PSIBLAST alignment of GI: 254780758 and protein with PDB id: 2p18

>gi|165760938|pdb|2P18|A Chain A, Crystal Structure Of The Leishmania Infantum Glyoxalase Ii Length = 311
>gi|165760939|pdb|2P1E|A Chain A, Crystal Structure Of The Leishmania Infantum Glyoxalase Ii With D-Lactate At The Active Site Length = 311
 Score = 56.6 bits (135), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 41/216 (18%), Positives = 63/216 (29%), Gaps = 35/216 (16%)

Query: 6   FHIVQVTPFKQN-CTFLFDEESLEAVVVDPGGDLDIIKDVIQSR-----NFHVKQ----I 55
           F +  V   K N    + D  +     VD   D   I   I+       N  V      I
Sbjct: 29  FSVTVVPTLKDNFSYLINDHTTHTLAAVDVNADYKPILTYIEEHLKQQGNADVTYTFSTI 88

Query: 56  WITHGHVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWL 115
             TH H DH                G  K  A +         ++    N    +  + +
Sbjct: 89  LSTHKHWDHS--------------GGNAKLKAELEAMNSTVPVVVVGGANDSIPAVTKPV 134

Query: 116 QDGDTLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRT----DILHGD 171
           ++GD + +G    +V   P H+ GHV+Y        + G  LF               GD
Sbjct: 135 REGDRVQVGDLSVEVIDAPCHTRGHVLYKVQHPQHPNDGVALFTGDTMFIAGIGAFFEGD 194

Query: 172 YQQLINSINNKI-------LPLGDEISFVCGHGPNS 200
            + +  ++             L        GH   S
Sbjct: 195 EKDMCRAMEKVYHIHKGNDYALDKVTFIFPGHEYTS 230