi|313119642|gb|EFR42833.1| metallo-beta-lactamase domain protein [Dialister microaerophilus
           UPII 345-E]
          Length = 211

 Score =  116 bits (291), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 70/213 (32%), Positives = 104/213 (48%), Gaps = 17/213 (7%)

Query: 9   VQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGA 68
           V + P + N   ++ E   E VV+DP  D++ I   I+  N  +K I +TH H+DH+ G 
Sbjct: 6   VILGPLQNNTYIIYFENINEVVVIDPSFDIENILSEIKKSNIKIKAILLTHAHIDHIAGV 65

Query: 69  AQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNA--------SSDRWLQDGDT 120
            ++KE           D    MG+  EQ  LL+   N              D  L+DG+ 
Sbjct: 66  LKIKESFP--------DSKVYMGE-KEQKTLLNSNFNLSYLFPGTLIYDKVDFLLKDGEK 116

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           L  G   F++   PGH+ G + Y     N    GDTLF  +IGR+D   G++ QL+NSI 
Sbjct: 117 LNFGNVEFEIITTPGHTIGSICYYIKSENILFTGDTLFYKTIGRSDFPGGNFIQLVNSIV 176

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           N++  L D    + GHG  ++I  ER  N F++
Sbjct: 177 NRLFTLPDNTDVMPGHGVTTSIKFERENNQFVR 209


>gi|328949568|ref|YP_004366903.1| beta-lactamase domain protein [Marinithermus hydrothermalis DSM
           14884]
 gi|328449892|gb|AEB10793.1| beta-lactamase domain protein [Marinithermus hydrothermalis DSM
           14884]
          Length = 209

 Score =  116 bits (291), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 70/204 (34%), Positives = 102/204 (50%), Gaps = 5/204 (2%)

Query: 9   VQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGA 68
           V V P ++N   L D E    V++DPG + + I + +++  F  + I +TH H DHVG  
Sbjct: 6   VTVGPLQENTYLLADPEG-RGVIIDPGAEPERILEAVRAGRFQPEAILLTHAHFDHVGAV 64

Query: 69  AQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIF 128
           A L E L L +   H+ D  +       A    I +      +  +LQ+G  L  G  + 
Sbjct: 65  APLVEALDLPVYL-HEADLPLYQNAPAIAAQWGIALPPPPPPTG-FLQEGQVLEHGPRL- 121

Query: 129 KVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGD 188
           +V + PGHSPGHV +   E      GD LFR SIGR D+    Y+ L+ S+  ++L L  
Sbjct: 122 EVLYLPGHSPGHVAFYQPEAGLVFSGDVLFRGSIGRYDLPGASYEALMRSL-AELLTLPP 180

Query: 189 EISFVCGHGPNSTIGRERRLNPFL 212
                 GHGP +T+  E + NPFL
Sbjct: 181 PTRVYPGHGPETTLLHEAQTNPFL 204


>gi|310829079|ref|YP_003961436.1| beta-lactamase domain protein [Eubacterium limosum KIST612]
 gi|308740813|gb|ADO38473.1| beta-lactamase domain protein [Eubacterium limosum KIST612]
          Length = 209

 Score =  116 bits (291), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 67/204 (32%), Positives = 111/204 (54%), Gaps = 8/204 (3%)

Query: 11  VTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQ 70
           V P   NC   +DE++ +AV++DPG + D I + ++     V +I +THGH DH+GG  +
Sbjct: 9   VGPMASNCYIAWDEDTKDAVIIDPGFEDDRIMETVEKHGLKVGKILLTHGHFDHIGGLEK 68

Query: 71  LKEDLSLTIIGPHKDDAAMMGKVDEQ-ARLLSIRMNARNASSDRWLQDGDTLLLGTHI-F 128
            K      +   + DDA  +    +  + ++   MN     +D  L+DGD + +  +I  
Sbjct: 69  TKAQTGAKVY-IYADDADTLTSAGKNLSTMVGQPMNP--GPADVLLRDGDEVEISPNIKL 125

Query: 129 KVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGD 188
              H PGH+ G   +V  +  F+  GDTLF  SIGRTD   G Y+ ++ S+ ++++   D
Sbjct: 126 TTIHTPGHTVGSCCFVGEDVIFS--GDTLFEGSIGRTDFPGGSYENMMKSL-SRLMTYDD 182

Query: 189 EISFVCGHGPNSTIGRERRLNPFL 212
           +++ + GHG N+ I  ER  NPF+
Sbjct: 183 DMTVLPGHGENTDIAYERARNPFI 206


>gi|229495875|ref|ZP_04389601.1| metallo-beta-lactamase family protein [Porphyromonas endodontalis
           ATCC 35406]
 gi|229317188|gb|EEN83095.1| metallo-beta-lactamase family protein [Porphyromonas endodontalis
           ATCC 35406]
          Length = 217

 Score =  116 bits (290), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 74/216 (34%), Positives = 107/216 (49%), Gaps = 12/216 (5%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPG----GDLDIIKDVIQSRNFHVKQIWITH 59
            SF+ VQV     N   L D+ + EA ++D G     + +I+   ++  N     +  TH
Sbjct: 8   FSFNFVQV-----NTYLLVDKATREAAIIDCGCMVPAEENILSSKVEELNATPTLLIATH 62

Query: 60  GHVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIR-MNARNASSDRWLQDG 118
            H DHV G     +   LT    H+ +   M   +EQ R   +  M  R+    +  + G
Sbjct: 63  LHFDHVWGVPFAAQKWGLTPRA-HRVEIEKMPPFEEQMRAFGMPPMPERHDLPYQPFETG 121

Query: 119 DTLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSS-IGRTDILHGDYQQLIN 177
           D L LG  + +V   PGH+PGHV +   + +    GD LF    IGRTD+  G Y  LIN
Sbjct: 122 DRLKLGETLLEVLFVPGHTPGHVAFYEPQQHLLFAGDVLFAGGDIGRTDLPGGSYTTLIN 181

Query: 178 SINNKILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           SI  +++PL D+     GHGP STIG ERR N +++
Sbjct: 182 SIKTQLMPLDDDTIVYSGHGPQSTIGFERRANSYIQ 217


>gi|256375835|ref|YP_003099495.1| beta-lactamase domain protein [Actinosynnema mirum DSM 43827]
 gi|255920138|gb|ACU35649.1| beta-lactamase domain protein [Actinosynnema mirum DSM 43827]
          Length = 234

 Score =  116 bits (290), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 75/210 (35%), Positives = 103/210 (49%), Gaps = 14/210 (6%)

Query: 14  FKQNCTFLFDEESLEAVVVDPGGD-LDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQL- 71
            + NC  +  E     VVVDPG D L+ I + ++        + +THGH DH    A + 
Sbjct: 11  LQANCYLVASEAGGACVVVDPGQDALEPIAEAVREHRLSPVAVLLTHGHFDHSYSVAPVC 70

Query: 72  -KEDLSLTIIGPHKDDAAMM-----GKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGT 125
             +D+   +   H  D AM+     G   E       R+  R     R L DG  L L  
Sbjct: 71  DGDDIPAWV---HPADRAMLSDPLSGVSAETRAFFGGRLEMREPREVRELSDGAELDLAG 127

Query: 126 HIFKVFHCPGHSPGHVIYVNFENNFAHL---GDTLFRSSIGRTDILHGDYQQLINSINNK 182
             F V H PGH+ G V++ +       L   GDTLF  SIGRTD+  GD+  ++ S+  K
Sbjct: 128 LRFTVDHTPGHTGGSVMFRSGVEEGGRLVLSGDTLFAGSIGRTDLPGGDHGAMLGSLRRK 187

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           +L L D++  + GHGP +TIGRER  NPFL
Sbjct: 188 VLTLDDDVVVLPGHGPTTTIGRERASNPFL 217


>gi|302337001|ref|YP_003802207.1| beta-lactamase [Spirochaeta smaragdinae DSM 11293]
 gi|301634186|gb|ADK79613.1| beta-lactamase domain protein [Spirochaeta smaragdinae DSM 11293]
          Length = 222

 Score =  116 bits (290), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 72/214 (33%), Positives = 112/214 (52%), Gaps = 21/214 (9%)

Query: 17  NCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQL----- 71
           NC +++     E V++DPGGD + I   +  +N   + I +THGH+DHV    ++     
Sbjct: 13  NC-YIYSRWKKECVIIDPGGDYEKIISHMVGKNLTPRGIILTHGHLDHVSALGKIIDYYV 71

Query: 72  KEDLSLTIIGPHKDDAAMMG----KVDEQA--------RLLSIRMNARNASSDRWLQDGD 119
           ++++ L I   H+DDA   G    ++ E+A        + L   M       D +L++G 
Sbjct: 72  EQEIHLDI-AAHEDDAIFFGSGAREIHEEAFQQMGIDGKALFQEMYKPIPDIDLFLEEGK 130

Query: 120 TLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSI 179
           ++       +V H PGH+ G V   + E++    GDTLF   +GRTD+  GD Q L  SI
Sbjct: 131 SVFDCD--LRVIHTPGHTKGSVCLYSEESDMLFSGDTLFFEGVGRTDLFGGDSQALFRSI 188

Query: 180 NNKILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           N K++PL D      GHGP +TI RER  NP+++
Sbjct: 189 NEKLMPLPDRTRVFPGHGPLTTIERERGYNPYVQ 222


>gi|150007124|ref|YP_001301867.1| metallo-beta-lactamase family protein [Parabacteroides distasonis
           ATCC 8503]
 gi|256840501|ref|ZP_05546009.1| metallo-beta-lactamase [Parabacteroides sp. D13]
 gi|149935548|gb|ABR42245.1| metallo-beta-lactamase family protein [Parabacteroides distasonis
           ATCC 8503]
 gi|256737773|gb|EEU51099.1| metallo-beta-lactamase [Parabacteroides sp. D13]
          Length = 212

 Score =  116 bits (290), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 69/207 (33%), Positives = 108/207 (52%), Gaps = 6/207 (2%)

Query: 10  QVTPFKQNCTFLFDEESLEAVVVDPGG----DLDIIKDVIQSRNFHVKQIWITHGHVDHV 65
           +V  F +N   L+D+ + EAV++D G     +   + D I      +K+   TH H+DH+
Sbjct: 8   EVNYFSENTYLLYDD-TKEAVLIDCGCLRKEEQKEVSDFIAQNGLTLKRYLCTHLHLDHI 66

Query: 66  GGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGT 125
            G   +     L+    HK D   +   +EQA+   + M A++    ++L +G+ +  G 
Sbjct: 67  FGNEFVHNTYGLSPEA-HKADVEGLPSPEEQAKAFGLPMKAKSVPVGKYLVNGEIIKFGK 125

Query: 126 HIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILP 185
               V   PGHSPG V + N +N F  +GD+LF  SIGRTD+  G+   L+ +I +K+L 
Sbjct: 126 SELAVLSVPGHSPGGVAFYNKKNGFVIVGDSLFAGSIGRTDLWGGNQDILLAAIKDKLLS 185

Query: 186 LGDEISFVCGHGPNSTIGRERRLNPFL 212
           L DE     GHGP + I  E+  NP+L
Sbjct: 186 LPDETVVYPGHGPETRIIDEKLNNPYL 212


>gi|288819083|ref|YP_003433431.1| beta-lactamase family protein [Hydrogenobacter thermophilus TK-6]
 gi|288788483|dbj|BAI70230.1| beta-lactamase family protein [Hydrogenobacter thermophilus TK-6]
 gi|308752666|gb|ADO46149.1| conserved hypothetical protein [Hydrogenobacter thermophilus TK-6]
          Length = 210

 Score =  116 bits (290), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 66/211 (31%), Positives = 105/211 (49%), Gaps = 3/211 (1%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +   ++ V     NC+ + DEE  +AVV+DPG D + I++ +    F ++ I  THGH+D
Sbjct: 1   MMLKVIPVGILSVNCSVILDEEEGKAVVIDPGADAERIEEAMD--GFELQAIICTHGHID 58

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG    LKE   +     H+ D  ++           I         D +L+DG  + +
Sbjct: 59  HVGQVKTLKEKYRVPFYM-HRSDLFLINDPIWPGFEKQIGCALPCPEPDEFLEDGSEIKV 117

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G+   +V + PGH+PG       ++     GD LF+ S+GR D+  G+ + L  S+    
Sbjct: 118 GSISLEVLYTPGHTPGLCCLYMKDHGVLIAGDLLFKGSVGRWDLPGGNLEDLKKSLARVF 177

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
             L D+   +CGH   +TIG ER  NP+L+S
Sbjct: 178 KELPDDTLVICGHYEETTIGHERVFNPYLRS 208


>gi|227536015|ref|ZP_03966064.1| zinc (Zn2+)-dependent hydrolase [Sphingobacterium spiritivorum ATCC
           33300]
 gi|227244128|gb|EEI94143.1| zinc (Zn2+)-dependent hydrolase [Sphingobacterium spiritivorum ATCC
           33300]
          Length = 213

 Score =  116 bits (290), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 65/206 (31%), Positives = 113/206 (54%), Gaps = 7/206 (3%)

Query: 13  PFKQNCTFLFDEESLEAVVVDPG----GDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGA 68
           P+++N   L+D++    V++DPG     + D+    I+    +   +  TH H+DHV G 
Sbjct: 11  PYQENTYVLYDDKGF-CVIIDPGMYGKAEEDLFLSFIEEHKLNPVLLLNTHCHIDHVLGN 69

Query: 69  AQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIF 128
             + E   L +   H+ +  ++ +V   A  + IR +  +   + +L +  T+  G ++ 
Sbjct: 70  KFVHEHFGL-LPQFHEGELPLLIEVQNYAPQMGIRYDI-SPIGEHFLPEEGTVSFGDNVL 127

Query: 129 KVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGD 188
           K+   PGHSP H+ + +    F   GD LFR SIGRTD+  G++ QL+ SI  K+  L +
Sbjct: 128 KLIFVPGHSPAHLCFYHESQKFIIGGDALFRGSIGRTDLPGGNHNQLLKSIQEKLYTLPE 187

Query: 189 EISFVCGHGPNSTIGRERRLNPFLKS 214
           ++    GHGP++TIG E+R NPF+++
Sbjct: 188 DVIVYPGHGPSTTIGEEKRTNPFIRA 213


>gi|218130856|ref|ZP_03459660.1| hypothetical protein BACEGG_02451 [Bacteroides eggerthii DSM 20697]
 gi|217987200|gb|EEC53531.1| hypothetical protein BACEGG_02451 [Bacteroides eggerthii DSM 20697]
          Length = 212

 Score =  115 bits (289), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 65/204 (31%), Positives = 108/204 (52%), Gaps = 6/204 (2%)

Query: 14  FKQNCTFLFDEESLEAVVVDPGG----DLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAA 69
           F +NC  L+DE + EAVV+DPG     +   +K+ I +   +VK +  TH H+DH+ G  
Sbjct: 11  FPENCYVLWDETN-EAVVIDPGCFYEEEKQALKNFIINNKLNVKHLLNTHLHLDHIFGNP 69

Query: 70  QLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFK 129
            + ++  L     ++ D   + +  +Q+R+   ++         +L DGD ++ G    +
Sbjct: 70  FMLKEFGLKAEA-NQADEFWIDEAPKQSRMFGFQLQEPPVPLGSYLHDGDIIIFGNTELE 128

Query: 130 VFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDE 189
             H PGHSPG ++Y     +    GD LF+ SIGR D+  G++ +LI  I +++  L +E
Sbjct: 129 AIHVPGHSPGSLVYYCAAEHCMFSGDVLFQGSIGRADLAGGNFDELIEHICSRLFILPNE 188

Query: 190 ISFVCGHGPNSTIGRERRLNPFLK 213
                GHG  +TIG E+  NPF +
Sbjct: 189 TIVYPGHGAPTTIGVEKAENPFFR 212


>gi|325297808|ref|YP_004257725.1| beta-lactamase domain-containing protein [Bacteroides salanitronis
           DSM 18170]
 gi|324317361|gb|ADY35252.1| beta-lactamase domain protein [Bacteroides salanitronis DSM 18170]
          Length = 212

 Score =  115 bits (289), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 69/204 (33%), Positives = 104/204 (50%), Gaps = 6/204 (2%)

Query: 14  FKQNCTFLFDEESLEAVVVDPGG----DLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAA 69
           F  NC  L DE   EAVV+D G     +   +K  I   +  +K +  TH H+DHV G  
Sbjct: 11  FPVNCYVLSDETG-EAVVIDAGCYYPEEQQKLKQYINGNHLRIKHLLNTHLHLDHVFGNP 69

Query: 70  QLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFK 129
            +  + +L      KD+  ++ ++  Q        N        ++ DGD +  G    K
Sbjct: 70  FMLREFNLRAEANRKDEF-LLDRLPAQCHAFGFPPNEPPVPLGGYVSDGDIIRFGNTELK 128

Query: 130 VFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDE 189
             H PGHSPG ++Y +  ++ A  GD LFR SIGR D+  GD+ +L++ I +K+  L DE
Sbjct: 129 AIHVPGHSPGSIVYYDAAHSCAFSGDVLFRGSIGRADLEGGDFGELMDGIVSKLFTLPDE 188

Query: 190 ISFVCGHGPNSTIGRERRLNPFLK 213
                GHG ++TIG+E+  NP+ K
Sbjct: 189 TVVYPGHGDSTTIGKEKIDNPYFK 212


>gi|319902423|ref|YP_004162151.1| metallo-beta-lactamase [Bacteroides helcogenes P 36-108]
 gi|319417454|gb|ADV44565.1| putative metallo-beta-lactamase [Bacteroides helcogenes P 36-108]
          Length = 212

 Score =  115 bits (289), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 64/204 (31%), Positives = 108/204 (52%), Gaps = 6/204 (2%)

Query: 14  FKQNCTFLFDEESLEAVVVDPGG----DLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAA 69
           F +NC  L+DE + EAVV+DPG     +   +K+ I +   ++K +  TH H+DH+ G  
Sbjct: 11  FPENCYVLWDETN-EAVVIDPGCFYEEEKQALKNFITNNGLNIKHLLNTHLHLDHIFGNP 69

Query: 70  QLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFK 129
            + ++  L     ++ D   + +  +Q+R+   ++         +L DGD +  G    +
Sbjct: 70  FMLKEFGLKAEA-NQADEFWIDEAPKQSRMFGFQLQEPPVPLGNYLHDGDIITFGNTKLE 128

Query: 130 VFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDE 189
             H PGHSPG ++Y    ++    GD LF+ SIGR D+  G++ +LI  I +++  L +E
Sbjct: 129 AIHVPGHSPGSLVYYCAADHCMFSGDVLFQGSIGRADLAGGNFDELIEHICSRLFVLPNE 188

Query: 190 ISFVCGHGPNSTIGRERRLNPFLK 213
                GHG  +TIG E+  NPF +
Sbjct: 189 TVVYPGHGAPTTIGIEKAENPFFR 212


>gi|312880416|ref|ZP_07740216.1| beta-lactamase domain protein [Aminomonas paucivorans DSM 12260]
 gi|310783707|gb|EFQ24105.1| beta-lactamase domain protein [Aminomonas paucivorans DSM 12260]
          Length = 209

 Score =  115 bits (289), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 71/196 (36%), Positives = 108/196 (55%), Gaps = 9/196 (4%)

Query: 20  FLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLKEDLSLTI 79
           +L  +E   A +VDPGG+   ++  ++ +   ++ I +THGH DH+GG  Q++  LS   
Sbjct: 16  YLVWDEGGHAFLVDPGGEASEVRAFLEDKGLTLEWIVLTHGHGDHIGGLPQMR-PLSRCG 74

Query: 80  IGPHKDDAAMMGKVDEQARLLSIRMNARNA--SSDRWLQDGDTLLLGTHIFKVFHCPGHS 137
           +  H+ DA M+    E  + LS  M    +   ++R L DG+ L +G+   +V H PGH+
Sbjct: 75  VAIHRGDADML---LEPGKNLSTFMGEPLSFDPAERILADGEELAVGSLTVRVIHTPGHT 131

Query: 138 PGHV--IYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEISFVCG 195
           PG +  +    E      GDTLF  SIGRTD L G  ++L+ +    +  L DE+  + G
Sbjct: 132 PGGICLLVTEGEERVLFAGDTLFARSIGRTD-LPGGSEELLEASLRVLAELPDELRVLPG 190

Query: 196 HGPNSTIGRERRLNPF 211
           HGP + IG ERR NPF
Sbjct: 191 HGPETRIGEERRNNPF 206


>gi|256419464|ref|YP_003120117.1| beta-lactamase do