PSIBLAST alignment of GI: 254780758 and protein with PDB id: 2zwr

gi|260656160|pdb|2ZWR|A Chain A, Crystal Structure Of Ttha1623 From Thermus Thermophilus Hb8 Length = 207
>gi|260656161|pdb|2ZWR|B Chain B, Crystal Structure Of Ttha1623 From Thermus Thermophilus Hb8 Length = 207
 Score =  145 bits (367), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 71/210 (33%), Positives = 102/210 (48%), Gaps = 13/210 (6%)

Query: 6   FHIVQV--TPFKQNCTFLFDEESLEA-VVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHV 62
             +  V   P ++N   +   E+ E  V++DPG + + +  + Q+       I +TH H 
Sbjct: 1   MRVFPVTLGPLQENAYLV---ETGEGPVLIDPGDEPEKLLALFQTTGLIPLAILLTHAHF 57

Query: 63  DHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLL 122
           DHVG  A L E L L +   H  D  +    D  AR   + +  +     R L++G  L 
Sbjct: 58  DHVGAVAPLVEALDLPVY-LHPLDLPLYEGADLAARAWGLAI-PKPPLPVRPLEEGMRL- 114

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
                F+V H PGHSPGHV + + E      GD LFR S+GR D+   D + L  S+  +
Sbjct: 115 ---FGFQVLHLPGHSPGHVAFYDPEGAQVFSGDLLFRGSVGRYDLPGADPKALFASLK-R 170

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           +L L  E     GHGP +T+G E R NPFL
Sbjct: 171 LLSLPPETRVHPGHGPGTTLGLEARTNPFL 200