PSIBLAST alignment of GI: 254780758 and protein with PDB id: 2zo4

gi|225698002|pdb|2ZO4|A Chain A, Crystal Structure Of Metallo-Beta-Lactamase Family Protein Ttha1429 From Thermus Thermophilus Hb8 Length = 317
 Score = 47.4 bits (111), Expect = 0.001,   Method: Composition-based stats.
 Identities = 45/238 (18%), Positives = 76/238 (31%), Gaps = 47/238 (19%)

Query: 9   VQVT-PFKQ-NCTFLFDEESLEAVVVDPGGDLDIIKDVIQ----SRNF---HVKQIWITH 59
           V +  P K  N   L  + + E  +VD        +  ++            VK I +TH
Sbjct: 13  VPIPYPLKTVNLYLL--QGAGEVALVDTALGTRAARGALELHLAELGLCFQDVKTILLTH 70

Query: 60  GHVDHVGGAAQLKEDLSLTIIGPHKDDA---AMMGKVDEQARLLSI-------------- 102
            H DH G +    E L   +    ++ A       + +  A                   
Sbjct: 71  HHPDHYGLSG-FFEGLGARVFLHEEEFARGHRFWREPEAFAEASWRLFLDHGTPEGALQG 129

Query: 103 --------RMNARNASSDRWLQDGDTLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLG 154
                   R       +   L+DG+ L +     +V   PGH+ GH  +   E      G
Sbjct: 130 IRETVEKTRERVHPPQNPLPLRDGEALEVAGKRLRVLWTPGHADGHAAFYLEEEGVLLAG 189

Query: 155 DTLFRSSIGRTDILHGDYQ----QLINSINNKILPLGDEISFVCGH-GPNSTIGRERR 207
           D L         +     +      + S+ +++  LG  ++   GH GP   I   R+
Sbjct: 190 DALLEKVSPNVGLWAYTRENPLKDFLRSL-DRLADLGARVA-YAGHFGP---IADVRQ 242