BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780758|ref|YP_003065171.1| hypothetical protein
CLIBASIA_03225 [Candidatus Liberibacter asiaticus str. psy62]
         (216 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|238025885|ref|YP_002910116.1| beta-lactamase-like protein [Burkholderia glumae BGR1]
 gi|237875079|gb|ACR27412.1| Beta-lactamase-like protein [Burkholderia glumae BGR1]
          Length = 215

 Score =  204 bits (518), Expect = 8e-51,   Method: Composition-based stats.
 Identities = 87/211 (41%), Positives = 131/211 (62%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +   ++ VTPF+QNC+ +  E++  A VVDPGGDL+ I++ ++ +   V+++ +THGH+D
Sbjct: 1   MKVTLIPVTPFQQNCSLIVCEQTGRAAVVDPGGDLERIREQVEQQGVQVEKVLVTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H  GA  L     + I GPH+D+   + ++  Q+        A     DRWL DGD + +
Sbjct: 61  HCAGAKALAAHYGVPIEGPHEDERFWIEQLPSQSERFGFGAKAEVFEPDRWLTDGDAVTV 120

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V+HCPGH+PGHV++ +  +  A +GD LF  SIGRTD   G+++ L+ SI  K+
Sbjct: 121 GDETLEVYHCPGHTPGHVVFFSRAHRLAIVGDVLFAGSIGRTDFPRGNHEDLVRSIREKL 180

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
            PLGD++ FV GHGP ST G ER  NPF+  
Sbjct: 181 WPLGDDVRFVPGHGPVSTFGNERATNPFVAD 211


>gi|254250881|ref|ZP_04944199.1| Beta-lactamase-like [Burkholderia dolosa AUO158]
 gi|124893490|gb|EAY67370.1| Beta-lactamase-like [Burkholderia dolosa AUO158]
          Length = 278

 Score =  202 bits (514), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 93/214 (43%), Positives = 130/214 (60%), Gaps = 1/214 (0%)

Query: 3   KLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHV 62
            +   ++ VTPF+QNC+ L  E +  A VVDPGGDL+ I+  I  +N  V ++ +THGHV
Sbjct: 64  SMKVTLIPVTPFQQNCSLLVCENTGRAAVVDPGGDLERIEQEIARQNVQVDKVLLTHGHV 123

Query: 63  DHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLL 122
           DH  GA  L     + I GPH+D+   + ++  Q++       A     DRWL DGDT+ 
Sbjct: 124 DHCAGAKALATRYGVPIEGPHEDERFWIEQLPMQSQRFGFPA-AEAFEPDRWLNDGDTVR 182

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
            G     V+HCPGH+PGHV++ +  +  A +GD LF  SIGRTD   G++  L+ SI  K
Sbjct: 183 FGDETLDVYHCPGHTPGHVVFFSRPHRVAIVGDVLFAGSIGRTDFPRGNHADLVRSIKEK 242

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           + PLGD+++FV GHGP ST G ERR NPF+   +
Sbjct: 243 LWPLGDDVTFVPGHGPVSTFGDERRTNPFVSDKV 276


>gi|253688169|ref|YP_003017359.1| beta-lactamase domain protein [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|251754747|gb|ACT12823.1| beta-lactamase domain protein [Pectobacterium carotovorum subsp.
           carotovorum PC1]
          Length = 215

 Score =  202 bits (514), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 102/212 (48%), Positives = 141/212 (66%), Gaps = 1/212 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + IV VT F QNCT L+ E++ EA +VDPGGD + IK  +      VKQI +THGH+D
Sbjct: 1   MKYQIVPVTAFSQNCTLLWCEKTNEAAIVDPGGDAEKIKRAVADAGISVKQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L E   + IIGP  +DA  +  +  Q+R+  +   A   +  RWLQ+GD + L
Sbjct: 61  HVGAAAELAEHYQVAIIGPQIEDAFWLEGLPAQSRMFGLEECA-PLTPSRWLQEGDEVSL 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     VFHCPGH+PGH+++ + E+  A +GD +F   +GRTD   GD+Q LI SI NK+
Sbjct: 120 GETTLAVFHCPGHTPGHIVFFDAESRLAQVGDVIFNGGVGRTDFPQGDHQALIASIKNKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSN 215
           LPLGD+++F+ GHGP ST+G ERR NPFL+ +
Sbjct: 180 LPLGDDVTFIPGHGPMSTLGYERRTNPFLRED 211


>gi|271500172|ref|YP_003333197.1| beta-lactamase domain-containing protein [Dickeya dadantii Ech586]
 gi|270343727|gb|ACZ76492.1| beta-lactamase domain protein [Dickeya dadantii Ech586]
          Length = 212

 Score =  202 bits (513), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 96/211 (45%), Positives = 138/211 (65%), Gaps = 1/211 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + I+ VT F QNCT L+ E++L+A +VDPGG+ D IK  +      V QI +THGH+D
Sbjct: 1   MKYQIIPVTAFSQNCTLLWCEKTLQAAIVDPGGEADKIKQAVAQAGVTVTQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA L E     I+GP ++DA  +  +  Q+R+  +       +  RWL+DGDT+ +
Sbjct: 61  HVGAAAALSEYFQAPIVGPQREDAFWLDGLPAQSRMFGLNDC-PPLTPARWLEDGDTVTV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G  +  V HCPGH+PGHV++V+ +  FA +GD +FR  +GR+D   G++Q LI SI  K+
Sbjct: 120 GESVLSVLHCPGHTPGHVVFVDKQARFAQVGDVIFRGGVGRSDFPQGNHQALIASIRTKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
            PLGD+I+F+ GHGP ST G ERR NPF++ 
Sbjct: 180 FPLGDDIAFIPGHGPMSTFGEERRTNPFVRD 210


>gi|37525684|ref|NP_929028.1| hypothetical protein plu1749 [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|36785112|emb|CAE14042.1| unnamed protein product [Photorhabdus luminescens subsp. laumondii
           TTO1]
          Length = 215

 Score =  202 bits (513), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 91/213 (42%), Positives = 139/213 (65%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + I+ VT F QNCT +++E+S EA +VDPGG+ + +   I+ R   + QI +THGH D
Sbjct: 1   MKYQIIPVTAFMQNCTLIWNEDSKEAAIVDPGGEAEKLIAEIERRGLKLTQILLTHGHFD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG  A++ +  +  + GP ++DA  +  +  Q+R+  I     +   DRWL +GD L +
Sbjct: 61  HVGATAEVAKHFNAPVYGPQQEDAFWIEGLQAQSRMFGIEEC-PSFEPDRWLNEGDELRV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGH+PGHV++VN  +   ++GD LF+  +GR+D   G+++QLINSI +K+
Sbjct: 120 GGVDLSVLHCPGHTPGHVVFVNHVDKLIYMGDVLFKGGVGRSDFPRGNHRQLINSIKDKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           LPLGD+  F+ GHGP ST+G ER+ NPFL+  +
Sbjct: 180 LPLGDDYEFIPGHGPMSTLGHERQTNPFLQDEV 212


>gi|251789273|ref|YP_003003994.1| beta-lactamase domain-containing protein [Dickeya zeae Ech1591]
 gi|247537894|gb|ACT06515.1| beta-lactamase domain protein [Dickeya zeae Ech1591]
          Length = 212

 Score =  202 bits (513), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 97/211 (45%), Positives = 137/211 (64%), Gaps = 1/211 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + I+ VT F QNCT L+ E++L+A +VDPGG+ D IK  +      + QI +THGH+D
Sbjct: 1   MKYQIIPVTAFGQNCTLLWCEKTLQAAIVDPGGEADKIKQAVAQAGVTITQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG A  L E     I+GP + DA  +  +  Q+R+  +       +  RWL+DGDT+ L
Sbjct: 61  HVGAAVALAEHFQAPIVGPQRADAFWLDGLPAQSRMFGLSDC-PPLTPTRWLEDGDTITL 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G  +  V HCPGH+PGHV++V+  + FA +GD +FR  +GR+D   GD+Q LI SI NK+
Sbjct: 120 GESVLSVLHCPGHTPGHVVFVDKLSRFAQVGDVIFRGGVGRSDFPQGDHQALIASIRNKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
            PLGD+I+F+ GHGP ST G ERR NPF++ 
Sbjct: 180 FPLGDDIAFIPGHGPMSTFGEERRTNPFVRD 210


>gi|227111941|ref|ZP_03825597.1| putative metallo-beta-lactamase [Pectobacterium carotovorum subsp.
           brasiliensis PBR1692]
          Length = 215

 Score =  201 bits (512), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 99/212 (46%), Positives = 141/212 (66%), Gaps = 1/212 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + IV VT F QNCT L+ E++ EA +VDPGGD + IK  +      VKQ+ +THGH+D
Sbjct: 1   MKYQIVPVTAFSQNCTLLWCEKTNEAAIVDPGGDAEKIKRAVADAGISVKQVLLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L E   + IIGP  +DA  +  +  Q+R+  +   A   +  RWLQ+GD + +
Sbjct: 61  HVGAAAELAEHYQVAIIGPQIEDAFWLEGLPAQSRMFGLEECA-PLTPSRWLQEGDEVNV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     VFHCPGH+PGH+++ + E+  A +GD +F   +GRTD   GD+Q LI SI NK+
Sbjct: 120 GETTLAVFHCPGHTPGHIVFFDAESRLAQVGDVIFNGGVGRTDFPQGDHQALIASIKNKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSN 215
           LPLGD+++F+ GHGP ST+G ER+ NPFL+ +
Sbjct: 180 LPLGDDVTFIPGHGPMSTLGHERKTNPFLRED 211


>gi|83720137|ref|YP_443645.1| metallo-beta-lactamase family protein [Burkholderia thailandensis
           E264]
 gi|167620794|ref|ZP_02389425.1| metallo-beta-lactamase family protein [Burkholderia thailandensis
           Bt4]
 gi|83653962|gb|ABC38025.1| metallo-beta-lactamase family protein [Burkholderia thailandensis
           E264]
          Length = 214

 Score =  201 bits (512), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 91/213 (42%), Positives = 133/213 (62%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +   ++ VTPF+QNC+ L  E++  A VVDPGGD ++I+  +  +N  V+++ +THGHVD
Sbjct: 1   MKVTLIPVTPFQQNCSLLVCEKTGRAAVVDPGGDFELIEQEVARQNVRVEKVLLTHGHVD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H  GA +L     + I GPH+D+   + K+  Q+        A     DRWL DG+++  
Sbjct: 61  HCAGAKRLAAHYGVPIEGPHEDERFWIEKLPMQSERFGFPA-AEAFEPDRWLDDGESVTF 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V+HCPGH+PGHV++ +  +  A +GD LF  SIGRTD   G++  LI SI  K+
Sbjct: 120 GEETLEVYHCPGHTPGHVVFFSRAHRLAIVGDVLFAGSIGRTDFPRGNHADLIRSIREKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            PLGD+++FV GHGP ST G ERR NPF+   +
Sbjct: 180 WPLGDDVTFVPGHGPVSTFGDERRTNPFVADGV 212


>gi|167582679|ref|ZP_02375553.1| metallo-beta-lactamase family protein [Burkholderia thailandensis
           TXDOH]
          Length = 214

 Score =  201 bits (511), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 93/213 (43%), Positives = 134/213 (62%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +   ++ VTPF+QNC+ L  E++  A VVDPGGDL++I+  +  +N  V+++ +THGHVD
Sbjct: 1   MKVTLIPVTPFQQNCSLLVCEKTGRAAVVDPGGDLELIEQEVARQNVRVEKVLLTHGHVD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H  GA +L     + I GPH+D+   + K+  Q+        A     DRWL DG+T+  
Sbjct: 61  HCAGAKRLAAHYGVPIEGPHEDERFWIEKLPMQSERFGFPA-AEAFEPDRWLDDGETVTF 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V+HCPGH+PGHV++ +  +  A +GD LF  SIGRTD   G++  LI SI  K+
Sbjct: 120 GEETLEVYHCPGHTPGHVVFFSRAHRLAIVGDVLFAGSIGRTDFPRGNHADLIRSIREKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            PLGD+++FV GHGP ST G ERR NPF+   +
Sbjct: 180 WPLGDDVTFVPGHGPVSTFGDERRTNPFVADGV 212


>gi|307131494|ref|YP_003883510.1| putative metal-binding enzyme [Dickeya dadantii 3937]
 gi|306529023|gb|ADM98953.1| predicted metal-binding enzyme [Dickeya dadantii 3937]
          Length = 212

 Score =  201 bits (510), Expect = 8e-50,   Method: Composition-based stats.
 Identities = 95/211 (45%), Positives = 140/211 (66%), Gaps = 1/211 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + I+ VT F QNCT L+ E++L+A +VDPGG+ D IK V+      V QI +THGH+D
Sbjct: 1   MKYQIIPVTAFSQNCTLLWCEKTLQAAIVDPGGEADKIKQVVAQTGVTVTQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA L E   + I+GP + DA  +  +  Q+R+  +          RWL++GDT+ +
Sbjct: 61  HVGAAAALAEYFQVPIVGPQQADAFWLDGLPAQSRMFGLDDC-PPLVPTRWLEEGDTVAI 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G  +  V HCPGH+PGHV++++ +  FA +GD +FR  +GR+D   G++Q L++SI NK+
Sbjct: 120 GESVLSVLHCPGHTPGHVVFIDEQARFAQVGDVIFRGGVGRSDFPQGNHQALVDSIRNKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
            PLGD+I F+ GHGP ST+G ERR NPF++ 
Sbjct: 180 FPLGDDIVFIPGHGPTSTLGEERRTNPFVRD 210


>gi|330815176|ref|YP_004358881.1| Beta-lactamase-like protein [Burkholderia gladioli BSR3]
 gi|327367569|gb|AEA58925.1| Beta-lactamase-like protein [Burkholderia gladioli BSR3]
          Length = 215

 Score =  200 bits (508), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 89/211 (42%), Positives = 135/211 (63%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +   ++ VTPF+QNC+ +  E++  A VVDPGGDL++I+  ++ +   V+++ ITHGH+D
Sbjct: 1   MKVTLIPVTPFQQNCSLIVCEQTGRAAVVDPGGDLELIRGEVERQQAKVEKVLITHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H  GA  L E   + I GPH+++   + ++  Q++       A      RWL DGDT+ +
Sbjct: 61  HCAGAKALAEHYGVPIEGPHEEERFWIDQLPAQSQRFGFGGAAEAFEPARWLGDGDTVTV 120

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V+HCPGH+PGHV++ + E+  A +GD LF  SIGRTD   G+++ L+ SI  K+
Sbjct: 121 GAETLEVYHCPGHTPGHVVFFSREHRLAIVGDVLFAGSIGRTDFPRGNHEDLLRSIREKL 180

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
            PLGD+++FV GHGP ST G ER  NPF+  
Sbjct: 181 WPLGDDVTFVPGHGPVSTFGDERESNPFVAD 211


>gi|253990244|ref|YP_003041600.1| hypothetical protein PAU_02767 [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253781694|emb|CAQ84857.1| conserved hypothetical protein [Photorhabdus asymbiotica]
          Length = 215

 Score =  199 bits (507), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 93/213 (43%), Positives = 140/213 (65%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + I+ VT F QNCT +++EE+ EA +VDPGG+   +   I++R   + QI +THGH D
Sbjct: 1   MKYQIIPVTAFMQNCTLIWNEETNEAAIVDPGGEAAKLIAEIENRGLKLTQILLTHGHFD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG  A++ +  ++ + GP ++DA  +  +  Q+R+  I     +   DRWL +GD L +
Sbjct: 61  HVGATAEVAKHFNVPVYGPQQEDAFWIEGLQAQSRMFGIEEC-PSFEPDRWLNEGDELRV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGH+PGHV++VN  +   ++GD LF+  IGR+D   G++QQLINSI +K+
Sbjct: 120 GGIDLSVLHCPGHTPGHVVFVNHADKLIYMGDVLFKGGIGRSDFPRGNHQQLINSIKDKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           LPLGD+  F+ GHGP ST+G ER+ NPFL+  +
Sbjct: 180 LPLGDDYEFIPGHGPMSTLGYERQTNPFLQDEV 212


>gi|261821334|ref|YP_003259440.1| beta-lactamase [Pectobacterium wasabiae WPP163]
 gi|261605347|gb|ACX87833.1| beta-lactamase domain protein [Pectobacterium wasabiae WPP163]
          Length = 215

 Score =  198 bits (504), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 101/212 (47%), Positives = 140/212 (66%), Gaps = 1/212 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + IV VT F QNCT L+ E++ EA +VDPGGD + IK  +      VKQI +THGH+D
Sbjct: 1   MKYQIVPVTAFSQNCTLLWCEKTNEAAIVDPGGDAEKIKHAVADAGILVKQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L E   + IIGP  +DA  +  +  Q+R+  +   A   +  RWLQDGD   +
Sbjct: 61  HVGAAAELAEHYQVPIIGPQIEDAFWLEGLPAQSRMFGLEECA-PLTPSRWLQDGDEARV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     VFHCPGH+PGH+++ + E+  A +GD +F   +GRTD   GD+Q LI SI NK+
Sbjct: 120 GETTLAVFHCPGHTPGHIVFFDAESRLAQVGDVIFNGGVGRTDFPQGDHQALIASIKNKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSN 215
           LPLGD+++F+ GHGP ST+G ER+ NPFL+ +
Sbjct: 180 LPLGDDVTFIPGHGPMSTLGHERKTNPFLRED 211


>gi|292492147|ref|YP_003527586.1| beta-lactamase [Nitrosococcus halophilus Nc4]
 gi|291580742|gb|ADE15199.1| beta-lactamase domain protein [Nitrosococcus halophilus Nc4]
          Length = 212

 Score =  198 bits (503), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 99/212 (46%), Positives = 136/212 (64%), Gaps = 1/212 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + F I+ VT F QNCT L  EE+ +A VVDPGGDLD I + +++    +++I +THGH+D
Sbjct: 1   MKFEILPVTRFMQNCTLLGCEETGKAAVVDPGGDLDQILEKVEASQLKIEKILVTHGHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GG  +L   L + I GP  +D   +  +  Q+ +      A     DRWL+ GDT+  
Sbjct: 61  HAGGVTELARRLDVPIEGPQIEDKFWIDSLPSQSEMFGFPP-AEAFVPDRWLEQGDTVSF 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G  +  V+HCPGH+PGHVI+ + +++ A +GD LF+ SIGRTD   GDY  LI SI  ++
Sbjct: 120 GKVVLNVYHCPGHTPGHVIFFHLDSHLALVGDVLFQGSIGRTDFPRGDYDALIRSIRERL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSN 215
           LPLGDE+ F+ GHGP ST G ERR NPFL+ N
Sbjct: 180 LPLGDEVRFIPGHGPMSTFGEERRSNPFLREN 211


>gi|227329502|ref|ZP_03833526.1| putative metallo-beta-lactamase [Pectobacterium carotovorum subsp.
           carotovorum WPP14]
          Length = 215

 Score =  198 bits (503), Expect = 5e-49,   Method: Composition-based stats.
 Identities = 99/212 (46%), Positives = 140/212 (66%), Gaps = 1/212 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + IV VT F QNCT L+ E++ EA +VDPGGD + IK  +      VKQI +THGH+D
Sbjct: 1   MKYQIVPVTAFSQNCTLLWCEKTNEAAIVDPGGDAEKIKRAVADAGISVKQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L E   + IIGP  +DA  +  +  Q+R+  +   A   +  RWLQ+GD + +
Sbjct: 61  HVGAAAELAEHYQVAIIGPQIEDAFWLEGLPAQSRMFGLEECA-PLTPSRWLQEGDEVSV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     VFHCPGH+PGH+++ + E+  A +GD +F   +GRTD   GD+Q LI SI NK+
Sbjct: 120 GETTLAVFHCPGHTPGHIVFFDAESRLAQVGDVIFNGGVGRTDFPQGDHQALIASIKNKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSN 215
           LPLGD+++F+ GHGP S +G ER+ NPFL+ +
Sbjct: 180 LPLGDDVTFIPGHGPMSNLGHERKTNPFLRED 211


>gi|167587814|ref|ZP_02380202.1| beta-lactamase domain protein [Burkholderia ubonensis Bu]
          Length = 214

 Score =  198 bits (503), Expect = 5e-49,   Method: Composition-based stats.
 Identities = 92/213 (43%), Positives = 131/213 (61%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +   ++ VTPF+QNC+ L  E +  A VVDPGGDL+ I+  +  +N  V+++ +THGH+D
Sbjct: 1   MKVTLIPVTPFQQNCSLLVCEATGRAAVVDPGGDLERIEQEVARQNAQVEKVLLTHGHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H  GA  L     + I GPH+D+   + K+  Q+        A     DRWL DGDT+  
Sbjct: 61  HCAGAKALATRYGVPIEGPHEDERFWIDKLPTQSERFGFPA-ADAFEPDRWLNDGDTVQF 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V+HCPGH+PGHV++ +  +  A +GD LF  SIGRTD   G++  L+ SI  K+
Sbjct: 120 GDETLEVYHCPGHTPGHVVFFSRPHRLAIVGDVLFAGSIGRTDFPRGNHADLVRSIKEKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            PLGD+++FV GHGP ST G ERR NPF+   +
Sbjct: 180 WPLGDDVTFVPGHGPVSTFGDERRTNPFVSDKV 212


>gi|220925685|ref|YP_002500987.1| beta-lactamase domain-containing protein [Methylobacterium nodulans
           ORS 2060]
 gi|219950292|gb|ACL60684.1| beta-lactamase domain protein [Methylobacterium nodulans ORS 2060]
          Length = 213

 Score =  198 bits (503), Expect = 5e-49,   Method: Composition-based stats.
 Identities = 106/206 (51%), Positives = 138/206 (66%), Gaps = 1/206 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           I+ VTPF+QNCT L+ E +  A VVDPGGDLD I   ++     V++I +THGH+DH GG
Sbjct: 9   IIPVTPFQQNCTLLWCEATKRAAVVDPGGDLDRILAAVEKTGVAVEKILLTHGHIDHAGG 68

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           AA+LKE L + I GPH  D  ++ ++        I   AR  + DRWL +GDT+ +G   
Sbjct: 69  AAELKERLGVPIEGPHAADKPLLDRLPGTGAAYGI-EGARAVTPDRWLGEGDTVTIGELT 127

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
           F V HCPGHSPG V+ V+ E  FA +GD LFR S+GRTD+  GD+  LI SI  K+LPLG
Sbjct: 128 FDVLHCPGHSPGSVVLVSREARFAQVGDVLFRGSVGRTDLPGGDHAALIASIKTKLLPLG 187

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLK 213
           D+++F+ GHGP STIG ER  NPFL+
Sbjct: 188 DDLAFIPGHGPTSTIGEERLTNPFLQ 213


>gi|107024365|ref|YP_622692.1| beta-lactamase-like [Burkholderia cenocepacia AU 1054]
 gi|105894554|gb|ABF77719.1| beta-lactamase-like protein [Burkholderia cenocepacia AU 1054]
          Length = 237

 Score =  198 bits (503), Expect = 5e-49,   Method: Composition-based stats.
 Identities = 90/215 (41%), Positives = 133/215 (61%), Gaps = 1/215 (0%)

Query: 2   SKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGH 61
           + +   ++ VTPF+QNC+ L  E++  A VVDPGGDLD I+  +  +N  V+++ +THGH
Sbjct: 22  APMKVTLIPVTPFQQNCSLLVCEKTGRAAVVDPGGDLDRIEQEVARQNVQVEKVLLTHGH 81

Query: 62  VDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
           +DH  GA  L     + I GP +++   + K+  Q+        A     D+WL DGDT+
Sbjct: 82  IDHCAGAKTLATRYGVPIEGPQEEERFWIEKLPMQSERFGFPA-ADVFEPDQWLNDGDTV 140

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
             G    +V+HCPGH+PGHV++ +  +  A +GD LF  SIGRTD   G+++ L+ SI  
Sbjct: 141 RFGDETLEVYHCPGHTPGHVVFFSRAHRVAIVGDVLFAGSIGRTDFPRGNHEDLVRSIKE 200

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           K+ PLGD+++FV GHGP ST G ERR NPF+   +
Sbjct: 201 KLWPLGDDVTFVPGHGPVSTFGDERRTNPFVSDKV 235


>gi|53723970|ref|YP_104416.1| metallo-beta-lactamase family protein [Burkholderia mallei ATCC
           23344]
 gi|67643050|ref|ZP_00441799.1| metallo-beta-lactamase family protein [Burkholderia mallei GB8
           horse 4]
 gi|121601063|ref|YP_994679.1| metallo-beta-lactamase family protein [Burkholderia mallei SAVP1]
 gi|124385527|ref|YP_001027612.1| metallo-beta-lactamase family protein [Burkholderia mallei NCTC
           10229]
 gi|126449497|ref|YP_001082489.1| metallo-beta-lactamase family protein [Burkholderia mallei NCTC
           10247]
 gi|126452838|ref|YP_001068123.1| metallo-beta-lactamase family protein [Burkholderia pseudomallei
           1106a]
 gi|167001305|ref|ZP_02267104.1| metallo-beta-lactamase family protein [Burkholderia mallei PRL-20]
 gi|167744646|ref|ZP_02417420.1| metallo-beta-lactamase family protein [Burkholderia pseudomallei
           14]
 gi|167851625|ref|ZP_02477133.1| metallo-beta-lactamase family protein [Burkholderia pseudomallei
           B7210]
 gi|217423912|ref|ZP_03455412.1| metallo-beta-lactamase family protein [Burkholderia pseudomallei
           576]
 gi|242316833|ref|ZP_04815849.1| metallo-beta-lactamase family protein [Burkholderia pseudomallei
           1106b]
 gi|254175066|ref|ZP_04881727.1| metallo-beta-lactamase family protein [Burkholderia mallei ATCC
           10399]
 gi|254194751|ref|ZP_04901182.1| metallo-beta-lactamase family protein [Burkholderia pseudomallei
           S13]
 gi|254201491|ref|ZP_04907855.1| metallo-beta-lactamase family protein [Burkholderia mallei FMH]
 gi|254206831|ref|ZP_04913182.1| metallo-beta-lactamase family protein [Burkholderia mallei JHU]
 gi|254357141|ref|ZP_04973415.1| metallo-beta-lactamase family protein [Burkholderia mallei
           2002721280]
 gi|52427393|gb|AAU47986.1| metallo-beta-lactamase family protein [Burkholderia mallei ATCC
           23344]
 gi|121229873|gb|ABM52391.1| metallo-beta-lactamase family protein [Burkholderia mallei SAVP1]
 gi|124293547|gb|ABN02816.1| metallo-beta-lactamase family protein [Burkholderia mallei NCTC
           10229]
 gi|126226480|gb|ABN90020.1| metallo-beta-lactamase family protein [Burkholderia pseudomallei
           1106a]
 gi|126242367|gb|ABO05460.1| metallo-beta-lactamase family protein [Burkholderia mallei NCTC
           10247]
 gi|147747385|gb|EDK54461.1| metallo-beta-lactamase family protein [Burkholderia mallei FMH]
 gi|147752373|gb|EDK59439.1| metallo-beta-lactamase family protein [Burkholderia mallei JHU]
 gi|148026205|gb|EDK84290.1| metallo-beta-lactamase family protein [Burkholderia mallei
           2002721280]
 gi|160696111|gb|EDP86081.1| metallo-beta-lactamase family protein [Burkholderia mallei ATCC
           10399]
 gi|169651501|gb|EDS84194.1| metallo-beta-lactamase family protein [Burkholderia pseudomallei
           S13]
 gi|217392975|gb|EEC32997.1| metallo-beta-lactamase family protein [Burkholderia pseudomallei
           576]
 gi|238524294|gb|EEP87727.1| metallo-beta-lactamase family protein [Burkholderia mallei GB8
           horse 4]
 gi|242140072|gb|EES26474.1| metallo-beta-lactamase family protein [Burkholderia pseudomallei
           1106b]
 gi|243062920|gb|EES45106.1| metallo-beta-lactamase family protein [Burkholderia mallei PRL-20]
          Length = 214

 Score =  197 bits (502), Expect = 6e-49,   Method: Composition-based stats.
 Identities = 94/213 (44%), Positives = 134/213 (62%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +   ++ VTPF+QNC+ L  E++  A VVDPGGDL++I+  +  ++  V+++ +THGHVD
Sbjct: 1   MKVTLIPVTPFQQNCSLLVCEKTGRAAVVDPGGDLELIEQEVARQHVQVEKVLLTHGHVD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H  GA +L     + I GPH+D+   + K+  Q+        A     DRWL DGDTL  
Sbjct: 61  HCAGAKRLAAHYGVPIEGPHEDERFWIEKLPMQSERFGFPA-AEAFEPDRWLADGDTLAF 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V+HCPGH+PGHV++ +  +  A +GD LF  SIGRTD   G++  LI SI  K+
Sbjct: 120 GEETLEVYHCPGHTPGHVVFFSRAHRLAVVGDVLFAGSIGRTDFPRGNHADLIRSIREKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            PLGD+++FV GHGP ST G ERR NPF+   +
Sbjct: 180 WPLGDDVTFVPGHGPVSTFGDERRTNPFVADGV 212


>gi|78064865|ref|YP_367634.1| Beta-lactamase-like [Burkholderia sp. 383]
 gi|77965610|gb|ABB06990.1| Beta-lactamase-like protein [Burkholderia sp. 383]
          Length = 241

 Score =  197 bits (502), Expect = 6e-49,   Method: Composition-based stats.
 Identities = 90/215 (41%), Positives = 132/215 (61%), Gaps = 1/215 (0%)

Query: 2   SKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGH 61
           + +   ++ VTPF+QNC+ L  E++  A VVDPGGDLD I+  +  +N  V+++ +THGH
Sbjct: 26  ASMKVTLIPVTPFQQNCSLLVCEKTGRAAVVDPGGDLDRIEQEVARQNVQVEKVLLTHGH 85

Query: 62  VDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
           +DH  GA  L     + I GP +++   + K+  Q+        A     D WL DGDT+
Sbjct: 86  IDHCAGAKTLATHYGVPIEGPQEEERFWIEKLPMQSERFGFPA-AETFEPDHWLSDGDTV 144

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
             G    +V+HCPGH+PGHV++ +  +  A +GD LF  SIGRTD   G+++ L+ SI  
Sbjct: 145 QFGDETLEVYHCPGHTPGHVVFFSRAHRVAIVGDVLFAGSIGRTDFPRGNHEDLVRSIKE 204

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           K+ PLGD+++FV GHGP ST G ERR NPF+   +
Sbjct: 205 KLWPLGDDVTFVPGHGPVSTFGDERRTNPFVSDKV 239


>gi|126439461|ref|YP_001060816.1| metallo-beta-lactamase family protein [Burkholderia pseudomallei
           668]
 gi|167721647|ref|ZP_02404883.1| metallo-beta-lactamase family protein [Burkholderia pseudomallei
           DM98]
 gi|167904687|ref|ZP_02491892.1| metallo-beta-lactamase family protein [Burkholderia pseudomallei
           NCTC 13177]
 gi|237814213|ref|YP_002898664.1| hydrolase [Burkholderia pseudomallei MSHR346]
 gi|254183854|ref|ZP_04890445.1| metallo-beta-lactamase family protein [Burkholderia pseudomallei
           1655]
 gi|126218954|gb|ABN82460.1| metallo-beta-lactamase family protein [Burkholderia pseudomallei
           668]
 gi|184214386|gb|EDU11429.1| metallo-beta-lactamase family protein [Burkholderia pseudomallei
           1655]
 gi|237506833|gb|ACQ99151.1| hydrolase [Burkholderia pseudomallei MSHR346]
          Length = 214

 Score =  197 bits (502), Expect = 7e-49,   Method: Composition-based stats.
 Identities = 94/213 (44%), Positives = 134/213 (62%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +   ++ VTPF+QNC+ L  E++  A VVDPGGDL++I+  +  ++  V+++ +THGHVD
Sbjct: 1   MKVTLIPVTPFQQNCSLLVCEKTGRAAVVDPGGDLELIEQEVARQHVQVEKVLLTHGHVD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H  GA +L     + I GPH+D+   + K+  Q+        A     DRWL DGDTL  
Sbjct: 61  HCAGAKRLAAHYGVPIEGPHEDERFWIEKLPMQSERFGFPA-AEAFEPDRWLADGDTLAF 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V+HCPGH+PGHV++ +  +  A +GD LF  SIGRTD   G++  LI SI  K+
Sbjct: 120 GEETLEVYHCPGHTPGHVVFFSRAHRLAIVGDVLFAGSIGRTDFPRGNHADLIRSIREKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            PLGD+++FV GHGP ST G ERR NPF+   +
Sbjct: 180 WPLGDDVTFVPGHGPVSTFGDERRTNPFVADGV 212


>gi|254780758|ref|YP_003065171.1| hypothetical protein CLIBASIA_03225 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040435|gb|ACT57231.1| hypothetical protein CLIBASIA_03225 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 216

 Score =  197 bits (501), Expect = 7e-49,   Method: Composition-based stats.
 Identities = 216/216 (100%), Positives = 216/216 (100%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG
Sbjct: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT
Sbjct: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN
Sbjct: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           NKILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI
Sbjct: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216


>gi|50121468|ref|YP_050635.1| putative metallo-beta-lactamase [Pectobacterium atrosepticum
           SCRI1043]
 gi|49611994|emb|CAG75443.1| conserved hypothetical protein [Pectobacterium atrosepticum
           SCRI1043]
          Length = 215

 Score =  197 bits (501), Expect = 7e-49,   Method: Composition-based stats.
 Identities = 100/212 (47%), Positives = 141/212 (66%), Gaps = 1/212 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + IV VT F QNCT L+ E++ EA +VDPGGD + IK  +      VKQI +THGH+D
Sbjct: 1   MKYQIVPVTAFSQNCTLLWCEKTNEASIVDPGGDAEKIKRAVADVGISVKQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L E   + IIGP  +DA  +  +  Q+R+  +   A   +  RWLQ+GD + +
Sbjct: 61  HVGAAAELAEHYQVAIIGPQIEDAFWLEGLPAQSRMFGLEECA-PLTPSRWLQEGDEVNV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     VFHCPGH+PGH+++ + E+  A +GD +F   +GRTD   GD+Q LI SI NK+
Sbjct: 120 GGTTLAVFHCPGHTPGHIVFFDAESRLAQVGDVIFNGGVGRTDFPQGDHQALIASIKNKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSN 215
           LPLGD+++F+ GHGP ST+G ER+ NPFL+ +
Sbjct: 180 LPLGDDVTFIPGHGPMSTLGHERKTNPFLRED 211


>gi|209519172|ref|ZP_03267976.1| beta-lactamase domain protein [Burkholderia sp. H160]
 gi|209500398|gb|EEA00450.1| beta-lactamase domain protein [Burkholderia sp. H160]
          Length = 214

 Score =  197 bits (501), Expect = 8e-49,   Method: Composition-based stats.
 Identities = 96/213 (45%), Positives = 135/213 (63%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +   ++ VTPF+QNC+ L  E +  A VVDPGGDLD+I+  I  +N  V+++ +THGH+D
Sbjct: 1   MKVTLIPVTPFQQNCSLLVCEATGRAAVVDPGGDLDVIQREIARQNVSVEKVLLTHGHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H  GA  L     + I GPH D+   + K+ +Q+        A     DRWLQDGD+   
Sbjct: 61  HCAGAKTLATHYGVPIEGPHPDERFWLDKLPDQSTRFGFPA-ADAFEPDRWLQDGDSAQF 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   F+V+HCPGH+PGHV++ + E+  A +GD LF  SIGRTD   G++  LI SI +K+
Sbjct: 120 GDETFEVYHCPGHTPGHVVFFSREHRLALVGDVLFAGSIGRTDFPRGNHADLIRSIRDKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            PLGD+++FV GHGP ST G ERR NP++   +
Sbjct: 180 WPLGDDVTFVPGHGPTSTFGAERRTNPYVADGV 212


>gi|238763357|ref|ZP_04624321.1| hypothetical protein ykris0001_3130 [Yersinia kristensenii ATCC
           33638]
 gi|238698456|gb|EEP91209.1| hypothetical protein ykris0001_3130 [Yersinia kristensenii ATCC
           33638]
          Length = 215

 Score =  197 bits (501), Expect = 8e-49,   Method: Composition-based stats.
 Identities = 89/211 (42%), Positives = 138/211 (65%), Gaps = 1/211 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + I+ VT F QNCT ++ EE+ +A +VDPGG+ D I   +  +   V QI +THGH+D
Sbjct: 1   MKYQIIPVTAFSQNCTLIWCEETGQAALVDPGGEADKIIAEVTRQGVKVSQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L     + I GP K+DA  +  +  Q+R+  +          RWL++GD + +
Sbjct: 61  HVGAAAELAAHFQVPIYGPEKEDAFWLEGLPAQSRMFGLSEC-EAFLPTRWLEEGDKITV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGH+PGH+++++ +++ A +GD +F   +GR+D   GD+QQLI+SI  K+
Sbjct: 120 GAIELSVLHCPGHTPGHIVFIDQKDHLALVGDVIFNGGVGRSDFPRGDHQQLIHSIRTKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           LPLGD+++F+ GHGP ST+G ER+ NPF++ 
Sbjct: 180 LPLGDDMTFIPGHGPMSTLGHERQTNPFIRE 210


>gi|170743432|ref|YP_001772087.1| beta-lactamase domain-containing protein [Methylobacterium sp.
           4-46]
 gi|168197706|gb|ACA19653.1| beta-lactamase domain protein [Methylobacterium sp. 4-46]
          Length = 213

 Score =  197 bits (501), Expect = 9e-49,   Method: Composition-based stats.
 Identities = 103/206 (50%), Positives = 137/206 (66%), Gaps = 1/206 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           I+ VTPF+QNCT L+ E +  A V+DPGGDLD I   I+     V++I +THGH+DH GG
Sbjct: 9   IIPVTPFQQNCTLLWCEATKRAAVIDPGGDLDRILAAIEKAGVTVEKILLTHGHIDHAGG 68

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           AA+L+E L + I GPH+ D  ++ ++        I   AR  + DRWL +GD + +G   
Sbjct: 69  AAELRERLGVIIEGPHEADKPLLDRLPGTGAAYGI-EGARAVTPDRWLAEGDVVTVGDLS 127

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
           F V HCPGHSPG V+ V+ E  FA +GD LFR S+GRTD+  GD+  LI SI  K+LPLG
Sbjct: 128 FDVLHCPGHSPGSVVLVSREARFAQVGDVLFRGSVGRTDLPGGDHAALIASIKTKLLPLG 187

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLK 213
           D++  + GHGP STIG+ER  NPFL+
Sbjct: 188 DDVVLIPGHGPTSTIGQERLDNPFLQ 213


>gi|295675208|ref|YP_003603732.1| putative metallo-beta-lactamase family protein [Burkholderia sp.
           CCGE1002]
 gi|295435051|gb|ADG14221.1| putative metallo-beta-lactamase family protein [Burkholderia sp.
           CCGE1002]
          Length = 214

 Score =  197 bits (500), Expect = 9e-49,   Method: Composition-based stats.
 Identities = 96/213 (45%), Positives = 136/213 (63%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +   ++ VTPF+QNC+ L  E +  A VVDPGGDLD+I+  I  +N  V+++ +THGH+D
Sbjct: 1   MKVTLIPVTPFQQNCSLLVCETTGRAAVVDPGGDLDLIQREIARQNVAVEKVLLTHGHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H  GA  L     + I GPH D+   + K+ +Q+        A +   DRWLQDGDT+  
Sbjct: 61  HCAGAKTLATHYGVPIEGPHPDERFWLDKLPDQSTRFGFPA-ADSFEPDRWLQDGDTVQF 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   F+V+HCPGH+PGHV++ +  +  A +GD LF  SIGRTD   G++  LI SI +K+
Sbjct: 120 GGENFEVYHCPGHTPGHVVFFSRAHRLALVGDVLFAGSIGRTDFPRGNHADLIRSIRDKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            PLGD+++FV GHGP ST G ERR NP++   +
Sbjct: 180 WPLGDDVTFVPGHGPTSTFGAERRTNPYVADGV 212


>gi|167838272|ref|ZP_02465131.1| metallo-beta-lactamase family protein [Burkholderia thailandensis
           MSMB43]
          Length = 214

 Score =  197 bits (500), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 93/213 (43%), Positives = 134/213 (62%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +   ++ VTPF+QNC+ L  E++  A VVDPGGDL++I+  +  ++  V+++ +THGHVD
Sbjct: 1   MKVTLIPVTPFQQNCSLLVCEKTGRAAVVDPGGDLELIEQEVARQSVQVEKVLLTHGHVD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H  GA +L     + I GPH+D+   + K+  Q+        A     DRWL DGDT+  
Sbjct: 61  HCAGAKRLAAHYGVPIEGPHEDERFWIEKLPMQSERFGFPA-AEAFEPDRWLDDGDTVTF 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V+HCPGH+PGHV++ +  +  A +GD LF  SIGRTD   G++  LI SI  K+
Sbjct: 120 GEETLEVYHCPGHAPGHVVFFSRAHRLAIVGDVLFAGSIGRTDFPRGNHADLIRSIREKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            PLGD+++FV GHGP ST G ERR NPF+   +
Sbjct: 180 WPLGDDVTFVPGHGPVSTFGNERRTNPFVADGV 212


>gi|167564472|ref|ZP_02357388.1| metallo-beta-lactamase family protein [Burkholderia oklahomensis
           EO147]
 gi|167571622|ref|ZP_02364496.1| metallo-beta-lactamase family protein [Burkholderia oklahomensis
           C6786]
          Length = 214

 Score =  197 bits (500), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 93/213 (43%), Positives = 134/213 (62%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +   ++ VTPF+QNC+ L  E++  A +VDPGGDLD+I+  I  +N  V+++ +THGHVD
Sbjct: 1   MKVTLIPVTPFQQNCSLLVCEKTGRAAIVDPGGDLDLIEQEIARQNVEVEKVLLTHGHVD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H  GA +L     ++I GP +++   + K+  Q+        A     DRWL DGDT+  
Sbjct: 61  HCAGAKRLAAHYGVSIEGPQEEERFWIEKLPMQSERFGFPA-AETFEPDRWLDDGDTVTF 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V+HCPGH+PGHV++ +  +  A +GD LF  SIGRTD   G++  LI SI  K+
Sbjct: 120 GGETLEVYHCPGHTPGHVVFFSRAHRLAIVGDVLFAGSIGRTDFPRGNHADLIRSIREKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            PLGD+++FV GHGP ST G ERR NPF+   +
Sbjct: 180 WPLGDDVTFVPGHGPVSTFGDERRTNPFVADGV 212


>gi|294636883|ref|ZP_06715213.1| metallo-beta-lactamase family protein [Edwardsiella tarda ATCC
           23685]
 gi|291089913|gb|EFE22474.1| metallo-beta-lactamase family protein [Edwardsiella tarda ATCC
           23685]
          Length = 229

 Score =  197 bits (500), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 99/212 (46%), Positives = 139/212 (65%), Gaps = 1/212 (0%)

Query: 3   KLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHV 62
           K+ +HI+ VT F+QNCT L+ E++ EA VVDPGG+   I   I +R+  V QI +THGH+
Sbjct: 14  KMKYHIIPVTAFQQNCTLLWCEQTREAAVVDPGGESAKILREIAARDLTVTQILLTHGHI 73

Query: 63  DHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLL 122
           DHVG AA+L + LS+ I GP ++D   + ++ +QA +       +     RWLQ GD L 
Sbjct: 74  DHVGAAARLAQTLSVPIYGPQQEDQYWLEQLSQQADMFGFTDC-QPFMPTRWLQQGDELT 132

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
           +G     V HCPGH+PGHV+Y   +   A +GD LFR SIGR+D   G++Q LINSI  +
Sbjct: 133 VGKERLAVLHCPGHTPGHVVYFCEQARLAQVGDVLFRGSIGRSDFAGGNHQDLINSIWTR 192

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           +  LGD+++F+ GHGP STIG ERR NP+++ 
Sbjct: 193 LFTLGDDVAFIPGHGPMSTIGEERRSNPYVRD 224


>gi|238795869|ref|ZP_04639382.1| Beta-lactamase domain protein [Yersinia mollaretii ATCC 43969]
 gi|238720332|gb|EEQ12135.1| Beta-lactamase domain protein [Yersinia mollaretii ATCC 43969]
          Length = 215

 Score =  196 bits (499), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 88/211 (41%), Positives = 137/211 (64%), Gaps = 1/211 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + I+ VT F QNCT ++ E + +A +VDPGGD + I   +  +  +V+QI +THGH+D
Sbjct: 1   MKYQIIPVTAFSQNCTLIWCEATGQAALVDPGGDAEKIIAEVARQGVNVRQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L     + I GP K+D   +  +  Q+R+  +       +  RWL++GD + +
Sbjct: 61  HVGAAAELASHFDIPIYGPEKEDTFWLEGLPAQSRMFGLDEC-EAFTPTRWLEEGDKVTV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGH+PGH+++++ +   A +GD +F   +GR+D   GD+QQLINSI  K+
Sbjct: 120 GEIELSVLHCPGHTPGHIVFIDQQGRLALVGDVIFNGGVGRSDFPRGDHQQLINSIRTKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           LPLGD+++F+ GHGP ST+G ER+ NPF++ 
Sbjct: 180 LPLGDDMTFIPGHGPMSTLGHERQNNPFIRE 210


>gi|161523374|ref|YP_001578386.1| beta-lactamase domain-containing protein [Burkholderia multivorans
           ATCC 17616]
 gi|189351853|ref|YP_001947481.1| hydroxyacylglutathione hydrolase [Burkholderia multivorans ATCC
           17616]
 gi|221214193|ref|ZP_03587165.1| metallo-beta-lactamase family protein [Burkholderia multivorans
           CGD1]
 gi|160340803|gb|ABX13889.1| beta-lactamase domain protein [Burkholderia multivorans ATCC 17616]
 gi|189335875|dbj|BAG44945.1| hydroxyacylglutathione hydrolase [Burkholderia multivorans ATCC
           17616]
 gi|221165848|gb|EED98322.1| metallo-beta-lactamase family protein [Burkholderia multivorans
           CGD1]
          Length = 214

 Score =  196 bits (499), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 92/213 (43%), Positives = 130/213 (61%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +   ++ VTPF+QNC+ L  E++  A VVDPGGDL+ I+  I  +N  V ++ +THGH+D
Sbjct: 1   MKVTLIPVTPFQQNCSLLVCEKTGRAAVVDPGGDLERIEQEIARQNVQVDKVLLTHGHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H  GA  L     + I GP +D+   + K+  Q+        A     DRWL DGDT+  
Sbjct: 61  HCAGAKTLATHYGVPIEGPQEDERFWIEKLPTQSERFGFPA-AEAFEPDRWLNDGDTVQF 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V+HCPGH+PGHV++ +  +  A +GD LF  SIGRTD   G++  L+ SI  K+
Sbjct: 120 GDETLEVYHCPGHTPGHVVFFSRAHRVAIVGDVLFAGSIGRTDFPRGNHADLVRSIKEKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            PLGD+++FV GHGP ST G ERR NPF+   +
Sbjct: 180 WPLGDDVTFVPGHGPVSTFGDERRTNPFVSDKV 212


>gi|119944001|ref|YP_941681.1| beta-lactamase domain-containing protein [Psychromonas ingrahamii
           37]
 gi|119862605|gb|ABM02082.1| beta-lactamase domain protein [Psychromonas ingrahamii 37]
          Length = 215

 Score =  196 bits (499), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 77/212 (36%), Positives = 126/212 (59%), Gaps = 1/212 (0%)

Query: 2   SKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGH 61
           + +   ++ VTP++QNC+ +  EE+  A +VDPGGD   I ++++ +   V +I +THGH
Sbjct: 4   NSMKIIVIPVTPYQQNCSLIICEETKIAAIVDPGGDPLRILNIVEKQGVKVDKIILTHGH 63

Query: 62  VDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
           +DHVGG   +   L++ +IGP K+D   + +++ Q+R   +     + S +RWL +G+ L
Sbjct: 64  LDHVGGTQAVAGKLNVPVIGPEKEDLFWLEQLEAQSRRFGL-PTTESFSPNRWLTEGEVL 122

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
            +G    KV   PGH+PGH+   + ++    +GD LF   IGR D   G+   L++ I  
Sbjct: 123 EVGKIKLKVLRIPGHTPGHIALYDKQSKQVIVGDILFNGGIGRFDFPRGNRSLLVSGIKE 182

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           K+L L  E +   GHGP +TIG+E+  NPFL+
Sbjct: 183 KLLTLPPETTVYPGHGPTTTIGKEKASNPFLR 214


>gi|134281456|ref|ZP_01768164.1| metallo-beta-lactamase family protein [Burkholderia pseudomallei
           305]
 gi|134247123|gb|EBA47209.1| metallo-beta-lactamase family protein [Burkholderia pseudomallei
           305]
          Length = 214

 Score =  196 bits (499), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 94/213 (44%), Positives = 135/213 (63%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +   ++ VTPF+QNC+ L  E++  A VVDPGGDL++I+  +  ++  V+++ +THGHVD
Sbjct: 1   MKVTLIPVTPFQQNCSLLVCEKTGRAAVVDPGGDLELIEQEVARQHVQVEKVLLTHGHVD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H  GA +L     + I GPH+D+   + K+  Q+        A     DRWL DGDTL  
Sbjct: 61  HCAGAKRLAAHYGVPIEGPHEDERFWIEKLPMQSERFGFPA-AEAFEPDRWLADGDTLAF 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V+HCPGH+PGHV++ +  +  A +GD LF  SIGRTD   G++  LI+SI  K+
Sbjct: 120 GEETLEVYHCPGHTPGHVVFFSRAHRLAIVGDVLFAGSIGRTDFPRGNHADLIHSIREKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            PLGD+++FV GHGP ST G ERR NPF+   +
Sbjct: 180 WPLGDDVTFVPGHGPVSTFGDERRTNPFVADGV 212


>gi|238785820|ref|ZP_04629790.1| Beta-lactamase domain protein [Yersinia bercovieri ATCC 43970]
 gi|238713273|gb|EEQ05315.1| Beta-lactamase domain protein [Yersinia bercovieri ATCC 43970]
          Length = 215

 Score =  196 bits (498), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 90/211 (42%), Positives = 136/211 (64%), Gaps = 1/211 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + I+ VT F QNCT ++ E + +A +VDPGGD D I   +  +  +V QI +THGH+D
Sbjct: 1   MKYQIIPVTAFSQNCTLIWCEATGQAALVDPGGDADKIIAEVARQGVNVNQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L     + I GP K+D   +  +  Q+R+  +       +  RWL++GD + +
Sbjct: 61  HVGAAAELAAHFDIPIYGPEKEDIFWLEGLPAQSRMFGLDEC-ETFTPTRWLEEGDKVTV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGH+PGH+++++ +   A +GD +F   +GR+D   GD+QQLINSI  K+
Sbjct: 120 GEIELSVLHCPGHTPGHIVFIDQQGRLALVGDVIFNGGVGRSDFPRGDHQQLINSIRTKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           LPLGD+I+F+ GHGP ST+G ER+ NPF++ 
Sbjct: 180 LPLGDDITFIPGHGPMSTLGHERQTNPFIRE 210


>gi|170731622|ref|YP_001763569.1| beta-lactamase domain-containing protein [Burkholderia cenocepacia
           MC0-3]
 gi|169814864|gb|ACA89447.1| beta-lactamase domain protein [Burkholderia cenocepacia MC0-3]
          Length = 214

 Score =  196 bits (498), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 90/213 (42%), Positives = 132/213 (61%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +   ++ VTPF+QNC+ L  E++  A VVDPGGDLD I+  +  +N  V+++ +THGH+D
Sbjct: 1   MKVTLIPVTPFQQNCSLLVCEKTGRAAVVDPGGDLDRIEQEVARQNVQVEKVLLTHGHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H  GA  L     + I GP +++   + K+  Q+        A     D+WL DGDT+  
Sbjct: 61  HCAGAKTLATRYGVPIEGPQEEERFWIEKLPMQSERFGFPA-ADVFEPDQWLNDGDTVQF 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V+HCPGH+PGHV++ +  +  A +GD LF  SIGRTD   G+++ L+ SI  K+
Sbjct: 120 GDETLEVYHCPGHTPGHVVFFSRAHRVAIVGDVLFAGSIGRTDFPRGNHEDLVRSIKEKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            PLGD+++FV GHGP ST G ERR NPF+   +
Sbjct: 180 WPLGDDVTFVPGHGPVSTFGDERRTNPFVSDKV 212


>gi|238749751|ref|ZP_04611256.1| hypothetical protein yrohd0001_30710 [Yersinia rohdei ATCC 43380]
 gi|238712406|gb|EEQ04619.1| hypothetical protein yrohd0001_30710 [Yersinia rohdei ATCC 43380]
          Length = 215

 Score =  196 bits (498), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 89/211 (42%), Positives = 136/211 (64%), Gaps = 1/211 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + I+ VT F QNCT ++ E + +A +VDPGGD   I   +  ++  V QI +THGH+D
Sbjct: 1   MKYKIIPVTAFSQNCTLIWCEVTGQAALVDPGGDAAKIIAEVARQDVKVSQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L E   + I GP K+D   +  +  Q+++  +       +  RWL++GD + +
Sbjct: 61  HVGAAAELAEHFQVPIYGPEKEDLFWLEGLPAQSKMFGLSEC-EAFTPTRWLEEGDKITV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGH+PGH+++++ +   A +GD +F   +GR+D   GD+QQLINSI  K+
Sbjct: 120 GATELSVLHCPGHTPGHIVFIDKQGQLALVGDVIFNGGVGRSDFPRGDHQQLINSIRTKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           LPLGD+I+F+ GHGP ST+G ER+ NPF++ 
Sbjct: 180 LPLGDDITFIPGHGPMSTLGHERQTNPFIRE 210


>gi|116688309|ref|YP_833932.1| beta-lactamase domain-containing protein [Burkholderia cenocepacia
           HI2424]
 gi|116646398|gb|ABK07039.1| beta-lactamase domain protein [Burkholderia cenocepacia HI2424]
          Length = 214

 Score =  196 bits (498), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 90/213 (42%), Positives = 132/213 (61%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +   ++ VTPF+QNC+ L  E++  A VVDPGGDLD I+  +  +N  V+++ +THGH+D
Sbjct: 1   MKVTLIPVTPFQQNCSLLVCEKTGRAAVVDPGGDLDRIEQEVARQNVQVEKVLLTHGHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H  GA  L     + I GP +++   + K+  Q+        A     D+WL DGDT+  
Sbjct: 61  HCAGAKTLATRYGVPIEGPQEEERFWIEKLPMQSERFGFPA-ADVFEPDQWLNDGDTVRF 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V+HCPGH+PGHV++ +  +  A +GD LF  SIGRTD   G+++ L+ SI  K+
Sbjct: 120 GDETLEVYHCPGHTPGHVVFFSRAHRVAIVGDVLFAGSIGRTDFPRGNHEDLVRSIKEKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            PLGD+++FV GHGP ST G ERR NPF+   +
Sbjct: 180 WPLGDDVTFVPGHGPVSTFGDERRTNPFVSDKV 212


>gi|22126639|ref|NP_670062.1| metallo-beta-lactamase superfamily protein [Yersinia pestis KIM 10]
 gi|45441011|ref|NP_992550.1| metallo-beta-lactamase superfamily protein [Yersinia pestis biovar
           Microtus str. 91001]
 gi|108806700|ref|YP_650616.1| metallo-beta-lactamase superfamily protein [Yersinia pestis
           Antiqua]
 gi|108812729|ref|YP_648496.1| metallo-beta-lactamase superfamily protein [Yersinia pestis
           Nepal516]
 gi|145599558|ref|YP_001163634.1| metallo-beta-lactamase superfamily protein [Yersinia pestis
           Pestoides F]
 gi|149366666|ref|ZP_01888700.1| metallo-beta-lactamase superfamily protein [Yersinia pestis
           CA88-4125]
 gi|162420777|ref|YP_001606448.1| metallo-beta-lactamase superfamily protein [Yersinia pestis Angola]
 gi|165924796|ref|ZP_02220628.1| metallo-beta-lactamase family protein [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165938910|ref|ZP_02227463.1| metallo-beta-lactamase family protein [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|166009820|ref|ZP_02230718.1| metallo-beta-lactamase family protein [Yersinia pestis biovar
           Antiqua str. E1979001]
 gi|166211362|ref|ZP_02237397.1| metallo-beta-lactamase family protein [Yersinia pestis biovar
           Antiqua str. B42003004]
 gi|167399873|ref|ZP_02305391.1| metallo-beta-lactamase family protein [Yersinia pestis biovar
           Antiqua str. UG05-0454]
 gi|167419476|ref|ZP_02311229.1| metallo-beta-lactamase family protein [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167424028|ref|ZP_02315781.1| metallo-beta-lactamase family protein [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|167470986|ref|ZP_02335690.1| metallo-beta-lactamase family protein [Yersinia pestis FV-1]
 gi|218928557|ref|YP_002346432.1| metallo-beta-lactamase superfamily protein [Yersinia pestis CO92]
 gi|229841381|ref|ZP_04461540.1| predicted metal-binding enzyme [Yersinia pestis biovar Orientalis
           str. PEXU2]
 gi|229843486|ref|ZP_04463632.1| predicted metal-binding enzyme [Yersinia pestis biovar Orientalis
           str. India 195]
 gi|229895860|ref|ZP_04511030.1| predicted metal-binding enzyme [Yersinia pestis Pestoides A]
 gi|229903134|ref|ZP_04518247.1| predicted metal-binding enzyme [Yersinia pestis Nepal516]
 gi|270486927|ref|ZP_06204001.1| metallo-beta-lactamase domain protein [Yersinia pestis KIM D27]
 gi|294503396|ref|YP_003567458.1| metallo-beta-lactamase superfamily protein [Yersinia pestis
           Z176003]
 gi|21959651|gb|AAM86313.1|AE013879_3 hypothetical protein y2761 [Yersinia pestis KIM 10]
 gi|45435870|gb|AAS61427.1| metallo-beta-lactamase superfamily protein [Yersinia pestis biovar
           Microtus str. 91001]
 gi|108776377|gb|ABG18896.1| metallo-beta-lactamase superfamily protein [Yersinia pestis
           Nepal516]
 gi|108778613|gb|ABG12671.1| metallo-beta-lactamase superfamily protein [Yersinia pestis
           Antiqua]
 gi|115347168|emb|CAL20061.1| metallo-beta-lactamase superfamily protein [Yersinia pestis CO92]
 gi|145211254|gb|ABP40661.1| metallo-beta-lactamase superfamily protein [Yersinia pestis
           Pestoides F]
 gi|149291040|gb|EDM41115.1| metallo-beta-lactamase superfamily protein [Yersinia pestis
           CA88-4125]
 gi|162353592|gb|ABX87540.1| metallo-beta-lactamase family protein [Yersinia pestis Angola]
 gi|165913057|gb|EDR31681.1| metallo-beta-lactamase family protein [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|165923856|gb|EDR40988.1| metallo-beta-lactamase family protein [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165991216|gb|EDR43517.1| metallo-beta-lactamase family protein [Yersinia pestis biovar
           Antiqua str. E1979001]
 gi|166207133|gb|EDR51613.1| metallo-beta-lactamase family protein [Yersinia pestis biovar
           Antiqua str. B42003004]
 gi|166962217|gb|EDR58238.1| metallo-beta-lactamase family protein [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167050581|gb|EDR61989.1| metallo-beta-lactamase family protein [Yersinia pestis biovar
           Antiqua str. UG05-0454]
 gi|167056877|gb|EDR66640.1| metallo-beta-lactamase family protein [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|229678904|gb|EEO75007.1| predicted metal-binding enzyme [Yersinia pestis Nepal516]
 gi|229689833|gb|EEO81894.1| predicted metal-binding enzyme [Yersinia pestis biovar Orientalis
           str. India 195]
 gi|229697747|gb|EEO87794.1| predicted metal-binding enzyme [Yersinia pestis biovar Orientalis
           str. PEXU2]
 gi|229700783|gb|EEO88812.1| predicted metal-binding enzyme [Yersinia pestis Pestoides A]
 gi|262365027|gb|ACY61584.1| metallo-beta-lactamase superfamily protein [Yersinia pestis
           D182038]
 gi|270335431|gb|EFA46208.1| metallo-beta-lactamase domain protein [Yersinia pestis KIM D27]
 gi|294353855|gb|ADE64196.1| metallo-beta-lactamase superfamily protein [Yersinia pestis
           Z176003]
 gi|320015729|gb|ADV99300.1| putative metal-binding enzyme [Yersinia pestis biovar Medievalis
           str. Harbin 35]
          Length = 215

 Score =  196 bits (498), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 85/211 (40%), Positives = 136/211 (64%), Gaps = 1/211 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + I+ VT F QNCT ++ E + +A +VDPGG+   I   ++ +   + Q+ +THGH+D
Sbjct: 1   MKYQIIPVTAFSQNCTLIWCEATGQAALVDPGGEATKIIAEVERQGVTISQVLLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA++     + I GP K+D   +  +  Q+R+  +       +  RWL++GD + +
Sbjct: 61  HVGAAAEVAAHFQVPIYGPEKEDTFWLEGLPAQSRMFGLSEC-EAFTPTRWLEEGDKITV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGH+PGH+++++ +   A +GD +F+  +GR+D   GD+QQLINSI  K+
Sbjct: 120 GEIELSVLHCPGHTPGHIVFIDPQGRLALVGDVIFKGGVGRSDFPRGDHQQLINSIRTKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           LPLGD+I+F+ GHGP ST+G ER+ NPF++ 
Sbjct: 180 LPLGDDITFIPGHGPMSTLGHERQTNPFIRE 210


>gi|53720887|ref|YP_109873.1| metallo-beta-lactamase superfamily protein [Burkholderia
           pseudomallei K96243]
 gi|76810998|ref|YP_331461.1| metallo-beta-lactamase superfamily protein [Burkholderia
           pseudomallei 1710b]
 gi|167817838|ref|ZP_02449518.1| metallo-beta-lactamase superfamily protein [Burkholderia
           pseudomallei 91]
 gi|167826216|ref|ZP_02457687.1| metallo-beta-lactamase superfamily protein [Burkholderia
           pseudomallei 9]
 gi|167896313|ref|ZP_02483715.1| metallo-beta-lactamase superfamily protein [Burkholderia
           pseudomallei 7894]
 gi|167912968|ref|ZP_02500059.1| metallo-beta-lactamase superfamily protein [Burkholderia
           pseudomallei 112]
 gi|167924647|ref|ZP_02511738.1| metallo-beta-lactamase superfamily protein [Burkholderia
           pseudomallei BCC215]
 gi|226193263|ref|ZP_03788873.1| metallo-beta-lactamase family protein [Burkholderia pseudomallei
           Pakistan 9]
 gi|254186333|ref|ZP_04892850.1| metallo-beta-lactamase family protein [Burkholderia pseudomallei
           Pasteur 52237]
 gi|254261750|ref|ZP_04952804.1| metallo-beta-lactamase family protein [Burkholderia pseudomallei
           1710a]
 gi|254298822|ref|ZP_04966273.1| metallo-beta-lactamase family protein [Burkholderia pseudomallei
           406e]
 gi|52211301|emb|CAH37290.1| metallo-beta-lactamase superfamily protein [Burkholderia
           pseudomallei K96243]
 gi|76580451|gb|ABA49926.1| metallo-beta-lactamase superfamily protein [Burkholderia
           pseudomallei 1710b]
 gi|157808682|gb|EDO85852.1| metallo-beta-lactamase family protein [Burkholderia pseudomallei
           406e]
 gi|157934018|gb|EDO89688.1| metallo-beta-lactamase family protein [Burkholderia pseudomallei
           Pasteur 52237]
 gi|225934863|gb|EEH30840.1| metallo-beta-lactamase family protein [Burkholderia pseudomallei
           Pakistan 9]
 gi|254220439|gb|EET09823.1| metallo-beta-lactamase family protein [Burkholderia pseudomallei
           1710a]
          Length = 214

 Score =  196 bits (497), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 94/213 (44%), Positives = 134/213 (62%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +   ++ VTPF+QNC+ L  E++  A VVDPGGDL++I+  +  ++  V+++ +THGHVD
Sbjct: 1   MKVTLIPVTPFQQNCSLLVCEKTGRAAVVDPGGDLELIEQEVARQHVQVEKVLLTHGHVD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H  GA +L     + I GPH+D+   + K+  Q+        A     DRWL DGDTL  
Sbjct: 61  HCAGAKRLAAHYGVPIEGPHEDERFWIEKLPMQSERFGFPA-AEAFEPDRWLADGDTLAF 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V+HCPGH+PGHV++ +  +  A +GD LF  SIGRTD   G++  LI SI  K+
Sbjct: 120 GEETLEVYHCPGHTPGHVVFFSRAHRLAIVGDVLFAGSIGRTDFPRGNHADLIRSIREKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            PLGD+++FV GHGP ST G ERR NPF+   +
Sbjct: 180 WPLGDDVTFVPGHGPVSTFGDERRTNPFVADEV 212


>gi|73542951|ref|YP_297471.1| Beta-lactamase-like [Ralstonia eutropha JMP134]
 gi|72120364|gb|AAZ62627.1| Beta-lactamase-like [Ralstonia eutropha JMP134]
          Length = 216

 Score =  196 bits (497), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 94/213 (44%), Positives = 137/213 (64%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +   ++ VTPF+QNC+ L DE + +A V DPGGDLD I + ++ +   +++I++THGHVD
Sbjct: 1   MKALLIPVTPFQQNCSLLIDEHTGKAAVCDPGGDLDRILEAVKEQGVTLEKIFLTHGHVD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H  GAA L   L + I GPH+D+   + ++ EQ R       A      RWLQDGDT+  
Sbjct: 61  HCAGAAALSRQLGIPIEGPHEDERFWIDQLPEQTRRFGFGQ-AEVFEPQRWLQDGDTVQF 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V+HCPGH+PGHV++ +  N  A +GD LF  SIGRTD   G++  L+ SI  ++
Sbjct: 120 GGETLEVYHCPGHTPGHVVFFSRANRLAVVGDVLFAGSIGRTDFPRGNHADLVRSIRTRL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            PLG++++F+ GHGP ST G ERR NPF+  ++
Sbjct: 180 WPLGEDVTFIPGHGPVSTFGEERRNNPFVADHL 212


>gi|325520984|gb|EGC99940.1| hydroxyacylglutathione hydrolase [Burkholderia sp. TJI49]
          Length = 214

 Score =  196 bits (497), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 92/213 (43%), Positives = 131/213 (61%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +   ++ VTPF+QNC+ L  E++  A VVDPGGDL+ I+  I  +N  V+++ +THGH+D
Sbjct: 1   MKVTLIPVTPFQQNCSLLVCEQTGRAAVVDPGGDLERIEQEIARQNVQVEKVLLTHGHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H  GA  L     + I GP +D+   + K+  Q+        A     DRWL DGDT+  
Sbjct: 61  HCAGAKTLATHYGVPIEGPQEDERFWIEKLPMQSERFGFPA-AEAFEPDRWLNDGDTVQF 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V+HCPGH+PGHV++ +  +  A +GD LF  SIGRTD   G++  L+ SI  K+
Sbjct: 120 GDETLEVYHCPGHTPGHVVFFSRAHRVAIVGDVLFAGSIGRTDFPRGNHADLVRSIKEKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            PLGD+++FV GHGP ST G ERR NPF+   +
Sbjct: 180 WPLGDDVTFVPGHGPVSTFGDERRTNPFVSDKV 212


>gi|51595773|ref|YP_069964.1| metallo-beta-lactamase superfamily protein [Yersinia
           pseudotuberculosis IP 32953]
 gi|153947925|ref|YP_001401526.1| metallo-beta-lactamase family protein [Yersinia pseudotuberculosis
           IP 31758]
 gi|170024877|ref|YP_001721382.1| beta-lactamase domain-containing protein [Yersinia
           pseudotuberculosis YPIII]
 gi|186894852|ref|YP_001871964.1| beta-lactamase domain-containing protein [Yersinia
           pseudotuberculosis PB1/+]
 gi|51589055|emb|CAH20673.1| metallo-beta-lactamase superfamily protein [Yersinia
           pseudotuberculosis IP 32953]
 gi|152959420|gb|ABS46881.1| metallo-beta-lactamase family protein [Yersinia pseudotuberculosis
           IP 31758]
 gi|169751411|gb|ACA68929.1| beta-lactamase domain protein [Yersinia pseudotuberculosis YPIII]
 gi|186697878|gb|ACC88507.1| beta-lactamase domain protein [Yersinia pseudotuberculosis PB1/+]
          Length = 215

 Score =  196 bits (497), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 86/211 (40%), Positives = 136/211 (64%), Gaps = 1/211 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + I+ VT F QNCT ++ E + +A +VDPGG+   I   ++ +   V Q+ +THGH+D
Sbjct: 1   MKYQIIPVTAFSQNCTLIWCEATGQAALVDPGGEATKIIAEVERQGVTVSQVLLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA++     + I GP K+D   +  +  Q+R+  +       +  RWL++GD + +
Sbjct: 61  HVGAAAEVAAHFQVPIYGPEKEDTFWLEGLPAQSRMFGLSEC-EAFTPTRWLEEGDKITV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGH+PGH+++++ +   A +GD +F+  +GR+D   GD+QQLINSI  K+
Sbjct: 120 GEIELSVLHCPGHTPGHIVFIDPQGRLALVGDVIFKGGVGRSDFPRGDHQQLINSIRTKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           LPLGD+I+F+ GHGP ST+G ER+ NPF++ 
Sbjct: 180 LPLGDDITFIPGHGPMSTLGHERQTNPFIRE 210


>gi|134294361|ref|YP_001118096.1| beta-lactamase domain-containing protein [Burkholderia
           vietnamiensis G4]
 gi|134137518|gb|ABO53261.1| beta-lactamase domain protein [Burkholderia vietnamiensis G4]
          Length = 214

 Score =  196 bits (497), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 90/213 (42%), Positives = 133/213 (62%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +   ++ VTPF+QNC+ L  E++  A VVDPGGDL+ I+  I  +N  ++++ +THGHVD
Sbjct: 1   MKVTLIPVTPFQQNCSLLVCEKTGRAAVVDPGGDLERIEQEIARQNVQLEKVLLTHGHVD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H  GA  L     + I+GP +D+   + ++  Q++       A     D+WL DGDT+  
Sbjct: 61  HCAGAKALATHYGVPIVGPQEDERFWIEQLPTQSQRFGFPA-AEAFEPDQWLHDGDTVRF 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V+HCPGH+PGHV++ +  +  A +GD LF  SIGRTD   G++  L+ SI  K+
Sbjct: 120 GDETLEVYHCPGHTPGHVVFFSRAHRVAIVGDVLFAGSIGRTDFPRGNHADLVRSIKEKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            PLGD+++FV GHGP ST G ERR NPF+   +
Sbjct: 180 WPLGDDVTFVPGHGPVSTFGDERRTNPFVSDKV 212


>gi|311694082|gb|ADP96955.1| metallo-beta-lactamase family protein [marine bacterium HP15]
          Length = 215

 Score =  196 bits (497), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 95/215 (44%), Positives = 140/215 (65%), Gaps = 2/215 (0%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           MS L++ I+ VTPF+QNC+ ++ E++  A VVDPGGDL+ I+  +      V++I +TH 
Sbjct: 1   MS-LNYRIIPVTPFQQNCSLIWCEKTRRAAVVDPGGDLEKIRAAVAEEGVTVEKILLTHA 59

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DH GG A+L ++L + I GP K+D   +  + +QA++          + DRWL+DG  
Sbjct: 60  HIDHAGGTAELTKELGIPIEGPQKEDNFWIVGLPQQAQMFGF-PAPEVFTPDRWLEDGQQ 118

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           + +G    +V HCPGH+PGHV++ + E+  A +GD LF  SIGRTD   GD+  LI SI 
Sbjct: 119 VTVGNQTLEVLHCPGHTPGHVVFYHKESGLALVGDVLFHGSIGRTDFPKGDHATLIRSIR 178

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLKSN 215
            ++ PLGDE++F+ GHGP ST GRER  NPF+  +
Sbjct: 179 EQLFPLGDEVAFIPGHGPMSTFGRERATNPFVSDH 213


>gi|261339261|ref|ZP_05967119.1| hypothetical protein ENTCAN_05497 [Enterobacter cancerogenus ATCC
           35316]
 gi|288319118|gb|EFC58056.1| metallo-beta-lactamase family protein [Enterobacter cancerogenus
           ATCC 35316]
          Length = 215

 Score =  196 bits (497), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 86/213 (40%), Positives = 138/213 (64%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++ I+ VT F QNC+ ++ E++  A +VDPGGD + IK  + +    + QI +THGH+D
Sbjct: 1   MNYRIIPVTAFSQNCSLIWCEQTKLAALVDPGGDAEKIKQEVAASGVTLMQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L +   + +IGP K+D   +  +  Q+R+  +    +  + DRWL +GD + +
Sbjct: 61  HVGAAAELAQHYGVPVIGPEKEDEFWLEGLPAQSRMFGLDEC-QPLTPDRWLNEGDRVSV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGH+++ + ++     GD +F+  +GR+D   GD+ QLI SI  K+
Sbjct: 120 GNVTLQVLHCPGHTPGHIVFFDDQSRLLISGDVIFKGGVGRSDFPRGDHGQLIQSIKQKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           LPLGD+++F+ GHGP ST+G ER  NPFL+  +
Sbjct: 180 LPLGDDVTFIPGHGPMSTLGYERLHNPFLQDEM 212


>gi|172059278|ref|YP_001806930.1| beta-lactamase domain-containing protein [Burkholderia ambifaria
           MC40-6]
 gi|171991795|gb|ACB62714.1| beta-lactamase domain protein [Burkholderia ambifaria MC40-6]
          Length = 214

 Score =  196 bits (497), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 89/213 (41%), Positives = 135/213 (63%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +   ++ VTPF+QNC+ +  E++  A VVDPGGDL+ I++ I  +N  ++++ +THGH+D
Sbjct: 1   MKVTLIPVTPFQQNCSLVVCEKTGRAAVVDPGGDLERIEEEIARQNVQLEKVLLTHGHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GGA  L     + I+GP +D+   + ++  Q++       A     D WL DGDT+ +
Sbjct: 61  HCGGAKALATHYGVPIVGPQEDERFWIEQLPMQSQRFGFPA-AETFEPDHWLNDGDTVQV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V+HCPGH+PGHV++ +  +  A +GD LF  SIGRTD   G++  L+ SI  K+
Sbjct: 120 GDETLEVYHCPGHTPGHVVFFSRAHRVAIVGDVLFAGSIGRTDFPRGNHADLVRSIKEKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            PLGD+++FV GHGP ST G ERR NPF+   +
Sbjct: 180 WPLGDDVTFVPGHGPVSTFGDERRTNPFVSDKV 212


>gi|170769250|ref|ZP_02903703.1| metallo-beta-lactamase family protein [Escherichia albertii
           TW07627]
 gi|170121902|gb|EDS90833.1| metallo-beta-lactamase family protein [Escherichia albertii
           TW07627]
          Length = 215

 Score =  196 bits (497), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 88/213 (41%), Positives = 142/213 (66%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++ I+ VT F QNC+ ++ E++  A +VDPGGD + IK  + +    + QI +THGH+D
Sbjct: 1   MNYRIIPVTAFSQNCSLIWCEQTRLAALVDPGGDAEKIKQEVDASGLTLMQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L +   + ++GP K+D   +  +  Q+R+  +    +  + DRWL +GDT+ +
Sbjct: 61  HVGAAAELAQHYGVPVLGPEKEDEFWLQGLPAQSRMFGLDEC-QPLTPDRWLSEGDTISI 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGHV++ + ++     GD LF+  +GR+D   GD++QLI+SI +K+
Sbjct: 120 GNVTLQVLHCPGHTPGHVVFFDNQSKLLISGDVLFKGGVGRSDFPRGDHKQLISSIKDKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           LPLGD+++F+ GHGP ST+G ER  NPFL+  +
Sbjct: 180 LPLGDDVTFIPGHGPLSTLGYERLHNPFLQDEM 212


>gi|171320219|ref|ZP_02909278.1| beta-lactamase domain protein [Burkholderia ambifaria MEX-5]
 gi|171094540|gb|EDT39595.1| beta-lactamase domain protein [Burkholderia ambifaria MEX-5]
          Length = 214

 Score =  196 bits (497), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 90/213 (42%), Positives = 133/213 (62%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +   ++ VTPF+QNC+ +  E++  A VVDPGGDL+ I+  I  +N  V+++ +THGHVD
Sbjct: 1   MKVTLIPVTPFQQNCSLVVCEKTGRAAVVDPGGDLERIEQEIARQNVQVEKVLLTHGHVD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H  GA  L     + I+GP +D+   + ++  Q++       A     D WL DGDT+ +
Sbjct: 61  HCAGAKALATHYGVPIVGPQEDERFWIEQLPMQSQRFGFPA-AETFEPDHWLNDGDTVQV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V+HCPGH+PGHV++ +  +  A +GD LF  SIGRTD   G++  L+ SI  K+
Sbjct: 120 GDETLEVYHCPGHTPGHVVFFSRAHRVAIVGDVLFAGSIGRTDFPRGNHADLVRSIKEKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            PLGD+++FV GHGP ST G ERR NPF+   +
Sbjct: 180 WPLGDDVTFVPGHGPVSTFGDERRTNPFVSDKV 212


>gi|115350255|ref|YP_772094.1| beta-lactamase domain-containing protein [Burkholderia ambifaria
           AMMD]
 gi|115280243|gb|ABI85760.1| beta-lactamase domain protein [Burkholderia ambifaria AMMD]
          Length = 214

 Score =  195 bits (496), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 89/213 (41%), Positives = 136/213 (63%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +   ++ VTPF+QNC+ +  E++  A VVDPGGDL+ I++ I  +N  ++++ +THGH+D
Sbjct: 1   MKVTLIPVTPFQQNCSLVVCEKTGRAAVVDPGGDLERIEEEIARQNVQLEKVLLTHGHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GGA  L     + I+GP +D+   + ++  Q++       A     D WL DGDT+ +
Sbjct: 61  HCGGAKALATHYGVPIVGPQEDERFWIEQLPTQSQRFGFPA-AETFEPDHWLNDGDTVQV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V+HCPGH+PGHV++ +  ++ A +GD LF  SIGRTD   G++  L+ SI  K+
Sbjct: 120 GDETLEVYHCPGHTPGHVVFFSRAHHVAIVGDVLFAGSIGRTDFPRGNHADLVRSIKEKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            PLGD+++FV GHGP ST G ERR NPF+   +
Sbjct: 180 WPLGDDVTFVPGHGPVSTFGDERRTNPFVSDKV 212


>gi|170693936|ref|ZP_02885092.1| beta-lactamase domain protein [Burkholderia graminis C4D1M]
 gi|170141008|gb|EDT09180.1| beta-lactamase domain protein [Burkholderia graminis C4D1M]
          Length = 214

 Score =  195 bits (496), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 93/213 (43%), Positives = 131/213 (61%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +   ++ VTPF+QN + L  E +  A VVDPGGDLDII+  I  +   V+++ +THGH+D
Sbjct: 1   MKVTLIPVTPFQQNSSLLVCEATGRAAVVDPGGDLDIIQGEIARQKVSVEKVLLTHGHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H  GA  L     + I GPH D+   + K+ +Q+        A+    DRWL DGDT+  
Sbjct: 61  HCAGAKTLATHYGVPIEGPHPDERFWLDKLPDQSTRFGFPA-AQAFEPDRWLDDGDTVQF 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V+HCPGH+PGHV++ +  +  A +GD LF  SIGRTD   G++  LI SI  K+
Sbjct: 120 GDETLEVYHCPGHTPGHVVFFSRAHRLALVGDVLFAGSIGRTDFPRGNHADLIRSIREKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            PLGD+++FV GHGP ST G ERR NP++   +
Sbjct: 180 WPLGDDVTFVPGHGPTSTFGAERRSNPYVADGV 212


>gi|296103070|ref|YP_003613216.1| beta-lactamase-like protein [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
 gi|295057529|gb|ADF62267.1| beta-lactamase-like protein [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
          Length = 215

 Score =  195 bits (496), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 85/213 (39%), Positives = 137/213 (64%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++ I+ VT F QNC+ ++ E++  A +VDPGGD + IK  +      + QI +THGH+D
Sbjct: 1   MNYRIIPVTAFSQNCSLIWCEQTKLAALVDPGGDAEKIKQEVAESGVTLMQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L +   + +IGP K+D   +  +  Q+R+  +    +  + DRWL +G+ + +
Sbjct: 61  HVGAAAELAQHYGVPVIGPEKEDEFWLQGLPAQSRMFGLDEC-QPLTPDRWLNEGERVNV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGH+++ + ++     GD +F+  +GR+D   GD+ QLI SI  K+
Sbjct: 120 GNVTLQVLHCPGHTPGHIVFFDDQSRLLISGDVIFKGGVGRSDFPRGDHGQLIQSIKQKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           LPLGD+++F+ GHGP ST+G ER  NPFL+  +
Sbjct: 180 LPLGDDVTFIPGHGPMSTLGYERVHNPFLQDEM 212


>gi|260597327|ref|YP_003209898.1| hypothetical protein CTU_15350 [Cronobacter turicensis z3032]
 gi|260216504|emb|CBA29678.1| Uncharacterized protein ycbL [Cronobacter turicensis z3032]
          Length = 228

 Score =  195 bits (496), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 90/215 (41%), Positives = 141/215 (65%), Gaps = 1/215 (0%)

Query: 2   SKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGH 61
           S +++HI+ VT F QNC+ ++ EE+ +A +VDPGGD   IK+ +      ++QI +THGH
Sbjct: 12  SGMNYHIIPVTAFAQNCSLIWCEETRQAALVDPGGDAQRIKEEVARMGVTLQQILLTHGH 71

Query: 62  VDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
           +DHVG AA+L     + IIGP K+D   +  +  Q+R+  +    +  + DRWL +GDT+
Sbjct: 72  LDHVGAAAELAAHYGIPIIGPEKEDEFWLQGLPAQSRMFGLDEC-QPLTPDRWLNEGDTV 130

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
            +G     V HCPGH+PGH+++ + ++     GD +F+  +GR+D   GD+ QLI++I  
Sbjct: 131 NVGNISLAVLHCPGHTPGHIVFFDAQSRLLVSGDVIFKGGVGRSDFPRGDHSQLIDAIKR 190

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           K+LPLGD+++F+ GHGP ST+G ER  NPFL+  +
Sbjct: 191 KLLPLGDDVTFIPGHGPMSTLGHERLHNPFLQDEM 225


>gi|237730890|ref|ZP_04561371.1| conserved hypothetical protein [Citrobacter sp. 30_2]
 gi|226906429|gb|EEH92347.1| conserved hypothetical protein [Citrobacter sp. 30_2]
          Length = 215

 Score =  195 bits (495), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 87/213 (40%), Positives = 138/213 (64%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++ I+ VT F QNC+ ++ E++  A +VDPGGD + IK  + +    + QI +THGH+D
Sbjct: 1   MNYRIIPVTAFAQNCSLIWCEQTRLAALVDPGGDAEKIKQEVDASGLTLMQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L +   + +IGP K+D   +  +  Q+R+  +       + DRWL +GD + +
Sbjct: 61  HVGAAAELAQHYGVPVIGPEKEDEFWLQGLPAQSRMFGLGDC-EPLTPDRWLNEGDRISV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGHV++ + ++     GD +F+  +GR+D   GD+ QLI+SI  K+
Sbjct: 120 GNVTLQVLHCPGHTPGHVVFFDEQSKLLISGDVIFKGGVGRSDFPRGDHSQLIDSIKRKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           LPLGD+++F+ GHGP ST+G ER  NPFL+  +
Sbjct: 180 LPLGDDVTFIPGHGPLSTLGNERLHNPFLQDEM 212


>gi|300716098|ref|YP_003740901.1| hypothetical protein EbC_15190 [Erwinia billingiae Eb661]
 gi|299061934|emb|CAX59050.1| uncharacterized protein [Erwinia billingiae Eb661]
          Length = 209

 Score =  195 bits (495), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 87/210 (41%), Positives = 133/210 (63%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + I+ VT F QNC+ ++  E+L+A VVDPGGD + I+  +  +   V QI +THGH+D
Sbjct: 1   MDYQIIPVTAFAQNCSLIWCAETLQAAVVDPGGDAETIQAHVAEKGVTVTQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L     + ++GPHK DA  +  +  Q+++      A   + DRWL++G+T+ L
Sbjct: 61  HVGAAAELAAFYGVPVVGPHKADAFWLEGLPAQSQMFGFPYCA-PLTPDRWLEEGETVQL 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    ++  CPGH+PGH+++ +  +     GD +F   +GR+D   G +  LI SI  K+
Sbjct: 120 GNITLEILLCPGHTPGHIVFFDRASRLLVSGDVIFNGGVGRSDFPQGSHADLIASIKTKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           LPLGD+++F  GHGP ST+GRER  NPFL+
Sbjct: 180 LPLGDDVTFFPGHGPMSTLGRERISNPFLQ 209


>gi|331646192|ref|ZP_08347295.1| putative Metallo-beta-lactamase [Escherichia coli M605]
 gi|281178058|dbj|BAI54388.1| conserved hypothetical protein [Escherichia coli SE15]
 gi|330910707|gb|EGH39217.1| hypothetical metal-binding enzyme [Escherichia coli AA86]
 gi|331044944|gb|EGI17071.1| putative Metallo-beta-lactamase [Escherichia coli M605]
          Length = 215

 Score =  195 bits (495), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 88/213 (41%), Positives = 139/213 (65%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++ I+ VT F QNC+ ++ E++  A +VDPGGD + IK  + +    + QI +THGH+D
Sbjct: 1   MNYRIIPVTAFSQNCSLIWCEQTRLAALVDPGGDAEKIKQEVDASGLTLMQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L +   + + GP K+D   +  +  Q+R+  +    +  + DRWL +GDT+ +
Sbjct: 61  HVGAAAELAQHYGVPVFGPEKEDEFWLQGLPAQSRMFGLEEC-QPLTPDRWLNEGDTISI 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGHV++ N +      GD +F+  +GR+D   GD+ QLI+SI +K+
Sbjct: 120 GNVTLQVLHCPGHTPGHVVFFNEQARLLISGDVIFKGGVGRSDFPRGDHNQLISSIKDKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           LPLGD+++F+ GHGP ST+G ER  NPFL+  +
Sbjct: 180 LPLGDDVTFIPGHGPLSTLGYERLHNPFLQDEM 212


>gi|221202367|ref|ZP_03575400.1| metallo-beta-lactamase family protein [Burkholderia multivorans
           CGD2M]
 gi|221208994|ref|ZP_03581990.1| metallo-beta-lactamase family protein [Burkholderia multivorans
           CGD2]
 gi|221171116|gb|EEE03567.1| metallo-beta-lactamase family protein [Burkholderia multivorans
           CGD2]
 gi|221177781|gb|EEE10195.1| metallo-beta-lactamase family protein [Burkholderia multivorans
           CGD2M]
          Length = 214

 Score =  195 bits (495), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 91/213 (42%), Positives = 129/213 (60%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +   ++ VTPF+QNC+ L  E++    VVDPGGDL+ I+  I  +N  V ++ +THGH+D
Sbjct: 1   MKVTLIPVTPFQQNCSLLVCEKTGRTAVVDPGGDLERIEQEIARQNVQVDKVLLTHGHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H  GA  L     + I GP +D+   + K+  Q+        A     DRWL DGDT+  
Sbjct: 61  HCAGAKTLATHYGVPIEGPQEDERFWIEKLPTQSERFGFPA-AEAFEPDRWLNDGDTVQF 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V+HCPGH+PGHV++ +  +  A +GD LF  SIGRTD   G++  L+ SI  K+
Sbjct: 120 GDETLEVYHCPGHTPGHVVFFSRAHRVAIVGDVLFAGSIGRTDFPRGNHADLVRSIKEKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            PLGD+++FV GHGP ST G ERR NPF+   +
Sbjct: 180 WPLGDDVTFVPGHGPVSTFGDERRTNPFVSDKV 212


>gi|206581011|ref|YP_002239425.1| metallo-beta-lactamase domain protein [Klebsiella pneumoniae 342]
 gi|288936275|ref|YP_003440334.1| beta-lactamase [Klebsiella variicola At-22]
 gi|290510669|ref|ZP_06550039.1| ycbL [Klebsiella sp. 1_1_55]
 gi|206570069|gb|ACI11845.1| metallo-beta-lactamase domain protein [Klebsiella pneumoniae 342]
 gi|288890984|gb|ADC59302.1| beta-lactamase domain protein [Klebsiella variicola At-22]
 gi|289777385|gb|EFD85383.1| ycbL [Klebsiella sp. 1_1_55]
          Length = 215

 Score =  195 bits (495), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 88/213 (41%), Positives = 138/213 (64%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++ I+ VT F QNC+ ++ E++  A +VDPGGD + IK V+      + QI +THGH+D
Sbjct: 1   MNYRIIPVTAFAQNCSLIWCEQTRLAALVDPGGDAERIKAVVAEAGVTLMQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L +   + +IGP K+D   +  +  Q+R+  +    +    DRWL +GD + +
Sbjct: 61  HVGAAAELAQHYGVPVIGPEKEDEFWLEGLPAQSRMFGLEDC-QPLRPDRWLNEGDVVNV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGHV++ +  +     GD +F+  +GR+D   GD+ QLI +I +K+
Sbjct: 120 GNVALQVLHCPGHTPGHVVFFDDASRLLISGDVIFKGGVGRSDFPRGDHGQLIAAIKDKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           LPLGD+++F+ GHGP ST+G ERR NPFL+  +
Sbjct: 180 LPLGDDVTFIPGHGPLSTLGEERRNNPFLQDEM 212


>gi|170701640|ref|ZP_02892584.1| beta-lactamase domain protein [Burkholderia ambifaria IOP40-10]
 gi|170133461|gb|EDT01845.1| beta-lactamase domain protein [Burkholderia ambifaria IOP40-10]
          Length = 214

 Score =  195 bits (495), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 90/213 (42%), Positives = 134/213 (62%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +   ++ VTPF+QNC+ +  E++  A VVDPGGDL+ I+  I  +N  V+++ +THGH+D
Sbjct: 1   MKVTLIPVTPFQQNCSLVVCEKTGRAAVVDPGGDLERIEQEIARQNVQVEKVLLTHGHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GGA  L     + I+GP +D+   + ++  Q++       A     D WL DGDT+ +
Sbjct: 61  HCGGAKALATHYGVPIVGPQEDERFWIEQLPMQSQRFGFPA-AETFEPDHWLNDGDTVQI 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V+HCPGH+PGHV++ +  +  A +GD LF  SIGRTD   G++  L+ SI  K+
Sbjct: 120 GDETLEVYHCPGHTPGHVVFFSRAHRVAIVGDVLFAGSIGRTDFPRGNHADLVRSIKEKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            PLGD+++FV GHGP ST G ERR NPF+   +
Sbjct: 180 WPLGDDVTFVPGHGPVSTFGDERRTNPFVSDKV 212


>gi|123441870|ref|YP_001005853.1| metallo-beta-lactamase superfamily protein [Yersinia enterocolitica
           subsp. enterocolitica 8081]
 gi|122088831|emb|CAL11637.1| metallo-beta-lactamase superfamily protein [Yersinia enterocolitica
           subsp. enterocolitica 8081]
          Length = 215

 Score =  195 bits (495), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 88/211 (41%), Positives = 136/211 (64%), Gaps = 1/211 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + I+ VT F QNCT ++ EE+ +A +VDPGG+   I   +   N  + QI +THGH+D
Sbjct: 1   MKYQIIPVTAFSQNCTLIWCEETGQAALVDPGGEAAKIIAEVARHNIQINQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L     + I GP K+D   +  +  Q+R+  +       +  RWL++GD + +
Sbjct: 61  HVGAAAELAAHFQVPIYGPEKEDTFWLEGLPAQSRMFGLSEC-EAFTPTRWLEEGDKITV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGH+PGH+++++ ++  A +GD +F   +GR+D   GD+QQLINSI  K+
Sbjct: 120 GAIELSVLHCPGHTPGHIVFIDQKDRLALVGDVIFSGGVGRSDFPRGDHQQLINSIRTKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           LPLGD+++F+ GHGP ST+G ER+ NPF++ 
Sbjct: 180 LPLGDDMTFIPGHGPMSTLGHERQTNPFIRE 210


>gi|188581759|ref|YP_001925204.1| beta-lactamase domain protein [Methylobacterium populi BJ001]
 gi|179345257|gb|ACB80669.1| beta-lactamase domain protein [Methylobacterium populi BJ001]
          Length = 214

 Score =  194 bits (494), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 98/207 (47%), Positives = 144/207 (69%), Gaps = 1/207 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           I+ VTPF+QNCT ++D+E+    VVDPGGDLD I+  I+S+   V++I +THGH+DH GG
Sbjct: 9   IIPVTPFQQNCTLIWDDETKTGAVVDPGGDLDRIEAAIRSQGVKVEKILLTHGHIDHAGG 68

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           AA+LKE L + + GPH+ D  ++  + E      +   AR  + DRWL +GDT+ +G   
Sbjct: 69  AAELKERLGVPVEGPHEADRFLLDSLPETGANYGL-EGARAVTPDRWLDEGDTVTVGGLT 127

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
           F ++H PGHSPG V++++ +  FA +GD +F+ SIGRTD+  G ++QLI  I  K+LPLG
Sbjct: 128 FDIWHAPGHSPGSVVFMSRDARFALVGDVVFQGSIGRTDLPGGSHEQLIRMIKEKVLPLG 187

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLKS 214
           D+++F+ GHGP  T+G+ER  NPFL+ 
Sbjct: 188 DDVAFIPGHGPTGTLGQERLTNPFLQG 214


>gi|320182004|gb|EFW56909.1| hypothetical protein SGB_00726 [Shigella boydii ATCC 9905]
 gi|332092541|gb|EGI97614.1| metallo-beta-lactamase superfamily protein [Shigella boydii
           5216-82]
          Length = 215

 Score =  194 bits (494), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 87/213 (40%), Positives = 138/213 (64%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++ I+ VT F QNC+ ++ E++  A +VDPGGD + IK  +      + QI +THGH+D
Sbjct: 1   MNYRIIPVTAFSQNCSLIWCEQTRLAALVDPGGDAEKIKQEVDDSGLTLMQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L +   + + GP K+D   +  +  Q+R+  +    +  + DRWL++GDT+ +
Sbjct: 61  HVGAAAELAQHYGVPVFGPEKEDEFWLQGLPAQSRMFGLEEC-QPLTPDRWLKEGDTISI 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGHV++ +        GD +F+  +GR+D   GD+ QLI+SI +K+
Sbjct: 120 GNVTLQVLHCPGHTPGHVVFFDDRAKLLISGDVIFKGGVGRSDFPRGDHNQLISSIKDKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           LPLGD+++F+ GHGP ST+G ER  NPFL+  +
Sbjct: 180 LPLGDDVTFIPGHGPLSTLGYERLHNPFLQDEM 212


>gi|226939805|ref|YP_002794878.1| metallo-beta-lactamase family protein [Laribacter hongkongensis
           HLHK9]
 gi|226714731|gb|ACO73869.1| putative metallo-beta-lactamase family protein [Laribacter
           hongkongensis HLHK9]
          Length = 246

 Score =  194 bits (494), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 91/211 (43%), Positives = 133/211 (63%), Gaps = 1/211 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + +V VT F QNC+ ++ + + EA V+DPGGD+D I  +I      V+Q+ +THGH+D
Sbjct: 33  MGYRVVPVTAFAQNCSIVWCDATREAAVIDPGGDVDHILSIIDELGVSVRQVLLTHGHLD 92

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVGGAA L   L + + GPH+ D   +  + +Q+++      A     DRWL+ GD L +
Sbjct: 93  HVGGAASLAARLGVPVAGPHQADDYWLKGLPQQSQMFGFPP-AEVLVPDRWLKAGDCLSV 151

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGHV++V+ +   A +GD LF  SIGRTD   G++ +LI SI   +
Sbjct: 152 GECELEVLHCPGHTPGHVVFVDRQAGLAWVGDVLFAGSIGRTDFPGGNHAELIRSIRETL 211

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
             LGD++ F+ GHGP ST+G ERR NPF+  
Sbjct: 212 FALGDDVRFIPGHGPESTLGEERRYNPFVAD 242


>gi|254246788|ref|ZP_04940109.1| Beta-lactamase-like [Burkholderia cenocepacia PC184]
 gi|124871564|gb|EAY63280.1| Beta-lactamase-like [Burkholderia cenocepacia PC184]
          Length = 278

 Score =  194 bits (494), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 90/215 (41%), Positives = 133/215 (61%), Gaps = 1/215 (0%)

Query: 2   SKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGH 61
           + +   ++ VTPF+QNC+ L  E++  A VVDPGGDLD I+  +  +N  V+++ +THGH
Sbjct: 63  APMKVTLIPVTPFQQNCSLLVCEKTGRAAVVDPGGDLDRIEQEVARQNVQVEKVLLTHGH 122

Query: 62  VDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
           +DH  GA  L     + I GP +++   + K+  Q+        A     D+WL DGDT+
Sbjct: 123 IDHCAGAKTLAMHYGVPIEGPQEEERFWIEKLPMQSERFGFPA-ADIFEPDQWLNDGDTV 181

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
             G    +V+HCPGH+PGHV++ +  +  A +GD LF  SIGRTD   G+++ L+ SI  
Sbjct: 182 QFGDETLEVYHCPGHTPGHVVFFSRAHRVAIVGDVLFAGSIGRTDFPRGNHEDLVRSIKE 241

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           K+ PLGD+++FV GHGP ST G ERR NPF+   +
Sbjct: 242 KLWPLGDDVTFVPGHGPVSTFGDERRTNPFVSDKV 276


>gi|206558563|ref|YP_002229323.1| metallo-beta-lactamase superfamily protein [Burkholderia
           cenocepacia J2315]
 gi|198034600|emb|CAR50466.1| metallo-beta-lactamase superfamily protein [Burkholderia
           cenocepacia J2315]
          Length = 214

 Score =  194 bits (494), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 90/213 (42%), Positives = 133/213 (62%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +   ++ VTPF+QNC+ L  E++  A VVDPGGDLD I+  +  +N  V+++ +THGH+D
Sbjct: 1   MKVTLIPVTPFQQNCSLLVCEKTGRAAVVDPGGDLDRIEQEVARQNVQVEKVLLTHGHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H  GA  L     + I GP +++   + K+  Q+        A +   D+WL DGDT+  
Sbjct: 61  HCAGAKTLATHYGVPIEGPQEEERFWIEKLPMQSERFGFPA-ADSFEPDQWLNDGDTVRF 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V+HCPGH+PGHV++ +  +  A +GD LF  SIGRTD   G+++ L+ SI  K+
Sbjct: 120 GDETLEVYHCPGHTPGHVVFFSRAHRIAIVGDVLFAGSIGRTDFPRGNHEDLVRSIKEKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            PLGD+++FV GHGP ST G ERR NPF+   +
Sbjct: 180 WPLGDDVTFVPGHGPVSTFGDERRTNPFVSDKV 212


>gi|152969511|ref|YP_001334620.1| putative enzyme [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
 gi|238893983|ref|YP_002918717.1| putative enzyme [Klebsiella pneumoniae NTUH-K2044]
 gi|262040973|ref|ZP_06014195.1| metallo-beta-lactamase [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|330013902|ref|ZP_08307826.1| metallo-beta-lactamase domain protein [Klebsiella sp. MS 92-3]
 gi|150954360|gb|ABR76390.1| putative enzyme [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
 gi|238546299|dbj|BAH62650.1| putative enzyme [Klebsiella pneumoniae subsp. pneumoniae
           NTUH-K2044]
 gi|259041667|gb|EEW42716.1| metallo-beta-lactamase [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|328533307|gb|EGF60056.1| metallo-beta-lactamase domain protein [Klebsiella sp. MS 92-3]
          Length = 215

 Score =  194 bits (494), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 87/213 (40%), Positives = 136/213 (63%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++ I+ VT F QNC+ ++  ++  A +VDPGGD + IK V+      + QI +THGH+D
Sbjct: 1   MNYRIIPVTAFAQNCSLIWCGQTRLAALVDPGGDAERIKAVVAEAGVTLMQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L +   + +IGP K+D   +  +  Q+R+  +    +    DRWL +GD + +
Sbjct: 61  HVGAAAELAQHYGVPVIGPEKEDEFWLEGLPAQSRMFGLEDC-QPLRPDRWLNEGDVVNV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGHV++ +  +     GD +F+  +GR+D   GD+ QLI +I  K+
Sbjct: 120 GNVALQVLHCPGHTPGHVVFFDDASRLLISGDVIFKGGVGRSDFPRGDHGQLIAAIKEKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           LPLGD+++F+ GHGP ST+G ERR NPFL+  +
Sbjct: 180 LPLGDDVTFIPGHGPLSTLGEERRNNPFLQDEM 212


>gi|170680350|ref|YP_001744243.1| metallo-beta-lactamase family protein [Escherichia coli SMS-3-5]
 gi|218700554|ref|YP_002408183.1| putative metal-binding hydrolase [Escherichia coli IAI39]
 gi|300937728|ref|ZP_07152529.1| metallo-beta-lactamase domain protein [Escherichia coli MS 21-1]
 gi|170518068|gb|ACB16246.1| metallo-beta-lactamase family protein [Escherichia coli SMS-3-5]
 gi|218370540|emb|CAR18347.1| putative metal-binding hydrolase [Escherichia coli IAI39]
 gi|300457235|gb|EFK20728.1| metallo-beta-lactamase domain protein [Escherichia coli MS 21-1]
 gi|315296216|gb|EFU55523.1| metallo-beta-lactamase domain protein [Escherichia coli MS 16-3]
 gi|323967174|gb|EGB62598.1| metallo-beta-lactamase superfamily protein [Escherichia coli M863]
          Length = 215

 Score =  194 bits (494), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 87/213 (40%), Positives = 138/213 (64%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++ I+ VT F QNC+ ++ E++  A +VDPGGD + IK  + +    + QI +THGH+D
Sbjct: 1   MNYRIIPVTAFSQNCSLIWCEQTRLAALVDPGGDAEKIKQEVDASGLTLMQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L +   + + GP K+D   +  +  Q+R+  +    +  + DRWL +GDT+ +
Sbjct: 61  HVGAAAELAQHYGVPVFGPEKEDEFWLQGLPAQSRMFGLEEC-QPLTPDRWLNEGDTISI 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGHV++ +        GD +F+  +GR+D   GD+ QLI+SI +K+
Sbjct: 120 GNVTLQVLHCPGHTPGHVVFFDERARLLISGDVIFKGGVGRSDFPRGDHNQLISSIKDKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           LPLGD+++F+ GHGP ST+G ER  NPFL+  +
Sbjct: 180 LPLGDDVTFIPGHGPLSTLGYERLHNPFLQDEM 212


>gi|327253717|gb|EGE65346.1| metallo-beta-lactamase superfamily protein [Escherichia coli
           STEC_7v]
          Length = 215

 Score =  194 bits (494), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 87/213 (40%), Positives = 138/213 (64%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++ I+ VT F QNC+ ++ E++  A +VDPGGD + IK  + +    + QI +THGH+D
Sbjct: 1   MNYRIIPVTAFSQNCSLIWCEQTRLAALVDPGGDAEKIKQEVDASGLTLMQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L +   + + GP K+D   +  +  Q+R+  +    +  + DRWL +GDT+ +
Sbjct: 61  HVGAAAELVQHYGVPVFGPEKEDEFWLQGLPAQSRMFGLEEC-QPLTPDRWLNEGDTISI 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGHV++ +        GD +F+  +GR+D   GD+ QLI+SI +K+
Sbjct: 120 GNVTLQVLHCPGHTPGHVVFFDERARLLISGDVIFKGGVGRSDFPRGDHNQLISSIKDKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           LPLGD+++F+ GHGP ST+G ER  NPFL+  +
Sbjct: 180 LPLGDDVTFIPGHGPLSTLGYERLHNPFLQDEM 212


>gi|15800788|ref|NP_286802.1| hypothetical protein Z1274 [Escherichia coli O157:H7 EDL933]
 gi|15830264|ref|NP_309037.1| hypothetical protein ECs1010 [Escherichia coli O157:H7 str. Sakai]
 gi|26246954|ref|NP_752994.1| hypothetical protein c1069 [Escherichia coli CFT073]
 gi|91210029|ref|YP_540015.1| hypothetical protein UTI89_C0999 [Escherichia coli UTI89]
 gi|110641124|ref|YP_668854.1| hypothetical protein ECP_0938 [Escherichia coli 536]
 gi|117623145|ref|YP_852058.1| YcbL [Escherichia coli APEC O1]
 gi|168751191|ref|ZP_02776213.1| metallo-beta-lactamase family protein [Escherichia coli O157:H7
           str. EC4113]
 gi|168757020|ref|ZP_02782027.1| metallo-beta-lactamase family protein [Escherichia coli O157:H7
           str. EC4401]
 gi|168762935|ref|ZP_02787942.1| metallo-beta-lactamase family protein [Escherichia coli O157:H7
           str. EC4501]
 gi|168769923|ref|ZP_02794930.1| metallo-beta-lactamase family protein [Escherichia coli O157:H7
           str. EC4486]
 gi|168776219|ref|ZP_02801226.1| metallo-beta-lactamase family protein [Escherichia coli O157:H7
           str. EC4196]
 gi|168783981|ref|ZP_02808988.1| metallo-beta-lactamase family protein [Escherichia coli O157:H7
           str. EC4076]
 gi|168787357|ref|ZP_02812364.1| metallo-beta-lactamase family protein [Escherichia coli O157:H7
           str. EC869]
 gi|168802923|ref|ZP_02827930.1| metallo-beta-lactamase family protein [Escherichia coli O157:H7
           str. EC508]
 gi|191172140|ref|ZP_03033684.1| metallo-beta-lactamase family protein [Escherichia coli F11]
 gi|195939658|ref|ZP_03085040.1| YcbL [Escherichia coli O157:H7 str. EC4024]
 gi|208806417|ref|ZP_03248754.1| metallo-beta-lactamase family protein [Escherichia coli O157:H7
           str. EC4206]
 gi|208814804|ref|ZP_03255983.1| metallo-beta-lactamase family protein [Escherichia coli O157:H7
           str. EC4045]
 gi|208822583|ref|ZP_03262902.1| metallo-beta-lactamase family protein [Escherichia coli O157:H7
           str. EC4042]
 gi|209395793|ref|YP_002269599.1| metallo-beta-lactamase family protein [Escherichia coli O157:H7
           str. EC4115]
 gi|217325208|ref|ZP_03441292.1| metallo-beta-lactamase family protein [Escherichia coli O157:H7
           str. TW14588]
 gi|218557832|ref|YP_002390745.1| metal-binding hydrolase [Escherichia coli S88]
 gi|218688770|ref|YP_002396982.1| putative metal-binding hydrolase [Escherichia coli ED1a]
 gi|227884108|ref|ZP_04001913.1| zinc (Zn2+)-dependent hydrolase [Escherichia coli 83972]
 gi|237707085|ref|ZP_04537566.1| YcbL [Escherichia sp. 3_2_53FAA]
 gi|254792126|ref|YP_003076963.1| putative metal-binding enzyme [Escherichia coli O157:H7 str.
           TW14359]
 gi|261227430|ref|ZP_05941711.1| predicted metal-binding enzyme [Escherichia coli O157:H7 str.
           FRIK2000]
 gi|261256147|ref|ZP_05948680.1| predicted metal-binding enzyme [Escherichia coli O157:H7 str.
           FRIK966]
 gi|291281928|ref|YP_003498746.1| Metallo-beta-lactamase family protein [Escherichia coli O55:H7 str.
           CB9615]
 gi|293409304|ref|ZP_06652880.1| conserved hypothetical protein [Escherichia coli B354]
 gi|300978414|ref|ZP_07174262.1| metallo-beta-lactamase domain protein [Escherichia coli MS 45-1]
 gi|300983086|ref|ZP_07176430.1| metallo-beta-lactamase domain protein [Escherichia coli MS 200-1]
 gi|301047812|ref|ZP_07194864.1| metallo-beta-lactamase domain protein [Escherichia coli MS 185-1]
 gi|306812620|ref|ZP_07446813.1| Metallo-beta-lactamase family protein [Escherichia coli NC101]
 gi|331656998|ref|ZP_08357960.1| putative Metallo-beta-lactamase [Escherichia coli TA206]
 gi|12514099|gb|AAG55412.1|AE005282_7 orf, hypothetical protein [Escherichia coli O157:H7 str. EDL933]
 gi|26107354|gb|AAN79537.1|AE016758_141 Hypothetical protein ycbL [Escherichia coli CFT073]
 gi|13360469|dbj|BAB34433.1| hypothetical protein [Escherichia coli O157:H7 str. Sakai]
 gi|91071603|gb|ABE06484.1| hypothetical protein UTI89_C0999 [Escherichia coli UTI89]
 gi|110342716|gb|ABG68953.1| hypothetical protein YcbL [Escherichia coli 536]
 gi|115512269|gb|ABJ00344.1| YcbL [Escherichia coli APEC O1]
 gi|187768360|gb|EDU32204.1| metallo-beta-lactamase family protein [Escherichia coli O157:H7
           str. EC4196]
 gi|188014715|gb|EDU52837.1| metallo-beta-lactamase family protein [Escherichia coli O157:H7
           str. EC4113]
 gi|188998778|gb|EDU67764.1| metallo-beta-lactamase family protein [Escherichia coli O157:H7
           str. EC4076]
 gi|189355912|gb|EDU74331.1| metallo-beta-lactamase family protein [Escherichia coli O157:H7
           str. EC4401]
 gi|189361174|gb|EDU79593.1| metallo-beta-lactamase family protein [Escherichia coli O157:H7
           str. EC4486]
 gi|189366788|gb|EDU85204.1| metallo-beta-lactamase family protein [Escherichia coli O157:H7
           str. EC4501]
 gi|189372736|gb|EDU91152.1| metallo-beta-lactamase family protein [Escherichia coli O157:H7
           str. EC869]
 gi|189375249|gb|EDU93665.1| metallo-beta-lactamase family protein [Escherichia coli O157:H7
           str. EC508]
 gi|190907667|gb|EDV67262.1| metallo-beta-lactamase family protein [Escherichia coli F11]
 gi|208726218|gb|EDZ75819.1| metallo-beta-lactamase family protein [Escherichia coli O157:H7
           str. EC4206]
 gi|208731452|gb|EDZ80140.1| metallo-beta-lactamase family protein [Escherichia coli O157:H7
           str. EC4045]
 gi|208738068|gb|EDZ85751.1| metallo-beta-lactamase family protein [Escherichia coli O157:H7
           str. EC4042]
 gi|209157193|gb|ACI34626.1| metallo-beta-lactamase family protein [Escherichia coli O157:H7
           str. EC4115]
 gi|209774728|gb|ACI85676.1| hypothetical protein ECs1010 [Escherichia coli]
 gi|209774730|gb|ACI85677.1| hypothetical protein ECs1010 [Escherichia coli]
 gi|209774732|gb|ACI85678.1| hypothetical protein ECs1010 [Escherichia coli]
 gi|209774734|gb|ACI85679.1| hypothetical protein ECs1010 [Escherichia coli]
 gi|209774736|gb|ACI85680.1| hypothetical protein ECs1010 [Escherichia coli]
 gi|217321429|gb|EEC29853.1| metallo-beta-lactamase family protein [Escherichia coli O157:H7
           str. TW14588]
 gi|218364601|emb|CAR02287.1| putative metal-binding hydrolase [Escherichia coli S88]
 gi|218426334|emb|CAR07159.1| putative metal-binding hydrolase [Escherichia coli ED1a]
 gi|222032658|emb|CAP75397.1| Uncharacterized protein ycbL [Escherichia coli LF82]
 gi|226898295|gb|EEH84554.1| YcbL [Escherichia sp. 3_2_53FAA]
 gi|227838860|gb|EEJ49326.1| zinc (Zn2+)-dependent hydrolase [Escherichia coli 83972]
 gi|254591526|gb|ACT70887.1| predicted metal-binding enzyme [Escherichia coli O157:H7 str.
           TW14359]
 gi|290761801|gb|ADD55762.1| Metallo-beta-lactamase family protein [Escherichia coli O55:H7 str.
           CB9615]
 gi|291469772|gb|EFF12256.1| conserved hypothetical protein [Escherichia coli B354]
 gi|294492636|gb|ADE91392.1| metallo-beta-lactamase family protein [Escherichia coli IHE3034]
 gi|300300304|gb|EFJ56689.1| metallo-beta-lactamase domain protein [Escherichia coli MS 185-1]
 gi|300306990|gb|EFJ61510.1| metallo-beta-lactamase domain protein [Escherichia coli MS 200-1]
 gi|300409656|gb|EFJ93194.1| metallo-beta-lactamase domain protein [Escherichia coli MS 45-1]
 gi|305853383|gb|EFM53822.1| Metallo-beta-lactamase family protein [Escherichia coli NC101]
 gi|307552766|gb|ADN45541.1| hypothetical protein ECABU_c09660 [Escherichia coli ABU 83972]
 gi|307627646|gb|ADN71950.1| Metallo-beta-lactamase family protein [Escherichia coli UM146]
 gi|312945447|gb|ADR26274.1| predicted metal-binding enzyme [Escherichia coli O83:H1 str. NRG
           857C]
 gi|315287546|gb|EFU46952.1| metallo-beta-lactamase domain protein [Escherichia coli MS 110-3]
 gi|315291225|gb|EFU50585.1| metallo-beta-lactamase domain protein [Escherichia coli MS 153-1]
 gi|320192587|gb|EFW67228.1| hypothetical protein ECoD_00514 [Escherichia coli O157:H7 str.
           EC1212]
 gi|320196578|gb|EFW71201.1| hypothetical protein EcoM_01119 [Escherichia coli WV_060327]
 gi|320637795|gb|EFX07587.1| Metallo-beta-lactamase family protein [Escherichia coli O157:H7
           str. G5101]
 gi|320642920|gb|EFX12121.1| Metallo-beta-lactamase family protein [Escherichia coli O157:H-
           str. 493-89]
 gi|320648377|gb|EFX17032.1| Metallo-beta-lactamase family protein [Escherichia coli O157:H-
           str. H 2687]
 gi|320653693|gb|EFX21767.1| Metallo-beta-lactamase family protein [Escherichia coli O55:H7 str.
           3256-97 TW 07815]
 gi|320659838|gb|EFX27394.1| Metallo-beta-lactamase family protein [Escherichia coli O55:H7 str.
           USDA 5905]
 gi|320664307|gb|EFX31458.1| Metallo-beta-lactamase family protein [Escherichia coli O157:H7
           str. LSU-61]
 gi|323953365|gb|EGB49231.1| metallo-beta-lactamase superfamily protein [Escherichia coli H252]
 gi|323958232|gb|EGB53941.1| metallo-beta-lactamase superfamily protein [Escherichia coli H263]
 gi|324009852|gb|EGB79071.1| metallo-beta-lactamase domain protein [Escherichia coli MS 57-2]
 gi|324012954|gb|EGB82173.1| metallo-beta-lactamase domain protein [Escherichia coli MS 60-1]
 gi|326338178|gb|EGD62007.1| hypothetical protein ECF_05129 [Escherichia coli O157:H7 str. 1125]
 gi|326346155|gb|EGD69893.1| putative metallo-beta-lactamase [Escherichia coli O157:H7 str.
           1044]
 gi|331055246|gb|EGI27255.1| putative Metallo-beta-lactamase [Escherichia coli TA206]
          Length = 215

 Score =  194 bits (493), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 87/213 (40%), Positives = 138/213 (64%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++ I+ VT F QNC+ ++ E++  A +VDPGGD + IK  + +    + QI +THGH+D
Sbjct: 1   MNYRIIPVTAFSQNCSLIWCEQTRLAALVDPGGDAEKIKQEVDASGLTLMQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L +   + + GP K+D   +  +  Q+R+  +    +  + DRWL +GDT+ +
Sbjct: 61  HVGAAAELAQHYGVPVFGPEKEDEFWLQGLPAQSRMFGLEEC-QPLTPDRWLNEGDTISI 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGHV++ +        GD +F+  +GR+D   GD+ QLI+SI +K+
Sbjct: 120 GNVTLQVLHCPGHTPGHVVFFDDRAKLLISGDVIFKGGVGRSDFPRGDHNQLISSIKDKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           LPLGD+++F+ GHGP ST+G ER  NPFL+  +
Sbjct: 180 LPLGDDVTFIPGHGPLSTLGYERLHNPFLQDEM 212


>gi|194434389|ref|ZP_03066652.1| metallo-beta-lactamase family protein [Shigella dysenteriae 1012]
 gi|194417373|gb|EDX33479.1| metallo-beta-lactamase family protein [Shigella dysenteriae 1012]
 gi|332095877|gb|EGJ00884.1| metallo-beta-lactamase superfamily protein [Shigella dysenteriae
           155-74]
          Length = 215

 Score =  194 bits (493), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 87/213 (40%), Positives = 139/213 (65%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++ I+ VT F QNC+ ++ E++  A +VDPGGD + IK  +      + QI +THGH+D
Sbjct: 1   MNYRIIPVTAFSQNCSLIWCEQTRLAALVDPGGDAEKIKQEVDDSGLTLMQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L +   + + GP K+D   +  +  Q+R+  +    ++ + DRWL++GDT+ +
Sbjct: 61  HVGAAAELAQHYGVPVFGPEKEDEFWLQGLPAQSRMFGLEEC-QSLTPDRWLKEGDTISI 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGHV++ +        GD +F+  +GR+D   GD+ QLI+SI +K+
Sbjct: 120 GNVTLQVLHCPGHTPGHVVFFDDRAKLLISGDVIFKGGVGRSDFPRGDHNQLISSIKDKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           LPLGD+++F+ GHGP ST+G ER  NPFL+  +
Sbjct: 180 LPLGDDVTFIPGHGPLSTLGYERLHNPFLQDEM 212


>gi|242239072|ref|YP_002987253.1| beta-lactamase [Dickeya dadantii Ech703]
 gi|242131129|gb|ACS85431.1| beta-lactamase domain protein [Dickeya dadantii Ech703]
          Length = 211

 Score =  194 bits (493), Expect = 7e-48,   Method: Composition-based stats.
 Identities = 93/211 (44%), Positives = 136/211 (64%), Gaps = 1/211 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + I+ VT F QNCT L+ E++L+A +VDPGG+ + I   ++     VKQI +THGH+D
Sbjct: 1   MKYQIIPVTAFSQNCTLLWCEKTLQAAIVDPGGEAEKIIRGVEQVGVTVKQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG A  L E   + +IGP + DA  +  +  Q+R+  ++         RWLQDGD + +
Sbjct: 61  HVGAAVTLAEHYQVPVIGPQEADAFWLNGLPAQSRMFGLQDC-PPLVPARWLQDGDRISV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G  +  V HCPGH+PGHV++V+ +   A +GD LFR  +GR+D   G++  LINSI  ++
Sbjct: 120 GECVMTVLHCPGHTPGHVVFVDEQARLAQVGDVLFRGGVGRSDFPGGNHDALINSIQTQL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
            PLGD+I+F+ GHGP ST G ERR NPF++ 
Sbjct: 180 FPLGDDITFIPGHGPTSTFGEERRTNPFVRD 210


>gi|170746764|ref|YP_001753024.1| beta-lactamase domain-containing protein [Methylobacterium
           radiotolerans JCM 2831]
 gi|170653286|gb|ACB22341.1| beta-lactamase domain protein [Methylobacterium radiotolerans JCM
           2831]
          Length = 214

 Score =  194 bits (493), Expect = 7e-48,   Method: Composition-based stats.
 Identities = 97/207 (46%), Positives = 143/207 (69%), Gaps = 1/207 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           I+ VTPF+QNCT ++D+ +    VVDPGGDLD I+  I+ +   V++I +THGHVDH  G
Sbjct: 9   IIPVTPFQQNCTLIWDDATKVGAVVDPGGDLDRIEAAIREQGVTVEKILLTHGHVDHAAG 68

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           A +L+E L + I GPH+ D  ++  + E A    +   AR  + DRWL +GD + +G   
Sbjct: 69  ADELRERLGVPIEGPHQADKFLLDSLPETAANYGL-GAARPVTPDRWLDEGDAVTVGGLA 127

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
           F + HCPGHSPG V++V+ +  FA +GD +F+ S+GRTD+  G+++QLI++I  K+LPLG
Sbjct: 128 FDILHCPGHSPGSVVFVSRDARFALVGDVVFKGSVGRTDLPGGNHEQLIHAIKEKVLPLG 187

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLKS 214
           D+++F+ GHGP ST+G ER  NPFL+ 
Sbjct: 188 DDVAFIPGHGPTSTLGAERVSNPFLQD 214


>gi|16128894|ref|NP_415447.1| predicted metal-binding enzyme [Escherichia coli str. K-12 substr.
           MG1655]
 gi|89107777|ref|AP_001557.1| predicted metal-binding enzyme [Escherichia coli str. K-12 substr.
           W3110]
 gi|170080585|ref|YP_001729905.1| metal-binding protein [Escherichia coli str. K-12 substr. DH10B]
 gi|188491939|ref|ZP_02999209.1| metallo-beta-lactamase family protein [Escherichia coli 53638]
 gi|194438724|ref|ZP_03070811.1| metallo-beta-lactamase family protein [Escherichia coli 101-1]
 gi|238900185|ref|YP_002925981.1| putative metal-binding enzyme [Escherichia coli BW2952]
 gi|253774044|ref|YP_003036875.1| beta-lactamase [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|254161041|ref|YP_003044149.1| putative metal-binding enzyme [Escherichia coli B str. REL606]
 gi|256023372|ref|ZP_05437237.1| predicted metal-binding enzyme [Escherichia sp. 4_1_40B]
 gi|297521036|ref|ZP_06939422.1| predicted metal-binding enzyme [Escherichia coli OP50]
 gi|300929622|ref|ZP_07145084.1| metallo-beta-lactamase domain protein [Escherichia coli MS 187-1]
 gi|300949710|ref|ZP_07163689.1| metallo-beta-lactamase domain protein [Escherichia coli MS 116-1]
 gi|300955425|ref|ZP_07167799.1| metallo-beta-lactamase domain protein [Escherichia coli MS 175-1]
 gi|301022421|ref|ZP_07186304.1| metallo-beta-lactamase domain protein [Escherichia coli MS 196-1]
 gi|301643447|ref|ZP_07243495.1| metallo-beta-lactamase domain protein [Escherichia coli MS 146-1]
 gi|307137556|ref|ZP_07496912.1| predicted metal-binding enzyme [Escherichia coli H736]
 gi|312971057|ref|ZP_07785236.1| metallo-beta-lactamase superfamily protein [Escherichia coli
           1827-70]
 gi|331641453|ref|ZP_08342588.1| putative Metallo-beta-lactamase [Escherichia coli H736]
 gi|2494856|sp|P75849|YCBL_ECOLI RecName: Full=Uncharacterized protein ycbL
 gi|1787158|gb|AAC74013.1| predicted metal-binding enzyme [Escherichia coli str. K-12 substr.
           MG1655]
 gi|4062494|dbj|BAA35673.1| predicted metal-binding enzyme [Escherichia coli str. K12 substr.
           W3110]
 gi|169888420|gb|ACB02127.1| predicted metal-binding enzyme [Escherichia coli str. K-12 substr.
           DH10B]
 gi|188487138|gb|EDU62241.1| metallo-beta-lactamase family protein [Escherichia coli 53638]
 gi|194422356|gb|EDX38356.1| metallo-beta-lactamase family protein [Escherichia coli 101-1]
 gi|238862657|gb|ACR64655.1| predicted metal-binding enzyme [Escherichia coli BW2952]
 gi|242376742|emb|CAQ31455.1| predicted metal-binding enzyme [Escherichia coli BL21(DE3)]
 gi|253325088|gb|ACT29690.1| beta-lactamase domain protein [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|253972942|gb|ACT38613.1| predicted metal-binding enzyme [Escherichia coli B str. REL606]
 gi|253977156|gb|ACT42826.1| predicted metal-binding enzyme [Escherichia coli BL21(DE3)]
 gi|260449927|gb|ACX40349.1| beta-lactamase domain protein [Escherichia coli DH1]
 gi|299881262|gb|EFI89473.1| metallo-beta-lactamase domain protein [Escherichia coli MS 196-1]
 gi|300317648|gb|EFJ67432.1| metallo-beta-lactamase domain protein [Escherichia coli MS 175-1]
 gi|300450891|gb|EFK14511.1| metallo-beta-lactamase domain protein [Escherichia coli MS 116-1]
 gi|300462459|gb|EFK25952.1| metallo-beta-lactamase domain protein [Escherichia coli MS 187-1]
 gi|301078161|gb|EFK92967.1| metallo-beta-lactamase domain protein [Escherichia coli MS 146-1]
 gi|309701203|emb|CBJ00503.1| conserved hypothetical protein [Escherichia coli ETEC H10407]
 gi|310336818|gb|EFQ01985.1| metallo-beta-lactamase superfamily protein [Escherichia coli
           1827-70]
 gi|315135575|dbj|BAJ42734.1| putative metal-binding enzyme [Escherichia coli DH1]
 gi|315619121|gb|EFU99701.1| metallo-beta-lactamase superfamily protein [Escherichia coli 3431]
 gi|323938033|gb|EGB34295.1| metallo-beta-lactamase superfamily protein [Escherichia coli E1520]
 gi|323942843|gb|EGB39008.1| metallo-beta-lactamase superfamily protein [Escherichia coli E482]
 gi|323962919|gb|EGB58493.1| metallo-beta-lactamase superfamily protein [Escherichia coli H489]
 gi|323973198|gb|EGB68390.1| metallo-beta-lactamase superfamily protein [Escherichia coli TA007]
 gi|331038251|gb|EGI10471.1| putative Metallo-beta-lactamase [Escherichia coli H736]
          Length = 215

 Score =  194 bits (493), Expect = 7e-48,   Method: Composition-based stats.
 Identities = 87/213 (40%), Positives = 136/213 (63%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++ I+ VT F QNC+ ++ E++  A +VDPGGD + IK  +      + QI +THGH+D
Sbjct: 1   MNYRIIPVTAFSQNCSLIWCEQTRLAALVDPGGDAEKIKQEVDDSGLTLMQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L +   + + GP K+D   +  +  Q+R+  +    +  + DRWL +GDT+ +
Sbjct: 61  HVGAAAELAQHYGVPVFGPEKEDEFWLQGLPAQSRMFGLEEC-QPLTPDRWLNEGDTISI 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGHV++ +        GD +F+  +GR+D   GD+ QLI+SI +K+
Sbjct: 120 GNVTLQVLHCPGHTPGHVVFFDDRAKLLISGDVIFKGGVGRSDFPRGDHNQLISSIKDKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           LPLGD++ F+ GHGP ST+G ER  NPFL+  +
Sbjct: 180 LPLGDDVIFIPGHGPLSTLGYERLHNPFLQDEM 212


>gi|119775277|ref|YP_928017.1| metallo-beta-lactamase family protein [Shewanella amazonensis SB2B]
 gi|119767777|gb|ABM00348.1| metallo-beta-lactamase family protein [Shewanella amazonensis SB2B]
          Length = 214

 Score =  194 bits (493), Expect = 7e-48,   Method: Composition-based stats.
 Identities = 89/213 (41%), Positives = 133/213 (62%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + I+ VTPF+QNCT ++ E + +A VVDPGG+L+ I + ++     + +I +THGH+D
Sbjct: 1   MKYQIIPVTPFQQNCTLIWCENTRKAAVVDPGGNLERIYEALEKHGLTLDKILLTHGHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVGGAA+L  +  + I GPH DDA  +  +  Q++           +  R+L++G++L +
Sbjct: 61  HVGGAAKLSTETGVAIEGPHVDDAFWLENLPRQSQNFGFAHC-DAFAPSRYLEEGESLRI 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGH+PGH+++       A +GD LFR SIGRTD    D++ LINSI  K+
Sbjct: 120 GDVSLAVMHCPGHTPGHLVFFEPVTKLALVGDVLFRGSIGRTDFPGSDHKALINSITTKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            PLG E++F+ GHGP ST   ER  NPF+   +
Sbjct: 180 WPLGKEVAFIPGHGPMSTFAEERAHNPFVADQL 212


>gi|323190747|gb|EFZ76016.1| metallo-beta-lactamase superfamily protein [Escherichia coli
           RN587/1]
          Length = 215

 Score =  194 bits (493), Expect = 8e-48,   Method: Composition-based stats.
 Identities = 86/213 (40%), Positives = 138/213 (64%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++ I+ VT F QNC+ ++ E++  A +VDPGGD + IK  + +    + QI +THGH+D
Sbjct: 1   MNYRIIPVTAFSQNCSLIWCEQTRLAALVDPGGDAEKIKQEVDASGLTLMQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L +   + + GP K+D   +  +  Q+R+  +    +  + DRWL +GDT+ +
Sbjct: 61  HVGAAAELAQHYGVPVFGPEKEDEFWLQGLPAQSRMFGLEEC-QPLTPDRWLNEGDTISI 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    ++ HCPGH+PGHV++ +        GD +F+  +GR+D   GD+ QLI+SI +K+
Sbjct: 120 GNVTLQMLHCPGHTPGHVVFFDDRAKLLISGDVIFKGGVGRSDFPRGDHNQLISSIKDKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           LPLGD+++F+ GHGP ST+G ER  NPFL+  +
Sbjct: 180 LPLGDDVTFIPGHGPLSTLGYERLHNPFLQDEM 212


>gi|156934581|ref|YP_001438497.1| hypothetical protein ESA_02415 [Cronobacter sakazakii ATCC BAA-894]
 gi|156532835|gb|ABU77661.1| hypothetical protein ESA_02415 [Cronobacter sakazakii ATCC BAA-894]
          Length = 215

 Score =  194 bits (492), Expect = 8e-48,   Method: Composition-based stats.
 Identities = 89/213 (41%), Positives = 140/213 (65%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++HI+ VT F QNC+ ++ EE+ +A +VDPGGD   IK+ +      ++QI +THGH+D
Sbjct: 1   MNYHIIPVTAFAQNCSLIWCEETRQAALVDPGGDAQRIKEEVARIGVTLQQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L     + IIGP K+D   +  +  Q+R+  +    +  + DRWL +GDT+ +
Sbjct: 61  HVGAAAELAAHYGIPIIGPEKEDEFWLQGLPAQSRMFGLDEC-QPLTPDRWLNEGDTVSV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGH+PGH+++ + ++     GD +F+  +GR+D   GD+ QLI++I  K+
Sbjct: 120 GNITLAVLHCPGHTPGHIVFFDAQSRLLVSGDVIFKGGVGRSDFPRGDHSQLIDAIKRKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           LPLGD+++F+ GHGP ST+G ER  NPFL+  +
Sbjct: 180 LPLGDDVTFIPGHGPMSTLGHERLHNPFLQDEM 212


>gi|300722555|ref|YP_003711845.1| hypothetical protein XNC1_1584 [Xenorhabdus nematophila ATCC 19061]
 gi|297629062|emb|CBJ89647.1| putative enzyme with metallo-hydrolase/oxidoreductase domain
           [Xenorhabdus nematophila ATCC 19061]
          Length = 210

 Score =  194 bits (492), Expect = 9e-48,   Method: Composition-based stats.
 Identities = 93/210 (44%), Positives = 132/210 (62%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + +HI+ VT   QNCT ++ EE+ EA +VDPGG+ + +   I+ R   V QI +THGH D
Sbjct: 1   MKYHIIPVTMAMQNCTLIWCEETQEAAIVDPGGNAEQLIAEIERRGLKVTQILLTHGHYD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG   ++ +   + + GPHK DA  +  ++ Q ++  +     + + DRWL +GDTL +
Sbjct: 61  HVGATVEVSKHFDVPVYGPHKGDAFWIEGLEIQCQMFGVEPC-PSFTPDRWLDEGDTLHV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGH+PGH+I  N       +GD LF+ SIGRTD   G+Y +LI SI  K+
Sbjct: 120 GNVELSVLHCPGHTPGHIILANHTEKLISMGDVLFKGSIGRTDFPGGNYDELIQSIKQKV 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           LPLGD+  F+ GHGP ST+G ER+ NPFL+
Sbjct: 180 LPLGDDYQFIPGHGPMSTLGHERKTNPFLQ 209


>gi|333008913|gb|EGK28373.1| metallo-beta-lactamase superfamily protein [Shigella flexneri
           K-272]
 gi|333020223|gb|EGK39493.1| metallo-beta-lactamase superfamily protein [Shigella flexneri
           K-227]
          Length = 215

 Score =  194 bits (492), Expect = 9e-48,   Method: Composition-based stats.
 Identities = 86/213 (40%), Positives = 137/213 (64%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++ I+ VT F QNC+ ++ E++  A +VDPGGD + IK  +      + +I +THGH+D
Sbjct: 1   MNYRIIPVTAFSQNCSLIWCEQTRLAALVDPGGDAEKIKQEVDDSGLTLMKILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L +   + + GP K+D   +  +  Q+R+  +    +  + DRWL +GDT+ +
Sbjct: 61  HVGAAAELAQHYGVPVFGPEKEDEFWLQGLPAQSRMFGLEEC-QPLTPDRWLNEGDTISI 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGHV++ +        GD +F+  +GR+D   GD+ QLI+SI +K+
Sbjct: 120 GNVTLQVLHCPGHTPGHVVFFDDRAKLLISGDVIFKGGVGRSDFPRGDHNQLISSIKDKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           LPLGD+++F+ GHGP ST+G ER  NPFL+  +
Sbjct: 180 LPLGDDVTFIPGHGPLSTLGYERLHNPFLQDEM 212


>gi|283784754|ref|YP_003364619.1| hypothetical protein ROD_09961 [Citrobacter rodentium ICC168]
 gi|282948208|emb|CBG87775.1| conserved hypothetical protein [Citrobacter rodentium ICC168]
          Length = 215

 Score =  194 bits (492), Expect = 9e-48,   Method: Composition-based stats.
 Identities = 85/213 (39%), Positives = 140/213 (65%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++ I+ VT F QNC+ ++ E++  A +VDPGGD + IK  + +    + QI +THGH+D
Sbjct: 1   MNYRIIPVTAFSQNCSLIWCEQTRLAALVDPGGDAEKIKQEVDASGVTLMQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L     + +IGP K+D   +  +  Q+R+  +    +  + DRWL++G+++ +
Sbjct: 61  HVGAAAELAAHYGVPVIGPEKEDEFWLQGLPAQSRMFGLDEC-QPLTPDRWLEEGESVNV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGH+++ +  +     GD +F+  +GR+D   GD+ QLI+SI +K+
Sbjct: 120 GNVTLQVLHCPGHTPGHIVFFDDRSRLLISGDVIFKGGVGRSDFPRGDHSQLIDSIKSKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           LPLGD+++F+ GHGP ST+G ER  NPFL+  +
Sbjct: 180 LPLGDDVTFIPGHGPLSTLGYERLHNPFLQDEM 212


>gi|238792381|ref|ZP_04636015.1| hypothetical protein yinte0001_13090 [Yersinia intermedia ATCC
           29909]
 gi|238728307|gb|EEQ19827.1| hypothetical protein yinte0001_13090 [Yersinia intermedia ATCC
           29909]
          Length = 215

 Score =  194 bits (492), Expect = 9e-48,   Method: Composition-based stats.
 Identities = 88/211 (41%), Positives = 132/211 (62%), Gaps = 1/211 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + I+ VT F QNCT ++ E + +A +VDPGGD   I   +  +   V QI +THGH+D
Sbjct: 1   MKYQIIPVTAFSQNCTLIWCEATKQAALVDPGGDAAKIIAEVTRQGVTVSQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG A +L     + I GP K+D   +  +  Q+R+  +       +  RWL++GD + +
Sbjct: 61  HVGAATELAAHFDIPIYGPEKEDTFWLEGLPAQSRMFGLSEC-DAFTPTRWLEEGDKITV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGH+PGH+++++     A +GD +F   +GR+D   GD+QQLINSI  K+
Sbjct: 120 GEVELSVLHCPGHTPGHIVFIDQSGRLALVGDVIFNGGVGRSDFPRGDHQQLINSIRTKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           LPLGD+I+F+ GHGP ST+G ER+ NPF++ 
Sbjct: 180 LPLGDDITFIPGHGPMSTLGHERQTNPFIRE 210


>gi|218704355|ref|YP_002411874.1| putative metal-binding hydrolase [Escherichia coli UMN026]
 gi|293404231|ref|ZP_06648225.1| ycbL protein [Escherichia coli FVEC1412]
 gi|298380012|ref|ZP_06989617.1| ycbL protein [Escherichia coli FVEC1302]
 gi|300901643|ref|ZP_07119703.1| metallo-beta-lactamase domain protein [Escherichia coli MS 198-1]
 gi|301023049|ref|ZP_07186858.1| metallo-beta-lactamase domain protein [Escherichia coli MS 69-1]
 gi|331682436|ref|ZP_08383055.1| putative Metallo-beta-lactamase [Escherichia coli H299]
 gi|218431452|emb|CAR12330.1| putative metal-binding hydrolase [Escherichia coli UMN026]
 gi|284920778|emb|CBG33841.1| conserved hypothetical protein [Escherichia coli 042]
 gi|291428817|gb|EFF01842.1| ycbL protein [Escherichia coli FVEC1412]
 gi|298279710|gb|EFI21218.1| ycbL protein [Escherichia coli FVEC1302]
 gi|300354936|gb|EFJ70806.1| metallo-beta-lactamase domain protein [Escherichia coli MS 198-1]
 gi|300397255|gb|EFJ80793.1| metallo-beta-lactamase domain protein [Escherichia coli MS 69-1]
 gi|323976686|gb|EGB71774.1| metallo-beta-lactamase superfamily protein [Escherichia coli
           TW10509]
 gi|331080067|gb|EGI51246.1| putative Metallo-beta-lactamase [Escherichia coli H299]
          Length = 215

 Score =  194 bits (492), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 87/213 (40%), Positives = 138/213 (64%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++ I+ VT F QNC+ ++ E++  A +VDPGGD + IK  + +    + QI +THGH+D
Sbjct: 1   MNYRIIPVTAFSQNCSLIWCEQTRLAALVDPGGDAEKIKQEVDASGLTLMQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L +   + + GP K+D   +  +  Q+R+  +    +  + DRWL +GDT+ +
Sbjct: 61  HVGAAAELAQHYGVPVFGPEKEDEFWLQGLPAQSRMFGLEEC-QPLTPDRWLNEGDTISI 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGHV++ +        GD +F+  +GR+D   GD+ QLI+SI +K+
Sbjct: 120 GNVALQVLHCPGHTPGHVVFFDDRAKLLISGDVIFKGGVGRSDFPRGDHNQLISSIKDKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           LPLGD+++F+ GHGP ST+G ER  NPFL+  +
Sbjct: 180 LPLGDDVTFIPGHGPLSTLGYERLHNPFLQDEM 212


>gi|24112336|ref|NP_706846.1| hypothetical protein SF0924 [Shigella flexneri 2a str. 301]
 gi|30062462|ref|NP_836633.1| hypothetical protein S0988 [Shigella flexneri 2a str. 2457T]
 gi|74311485|ref|YP_309904.1| hypothetical protein SSON_0930 [Shigella sonnei Ss046]
 gi|82544669|ref|YP_408616.1| hypothetical protein SBO_2218 [Shigella boydii Sb227]
 gi|110804936|ref|YP_688456.1| hypothetical protein SFV_0929 [Shigella flexneri 5 str. 8401]
 gi|157156504|ref|YP_001462146.1| metallo-beta-lactamase family protein [Escherichia coli E24377A]
 gi|157160448|ref|YP_001457766.1| metallo-beta-lactamase family protein [Escherichia coli HS]
 gi|170020671|ref|YP_001725625.1| beta-lactamase domain-containing protein [Escherichia coli ATCC
           8739]
 gi|191166968|ref|ZP_03028791.1| metallo-beta-lactamase family protein [Escherichia coli B7A]
 gi|193064648|ref|ZP_03045727.1| metallo-beta-lactamase family protein [Escherichia coli E22]
 gi|193070749|ref|ZP_03051684.1| metallo-beta-lactamase family protein [Escherichia coli E110019]
 gi|194428338|ref|ZP_03060879.1| metallo-beta-lactamase family protein [Escherichia coli B171]
 gi|209918177|ref|YP_002292261.1| hypothetical protein ECSE_0986 [Escherichia coli SE11]
 gi|218553514|ref|YP_002386427.1| putative metal-binding hydrolase [Escherichia coli IAI1]
 gi|218694401|ref|YP_002402068.1| putative metal-binding hydrolase [Escherichia coli 55989]
 gi|256020945|ref|ZP_05434810.1| putative metal-binding hydrolase [Shigella sp. D9]
 gi|260843176|ref|YP_003220954.1| putative metal-binding enzyme [Escherichia coli O103:H2 str. 12009]
 gi|260854218|ref|YP_003228109.1| putative metal-binding enzyme [Escherichia coli O26:H11 str. 11368]
 gi|260867099|ref|YP_003233501.1| putative metal-binding enzyme [Escherichia coli O111:H- str. 11128]
 gi|293414207|ref|ZP_06656856.1| ycbL protein [Escherichia coli B185]
 gi|293433224|ref|ZP_06661652.1| ycbL protein [Escherichia coli B088]
 gi|300816968|ref|ZP_07097187.1| metallo-beta-lactamase domain protein [Escherichia coli MS 107-1]
 gi|300823667|ref|ZP_07103794.1| metallo-beta-lactamase domain protein [Escherichia coli MS 119-7]
 gi|300902914|ref|ZP_07120859.1| metallo-beta-lactamase domain protein [Escherichia coli MS 84-1]
 gi|300921035|ref|ZP_07137422.1| metallo-beta-lactamase domain protein [Escherichia coli MS 115-1]
 gi|300925395|ref|ZP_07141280.1| metallo-beta-lactamase domain protein [Escherichia coli MS 182-1]
 gi|301302463|ref|ZP_07208594.1| metallo-beta-lactamase domain protein [Escherichia coli MS 124-1]
 gi|301326641|ref|ZP_07219971.1| metallo-beta-lactamase domain protein [Escherichia coli MS 78-1]
 gi|307311686|ref|ZP_07591326.1| conserved hypothetical protein [Escherichia coli W]
 gi|309795087|ref|ZP_07689507.1| metallo-beta-lactamase domain protein [Escherichia coli MS 145-7]
 gi|331651947|ref|ZP_08352966.1| putative Metallo-beta-lactamase [Escherichia coli M718]
 gi|331667305|ref|ZP_08368170.1| putative Metallo-beta-lactamase [Escherichia coli TA271]
 gi|331676715|ref|ZP_08377411.1| putative Metallo-beta-lactamase [Escherichia coli H591]
 gi|332282168|ref|ZP_08394581.1| metal-binding enzyme [Shigella sp. D9]
 gi|24051200|gb|AAN42553.1| orf, conserved hypothetical protein [Shigella flexneri 2a str. 301]
 gi|30040708|gb|AAP16439.1| hypothetical protein S0988 [Shigella flexneri 2a str. 2457T]
 gi|73854962|gb|AAZ87669.1| conserved hypothetical protein [Shigella sonnei Ss046]
 gi|81246080|gb|ABB66788.1| conserved hypothetical protein [Shigella boydii Sb227]
 gi|110614484|gb|ABF03151.1| conserved hypothetical protein [Shigella flexneri 5 str. 8401]
 gi|157066128|gb|ABV05383.1| metallo-beta-lactamase family protein [Escherichia coli HS]
 gi|157078534|gb|ABV18242.1| metallo-beta-lactamase family protein [Escherichia coli E24377A]
 gi|169755599|gb|ACA78298.1| beta-lactamase domain protein [Escherichia coli ATCC 8739]
 gi|190902962|gb|EDV62688.1| metallo-beta-lactamase family protein [Escherichia coli B7A]
 gi|192927705|gb|EDV82320.1| metallo-beta-lactamase family protein [Escherichia coli E22]
 gi|192955942|gb|EDV86410.1| metallo-beta-lactamase family protein [Escherichia coli E110019]
 gi|194413553|gb|EDX29834.1| metallo-beta-lactamase family protein [Escherichia coli B171]
 gi|209911436|dbj|BAG76510.1| conserved hypothetical protein [Escherichia coli SE11]
 gi|218351133|emb|CAU96837.1| putative metal-binding hydrolase [Escherichia coli 55989]
 gi|218360282|emb|CAQ97832.1| putative metal-binding hydrolase [Escherichia coli IAI1]
 gi|257752867|dbj|BAI24369.1| predicted metal-binding enzyme [Escherichia coli O26:H11 str.
           11368]
 gi|257758323|dbj|BAI29820.1| predicted metal-binding enzyme [Escherichia coli O103:H2 str.
           12009]
 gi|257763455|dbj|BAI34950.1| predicted metal-binding enzyme [Escherichia coli O111:H- str.
           11128]
 gi|281600287|gb|ADA73271.1| Beta-lactamase domain protein [Shigella flexneri 2002017]
 gi|291324043|gb|EFE63465.1| ycbL protein [Escherichia coli B088]
 gi|291434265|gb|EFF07238.1| ycbL protein [Escherichia coli B185]
 gi|300405056|gb|EFJ88594.1| metallo-beta-lactamase domain protein [Escherichia coli MS 84-1]
 gi|300412026|gb|EFJ95336.1| metallo-beta-lactamase domain protein [Escherichia coli MS 115-1]
 gi|300418465|gb|EFK01776.1| metallo-beta-lactamase domain protein [Escherichia coli MS 182-1]
 gi|300523867|gb|EFK44936.1| metallo-beta-lactamase domain protein [Escherichia coli MS 119-7]
 gi|300530320|gb|EFK51382.1| metallo-beta-lactamase domain protein [Escherichia coli MS 107-1]
 gi|300842302|gb|EFK70062.1| metallo-beta-lactamase domain protein [Escherichia coli MS 124-1]
 gi|300846686|gb|EFK74446.1| metallo-beta-lactamase domain protein [Escherichia coli MS 78-1]
 gi|306908241|gb|EFN38740.1| conserved hypothetical protein [Escherichia coli W]
 gi|308121391|gb|EFO58653.1| metallo-beta-lactamase domain protein [Escherichia coli MS 145-7]
 gi|313650831|gb|EFS15232.1| metallo-beta-lactamase superfamily protein [Shigella flexneri 2a
           str. 2457T]
 gi|315060212|gb|ADT74539.1| predicted metal-binding enzyme [Escherichia coli W]
 gi|315257968|gb|EFU37936.1| metallo-beta-lactamase domain protein [Escherichia coli MS 85-1]
 gi|320177118|gb|EFW52133.1| hypothetical protein SDB_00381 [Shigella dysenteriae CDC 74-1112]
 gi|320183826|gb|EFW58659.1| hypothetical protein SGF_03998 [Shigella flexneri CDC 796-83]
 gi|320202323|gb|EFW76894.1| hypothetical protein ECoL_00369 [Escherichia coli EC4100B]
 gi|323157186|gb|EFZ43309.1| metallo-beta-lactamase superfamily protein [Escherichia coli
           EPECa14]
 gi|323159554|gb|EFZ45534.1| metallo-beta-lactamase superfamily protein [Escherichia coli
           E128010]
 gi|323165400|gb|EFZ51187.1| metallo-beta-lactamase superfamily protein [Shigella sonnei 53G]
 gi|323175450|gb|EFZ61045.1| metallo-beta-lactamase superfamily protein [Escherichia coli 1180]
 gi|323185367|gb|EFZ70731.1| metallo-beta-lactamase superfamily protein [Escherichia coli 1357]
 gi|323379228|gb|ADX51496.1| hypothetical protein EKO11_2903 [Escherichia coli KO11]
 gi|323947284|gb|EGB43292.1| metallo-beta-lactamase superfamily protein [Escherichia coli H120]
 gi|324019064|gb|EGB88283.1| metallo-beta-lactamase domain protein [Escherichia coli MS 117-3]
 gi|324117208|gb|EGC11116.1| metallo-beta-lactamase superfamily protein [Escherichia coli E1167]
 gi|331050225|gb|EGI22283.1| putative Metallo-beta-lactamase [Escherichia coli M718]
 gi|331065661|gb|EGI37554.1| putative Metallo-beta-lactamase [Escherichia coli TA271]
 gi|331075404|gb|EGI46702.1| putative Metallo-beta-lactamase [Escherichia coli H591]
 gi|332093371|gb|EGI98429.1| metallo-beta-lactamase superfamily protein [Shigella boydii
           3594-74]
 gi|332104520|gb|EGJ07866.1| metal-binding enzyme [Shigella sp. D9]
 gi|332342369|gb|AEE55703.1| putative metal-binding hydrolase YcbL [Escherichia coli UMNK88]
 gi|332759015|gb|EGJ89325.1| metallo-beta-lactamase superfamily protein [Shigella flexneri
           4343-70]
 gi|332760072|gb|EGJ90370.1| metallo-beta-lactamase superfamily protein [Shigella flexneri
           2747-71]
 gi|332762699|gb|EGJ92962.1| metallo-beta-lactamase superfamily protein [Shigella flexneri
           K-671]
 gi|332767714|gb|EGJ97905.1| metallo-beta-lactamase superfamily protein [Shigella flexneri
           2930-71]
 gi|333006240|gb|EGK25749.1| metallo-beta-lactamase superfamily protein [Shigella flexneri
           K-218]
 gi|333020077|gb|EGK39348.1| metallo-beta-lactamase superfamily protein [Shigella flexneri
           K-304]
          Length = 215

 Score =  194 bits (492), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 87/213 (40%), Positives = 137/213 (64%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++ I+ VT F QNC+ ++ E++  A +VDPGGD + IK  +      + QI +THGH+D
Sbjct: 1   MNYRIIPVTAFSQNCSLIWCEQTRLAALVDPGGDAEKIKQEVDDSGLTLMQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L +   + + GP K+D   +  +  Q+R+  +    +  + DRWL +GDT+ +
Sbjct: 61  HVGAAAELAQHYGVPVFGPEKEDEFWLQGLPAQSRMFGLEEC-QPLTPDRWLNEGDTISI 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGHV++ +        GD +F+  +GR+D   GD+ QLI+SI +K+
Sbjct: 120 GNVTLQVLHCPGHTPGHVVFFDDRAKLLISGDVIFKGGVGRSDFPRGDHNQLISSIKDKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           LPLGD+++F+ GHGP ST+G ER  NPFL+  +
Sbjct: 180 LPLGDDVTFIPGHGPLSTLGYERLHNPFLQDEM 212


>gi|283833782|ref|ZP_06353523.1| metallo-beta-lactamase family protein [Citrobacter youngae ATCC
           29220]
 gi|291070447|gb|EFE08556.1| metallo-beta-lactamase family protein [Citrobacter youngae ATCC
           29220]
          Length = 215

 Score =  194 bits (492), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 87/213 (40%), Positives = 139/213 (65%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++ I+ VT F QNC+ ++ E++  A +VDPGGD + IK  +++    + QI +THGH+D
Sbjct: 1   MNYRIIPVTAFAQNCSLIWCEQTRLAALVDPGGDAEKIKQEVEASGLTLMQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L +   + +IGP K+D   +  +  Q+R+  +       + DRWL DGD + +
Sbjct: 61  HVGAAAELAQHYGVPVIGPEKEDEFWLQGLPAQSRMFGLGDC-EPLTPDRWLNDGDRVSV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGHV++ + ++     GD +F+  +GR+D   GD+ QLI++I  K+
Sbjct: 120 GNVSLQVLHCPGHTPGHVVFFDEQSKLLISGDVIFKGGVGRSDFPRGDHSQLIDAIKRKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           LPLGD+++F+ GHGP ST+G ER  NPFL+  +
Sbjct: 180 LPLGDDVTFIPGHGPLSTLGNERLHNPFLQDEM 212


>gi|238920324|ref|YP_002933839.1| hypothetical protein NT01EI_2434 [Edwardsiella ictaluri 93-146]
 gi|238869893|gb|ACR69604.1| conserved hypothetical protein [Edwardsiella ictaluri 93-146]
          Length = 215

 Score =  194 bits (492), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 96/213 (45%), Positives = 138/213 (64%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + +HI+ VT F+QNCT L+ E + EA +VDPGG+   I   I +R+  V QI +THGH+D
Sbjct: 1   MKYHIIPVTAFQQNCTLLWCETTREAAIVDPGGESAKILREIGARDLKVTQILLTHGHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L + LS+ I GP ++D   + ++ +QA +       +     RWLQ GDTL +
Sbjct: 61  HVGAAARLAQTLSVPIYGPQQEDKYWLDQLPQQADMFGFTDC-QPFMPTRWLQQGDTLAV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGH+PGHV+Y       A +GD LFR SIGR+D   G+++ L+NSI  ++
Sbjct: 120 GEEQLTVLHCPGHTPGHVVYFCERARLAQVGDVLFRGSIGRSDFAGGNHRDLLNSIWTRL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
             LGD+++F+ GHGP STIG ERR NP+++  +
Sbjct: 180 FTLGDDVAFIPGHGPMSTIGEERRSNPYVRDEL 212


>gi|269139500|ref|YP_003296201.1| metallo-beta-lactamase superfamily protein [Edwardsiella tarda
           EIB202]
 gi|267985161|gb|ACY84990.1| metallo-beta-lactamase superfamily protein [Edwardsiella tarda
           EIB202]
 gi|304559389|gb|ADM42053.1| Hypothetical metal-binding enzyme [Edwardsiella tarda FL6-60]
          Length = 215

 Score =  193 bits (491), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 96/211 (45%), Positives = 138/211 (65%), Gaps = 1/211 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + +HI+ VT F+QNCT L+ E + EA +VDPGG+   I   I +R+  V QI +THGH+D
Sbjct: 1   MKYHIIPVTAFQQNCTLLWCEATREAAIVDPGGESAKILREIGARDLKVTQILLTHGHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L + LS+ I GP ++D   + ++ +QA +       +     RWLQ GDTL +
Sbjct: 61  HVGAAARLAQTLSVPIYGPQQEDQYWLDQLSQQADMFGFTDC-QPFMPTRWLQQGDTLAV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGH+PGHV+Y   +   A +GD LFR SIGR+D   G+++ L+NSI  ++
Sbjct: 120 GEEQLTVLHCPGHTPGHVVYFCEKARLAQVGDVLFRGSIGRSDFAGGNHRDLLNSIWTRL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
             LGD+++F+ GHGP STIG ERR NP+++ 
Sbjct: 180 FTLGDDVAFIPGHGPMSTIGEERRSNPYVRD 210


>gi|323174972|gb|EFZ60587.1| metallo-beta-lactamase superfamily protein [Escherichia coli LT-68]
          Length = 215

 Score =  193 bits (491), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 87/213 (40%), Positives = 137/213 (64%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++ I+ VT F QNC+ ++ E++  A +VDPGGD + IK  +      + QI +THGH+D
Sbjct: 1   MNYRIIPVTAFSQNCSLIWCEQTRLAALVDPGGDAEKIKQEVDDSGLTLMQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L +   + + GP K+D   +  +  Q+R+  +    +  + DRWL +GDT+ +
Sbjct: 61  HVGAAAELAQHYGVPVFGPEKEDEFWLQGLPAQSRMFDLEEC-QPLTPDRWLNEGDTISI 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGHV++ +        GD +F+  +GR+D   GD+ QLI+SI +K+
Sbjct: 120 GNVTLQVLHCPGHTPGHVVFFDDRAKLLISGDVIFKGGVGRSDFPRGDHNQLISSIKDKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           LPLGD+++F+ GHGP ST+G ER  NPFL+  +
Sbjct: 180 LPLGDDVTFIPGHGPLSTLGYERLHNPFLQDEM 212


>gi|333001239|gb|EGK20807.1| metallo-beta-lactamase superfamily protein [Shigella flexneri VA-6]
          Length = 215

 Score =  193 bits (491), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 87/213 (40%), Positives = 138/213 (64%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++ I+ VT F QNC+ ++ E++  A +VDPGGD + IK  +      + QI +THGH+D
Sbjct: 1   MNYRIIPVTAFSQNCSLIWCEQTRLAALVDPGGDAEKIKQEVDDSGLTLMQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L +   + + GP K+D   +  +  Q+R+  +    ++ + DRWL +GDT+ +
Sbjct: 61  HVGAAAELAQHYGVPVFGPEKEDEFWLQGLPAQSRMFGLEEC-QSLTPDRWLNEGDTISI 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGHV++ +        GD +F+  +GR+D   GD+ QLI+SI +K+
Sbjct: 120 GNVTLQVLHCPGHTPGHVVFFDDRAKLLISGDVIFKGGVGRSDFPRGDHNQLISSIKDKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           LPLGD+++F+ GHGP ST+G ER  NPFL+  +
Sbjct: 180 LPLGDDVTFIPGHGPLSTLGYERLHNPFLQDEM 212


>gi|146311103|ref|YP_001176177.1| beta-lactamase domain-containing protein [Enterobacter sp. 638]
 gi|145317979|gb|ABP60126.1| beta-lactamase domain protein [Enterobacter sp. 638]
          Length = 215

 Score =  193 bits (491), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 86/213 (40%), Positives = 139/213 (65%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++ I+ VT F QNC+ ++ E++  A +VDPGGD + IK  + +    +KQI +THGH+D
Sbjct: 1   MNYRIIPVTAFSQNCSLIWCEQTKLAALVDPGGDAEKIKQEVAASGVTLKQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L +   + +IGP K+D   +  +  Q+R+  +       + DRWL +G+++ +
Sbjct: 61  HVGAAAELAQHYGVPVIGPEKEDEFWLQGLAAQSRMFGLDECL-PLTPDRWLNEGESVNV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    ++ HCPGH+PGH+++ + ++     GD +F+  +GR+D   GD+ QLI SI  K+
Sbjct: 120 GNVTLQILHCPGHTPGHIVFFDDQSRLLISGDVIFKGGVGRSDFPRGDHGQLIQSIKQKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           LPLGD+++F+ GHGP ST+G ER  NPFL+  I
Sbjct: 180 LPLGDDVTFIAGHGPMSTLGYERLHNPFLQDEI 212


>gi|295096373|emb|CBK85463.1| Zn-dependent hydrolases, including glyoxylases [Enterobacter
           cloacae subsp. cloacae NCTC 9394]
          Length = 215

 Score =  193 bits (491), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 88/213 (41%), Positives = 137/213 (64%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++ I+ VT F QNC+ ++ E++  A +VDPGGD + IK  + +    + QI +THGH+D
Sbjct: 1   MNYRIIPVTAFSQNCSLIWCEQTKLAALVDPGGDAETIKQEVAASGVTLMQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L E   + IIGP K+D   +  +  Q+R+  +    +  + DRWL +GD + +
Sbjct: 61  HVGAAAELAEHYGVPIIGPEKEDEFWLQGLPAQSRMFGLDEC-QPLTPDRWLNEGDRVNV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGH+++ +  +     GD +F+  +GR+D   GD+ QLI SI  K+
Sbjct: 120 GNVTLQVLHCPGHTPGHIVFFDDVSRLLISGDVIFKGGVGRSDFPRGDHGQLIQSIKQKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           LPLGD+++F+ GHGP ST+G ER  NPFL+  +
Sbjct: 180 LPLGDDVTFIPGHGPMSTLGDERLHNPFLQDEM 212


>gi|238789298|ref|ZP_04633085.1| hypothetical protein yfred0001_41070 [Yersinia frederiksenii ATCC
           33641]
 gi|238722630|gb|EEQ14283.1| hypothetical protein yfred0001_41070 [Yersinia frederiksenii ATCC
           33641]
          Length = 229

 Score =  193 bits (491), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 87/211 (41%), Positives = 137/211 (64%), Gaps = 1/211 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + I+ VT F QNCT ++ E + +A +VDPGG+   I   +  +   V QI +THGH+D
Sbjct: 15  MKYQIIPVTAFSQNCTLIWCEATGQAALVDPGGEAAKIIAEVARQGVKVSQILLTHGHLD 74

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L     + I GP K+DA  +  +  Q+++  +       +  RWL++GD + +
Sbjct: 75  HVGAAAELAAHFQVPIYGPEKEDAFWLEGLPAQSKMFGLSEC-EAFTPTRWLEEGDKVTV 133

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGH+PGH+++++ +++ A +GD +F   +GR+D   GD+QQLINSI  K+
Sbjct: 134 GEVELAVLHCPGHTPGHIVFIDQQDHLALVGDVIFNGGVGRSDFPRGDHQQLINSIRTKL 193

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           LPLGD+++F+ GHGP ST+G ER+ NPF++ 
Sbjct: 194 LPLGDDMTFIPGHGPMSTLGHERQTNPFIRE 224


>gi|307728226|ref|YP_003905450.1| beta-lactamase domain-containing protein [Burkholderia sp.
           CCGE1003]
 gi|307582761|gb|ADN56159.1| beta-lactamase domain protein [Burkholderia sp. CCGE1003]
          Length = 214

 Score =  193 bits (491), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 90/213 (42%), Positives = 131/213 (61%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +   ++ VTPF+QNC+ L  E +  A VVDPGGDL++I+  I  +   V+++++THGH+D
Sbjct: 1   MKVTLIPVTPFQQNCSLLVCEATGRAAVVDPGGDLEVIQGEIARQKVSVEKVFLTHGHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H  GA  L     + I GPH D+   + K+ +Q+        A     DRWL  GDT+  
Sbjct: 61  HCAGAKTLALHYGVPIEGPHADERFWLDKLPDQSTRFGFPA-AEAFEPDRWLDTGDTVQF 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V+HCPGH+PGHV++ +  +  A +GD LF  SIGRTD   G++  L+ SI  K+
Sbjct: 120 GEETLEVYHCPGHTPGHVVFFSRAHRLALVGDVLFAGSIGRTDFPRGNHADLVRSIREKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            PLGD+++FV GHGP ST G ERR NP++   +
Sbjct: 180 WPLGDDVTFVPGHGPTSTFGAERRSNPYVGDGV 212


>gi|194291110|ref|YP_002007017.1| enzyme with metallo-hydrolase/oxidoreductase domain [Cupriavidus
           taiwanensis LMG 19424]
 gi|193224945|emb|CAQ70956.1| putative enzyme with metallo-hydrolase/oxidoreductase domain
           [Cupriavidus taiwanensis LMG 19424]
          Length = 216

 Score =  193 bits (490), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 93/213 (43%), Positives = 138/213 (64%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +   ++ VTPF+QNC+ L DE +  A V DPGGDLD I+  ++ +   +++I++THGHVD
Sbjct: 1   MKALLIPVTPFQQNCSLLIDESTGAAAVCDPGGDLDRIRAAVKEQGVTLEKIFLTHGHVD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H  GAA L  +L + I GP +D+   + ++ EQ R       A +   DRWL++GDT+  
Sbjct: 61  HCAGAAALSRELGIPIEGPQQDERFWIEQLPEQTRRFGFGH-AESFEPDRWLENGDTVQF 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V+HCPGH+PGHV++ +  N  A +GD LF  SIGRTD   G++  LI SI  ++
Sbjct: 120 GNETLEVYHCPGHTPGHVVFFSRPNRLAVVGDVLFAGSIGRTDFPRGNHADLIRSIRTRL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            PLG++++F+ GHGP ST G ERR NPF+  ++
Sbjct: 180 WPLGEDVTFIPGHGPVSTFGEERRTNPFVADHL 212


>gi|163761577|ref|ZP_02168648.1| putative beta-lactamase family protein [Hoeflea phototrophica
           DFL-43]
 gi|162281173|gb|EDQ31473.1| putative beta-lactamase family protein [Hoeflea phototrophica
           DFL-43]
          Length = 215

 Score =  193 bits (490), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 119/214 (55%), Positives = 152/214 (71%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M  L   I+ VTPF+QNCT LFDE++   VV+DPGGD+D+I   I      ++ IW+THG
Sbjct: 1   MGNLRAGIIPVTPFQQNCTVLFDEDTKSGVVIDPGGDVDVILQTISENGLTIEAIWLTHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DH GGA +L E L + IIGPHKDD  ++  +++QAR+  + M  RN + D+WL+DG+ 
Sbjct: 61  HIDHAGGADELCETLGVKIIGPHKDDVPLLSGLEDQARMFGLDMEVRNVTPDQWLEDGEK 120

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           +  G H F+V+H PGH+PGHVIY N    FAHLGD LF  SIGRTD+  GD+Q LINSI 
Sbjct: 121 VSFGAHEFEVYHTPGHAPGHVIYFNRAQGFAHLGDVLFAGSIGRTDLPGGDHQTLINSIR 180

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           +K+LPLGDEI F+CGHGP   IG ERR NPFLK 
Sbjct: 181 DKVLPLGDEIGFICGHGPGGKIGDERRTNPFLKD 214


>gi|304397087|ref|ZP_07378966.1| conserved hypothetical protein [Pantoea sp. aB]
 gi|304355236|gb|EFM19604.1| conserved hypothetical protein [Pantoea sp. aB]
          Length = 209

 Score =  193 bits (490), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 91/210 (43%), Positives = 138/210 (65%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++HI+ VT F QNC+ ++ + + EA +VDPGGD +++K  ++       QI +THGH+D
Sbjct: 1   MNYHIIPVTAFAQNCSVIWCDSTREAALVDPGGDAELVKQTLEQLGLKPAQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG A +L     + IIGP K DA  +  +  Q+R+  +   A   + DRWL++G+++ +
Sbjct: 61  HVGAAVELAAFWQIPIIGPQKRDAFWLEALPTQSRMFGLDECA-PFTPDRWLEEGESVQV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGHSPGHV++ + +      GD +F   +GRTD   GD+QQLIN+I  K+
Sbjct: 120 GLITLEVLHCPGHSPGHVVFFDRQGRLLISGDVIFNGGVGRTDFPQGDHQQLINAIRTKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           LPLGD+++F+ GHGP ST+G ER  NPFL+
Sbjct: 180 LPLGDDVTFLPGHGPISTLGHERVSNPFLQ 209


>gi|312797501|ref|YP_004030423.1| Hydroxyacylglutathione hydrolase [Burkholderia rhizoxinica HKI 454]
 gi|312169276|emb|CBW76279.1| Hydroxyacylglutathione hydrolase (EC 3.1.2.6) [Burkholderia
           rhizoxinica HKI 454]
          Length = 234

 Score =  193 bits (490), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 93/215 (43%), Positives = 135/215 (62%), Gaps = 1/215 (0%)

Query: 2   SKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGH 61
           + +   ++ VT F QNC+ L  E++  A +VDPGGDL++I+  +Q R   V+++ +THGH
Sbjct: 18  NPMQVKLIPVTAFMQNCSLLVCEQTQRAAIVDPGGDLELIQAQVQKRGASVEKVLLTHGH 77

Query: 62  VDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
           VDH  GA  L     + I GPH D+   +  + +Q+    +   A+    DRWL DGDT+
Sbjct: 78  VDHCAGARALANHYGVPIEGPHPDEQFWLALLPQQSTRFGLPA-AQAFEPDRWLHDGDTV 136

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
             G  I +V HCPGH+PGHV++ + E+  A +GD LF  SIGRTD   G++  LI+SI  
Sbjct: 137 RFGNEILEVLHCPGHTPGHVVFFSREHRLALVGDVLFAGSIGRTDFPRGNHADLISSIRK 196

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           K+ PLGD++ FV GHGP ST G ERR NP++  ++
Sbjct: 197 KLWPLGDDVRFVPGHGPMSTFGEERRTNPYVADHV 231


>gi|89094954|ref|ZP_01167885.1| putative metallo-beta-lactamase family protein [Oceanospirillum sp.
           MED92]
 gi|89080820|gb|EAR60061.1| putative metallo-beta-lactamase family protein [Oceanospirillum sp.
           MED92]
          Length = 209

 Score =  193 bits (490), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 93/210 (44%), Positives = 139/210 (66%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + I+ VTPF+QNC+ ++ E++ +A VVDPGGDLD +   +      +++I +TH H+D
Sbjct: 1   MKYRIIPVTPFQQNCSLIWCEKTNKAAVVDPGGDLDKVLAAVAEEGVELEKILLTHAHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GG A+L    SL I GPHK D   +  +++Q  + +        + DRWL+DGD +L+
Sbjct: 61  HAGGTAELSSGHSLPIEGPHKGDQFWIDGIEQQCAMFNFPPC-EGFTPDRWLEDGDEVLV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    KV H PGH+PGHV++ N E+  A +GD LF  SIGRTD   G++Q+LI+SI NK+
Sbjct: 120 GEISLKVIHSPGHTPGHVVFFNPEDQVALVGDVLFNGSIGRTDFPQGNHQELISSIKNKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
            PLG+++ F+ GHGP ST G+E + NPF++
Sbjct: 180 FPLGEDVEFIPGHGPGSTFGQEMQSNPFVR 209


>gi|187730154|ref|YP_001880872.1| metallo-beta-lactamase family protein [Shigella boydii CDC 3083-94]
 gi|187427146|gb|ACD06420.1| metallo-beta-lactamase family protein [Shigella boydii CDC 3083-94]
          Length = 215

 Score =  193 bits (490), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 87/213 (40%), Positives = 137/213 (64%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++ I+ VT F QNC+ ++ E++  A +VDPGGD + IK  +      + QI +THGH+D
Sbjct: 1   MNYRIIPVTAFSQNCSLIWCEQTRLAALVDPGGDAEKIKQEVDDSGLTLMQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L +   + + GP K+D   +  +  Q+R+  +    +  + DRWL +GDT+ +
Sbjct: 61  HVGAAAELAQHYGVPVFGPEKEDEFWLQGLPVQSRMFGLEEC-QPLTPDRWLNEGDTISI 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGHV++ +        GD +F+  +GR+D   GD+ QLI+SI +K+
Sbjct: 120 GNVTLQVLHCPGHTPGHVVFFDDRAKLLISGDVIFKGGVGRSDFPRGDHNQLISSIKDKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           LPLGD+++F+ GHGP ST+G ER  NPFL+  +
Sbjct: 180 LPLGDDVTFIPGHGPLSTLGYERLHNPFLQDEM 212


>gi|215486052|ref|YP_002328483.1| predicted metal-binding enzyme [Escherichia coli O127:H6 str.
           E2348/69]
 gi|312969007|ref|ZP_07783214.1| metallo-beta-lactamase superfamily protein [Escherichia coli
           2362-75]
 gi|215264124|emb|CAS08468.1| predicted metal-binding enzyme [Escherichia coli O127:H6 str.
           E2348/69]
 gi|312286409|gb|EFR14322.1| metallo-beta-lactamase superfamily protein [Escherichia coli
           2362-75]
          Length = 215

 Score =  192 bits (489), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 87/213 (40%), Positives = 137/213 (64%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++ I+ VT F QNC+ ++ E++  A +VDPGGD + IK  + +    + QI +THGH+D
Sbjct: 1   MNYRIIPVTAFSQNCSLIWCEQTRLAALVDPGGDAEKIKQEVDASGLTLMQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L +   + + GP K+D   +  +  Q+R+  +    +  + DRWL +GDT+ +
Sbjct: 61  HVGAAAELAQHYGVPVFGPEKEDEFWLQGLPAQSRMFGLEEC-QPLTPDRWLNEGDTISI 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGHV++ +        GD +F+  +GR+D   GD+ QLI SI +K+
Sbjct: 120 GNVTLQVLHCPGHTPGHVVFFDDRAKLLISGDVIFKGGVGRSDFPRGDHNQLIYSIKDKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           LPLGD+++F+ GHGP ST+G ER  NPFL+  +
Sbjct: 180 LPLGDDVTFIPGHGPLSTLGYERLHNPFLQDEM 212


>gi|301598408|pdb|2XF4|A Chain A, Crystal Structure Of Salmonella Enterica Serovar
           Typhimurium Ycbl
          Length = 210

 Score =  192 bits (489), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 86/211 (40%), Positives = 138/211 (65%), Gaps = 1/211 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++ I+ VT F QNC+ ++ E++  A +VDPGGD + IK  + +    + QI +THGH+D
Sbjct: 1   MNYRIIPVTAFSQNCSLIWCEQTRLAALVDPGGDAEKIKQEVDASGVTLMQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG A++L +   + +IGP K+D   +  +  Q+R+  +    +  + DRWL DGD + +
Sbjct: 61  HVGAASELAQHYGVPVIGPEKEDEFWLQGLPAQSRMFGLDEC-QPLTPDRWLNDGDRVSV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGHV++ + ++     GD +F+  +GR+D   GD+ QLI++I  K+
Sbjct: 120 GNVTLQVLHCPGHTPGHVVFFDEQSQLLISGDVIFKGGVGRSDFPRGDHTQLIDAIKRKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           LPLGD+++F+ GHGP ST+G ER  NPFL+ 
Sbjct: 180 LPLGDDVTFIPGHGPLSTLGYERLHNPFLQD 210


>gi|317491482|ref|ZP_07949918.1| metallo-beta-lactamase superfamily protein [Enterobacteriaceae
           bacterium 9_2_54FAA]
 gi|316921029|gb|EFV42352.1| metallo-beta-lactamase superfamily protein [Enterobacteriaceae
           bacterium 9_2_54FAA]
          Length = 215

 Score =  192 bits (489), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 94/209 (44%), Positives = 137/209 (65%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + I+ VT F+QNCT L+ E++ +A +VDPGG+   I   +++    V QI +THGH+D
Sbjct: 1   MKYKIIPVTAFQQNCTLLWCEDTHQAAIVDPGGEPAKILREVEALGLTVTQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG A QL + L++ I GP +DD   +  +  Q+++          +  RWL DGDTL +
Sbjct: 61  HVGAAGQLAKSLNVPIYGPQEDDLFWLEGLPAQSKMFGFTNC-DPLTPTRWLNDGDTLQV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +VFHCPGH+PGHVI+ N E+  A +GD LF   +GR+D   GD+Q LINSI  K+
Sbjct: 120 GNQTLQVFHCPGHTPGHVIFFNEESRLAQVGDVLFSGGVGRSDFPRGDHQALINSIKTKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
            PLG++++F+ GHGP ST G+ER+ NPF+
Sbjct: 180 WPLGNDVAFIPGHGPMSTFGQERQTNPFV 208


>gi|168822070|ref|ZP_02834070.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|205341513|gb|EDZ28277.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|320085240|emb|CBY95025.1| Hydroxyacylglutathione hydrolase Glyoxalase II; Glx II [Salmonella
           enterica subsp. enterica serovar Weltevreden str.
           2007-60-3289-1]
          Length = 215

 Score =  192 bits (488), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 86/213 (40%), Positives = 139/213 (65%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++ I+ VT F QNC+ ++ E++  A +VDPGGD + IK  + +    + QI +THGH+D
Sbjct: 1   MNYRIIPVTAFSQNCSLIWCEQTRLAALVDPGGDAEKIKQEVDASGVTLMQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG A++L +   + +IGP K+D   +  +  Q+R+  +    +  + DRWL DGD + +
Sbjct: 61  HVGAASELAQYYGVPVIGPEKEDEFWLQGLPAQSRMFGLDEC-QPLTPDRWLNDGDRVSV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGHV++ + ++     GD +F+  +GR+D   GD+ QLI++I  K+
Sbjct: 120 GNVTLQVLHCPGHTPGHVVFFDEQSQLLISGDVIFKGGVGRSDFPRGDHTQLIDAIKRKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           LPLGD+++F+ GHGP ST+G ER  NPFL+  +
Sbjct: 180 LPLGDDVTFIPGHGPLSTLGYERLHNPFLQDEM 212


>gi|16764357|ref|NP_459972.1| metallo-beta-lactamase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|62179524|ref|YP_215941.1| hypothetical protein SC0954 [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|161614764|ref|YP_001588729.1| hypothetical protein SPAB_02516 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|167553001|ref|ZP_02346751.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
 gi|167994948|ref|ZP_02576038.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|168233418|ref|ZP_02658476.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|168237102|ref|ZP_02662160.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|168243766|ref|ZP_02668698.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|168264665|ref|ZP_02686638.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
 gi|168466592|ref|ZP_02700454.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|194446110|ref|YP_002040195.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194450083|ref|YP_002044989.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|194471636|ref|ZP_03077620.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|194737484|ref|YP_002114050.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|197247583|ref|YP_002145915.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|197261729|ref|ZP_03161803.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|198246004|ref|YP_002214921.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|200391125|ref|ZP_03217736.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|204929977|ref|ZP_03220998.1| metallo-beta-lactamase family protein [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
 gi|205352204|ref|YP_002226005.1| hypothetical protein SG0939 [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|207856388|ref|YP_002243039.1| hypothetical protein SEN0901 [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|224582807|ref|YP_002636605.1| hypothetical protein SPC_0998 [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|16419510|gb|AAL19931.1| putative metallo-beta-lactamase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|62127157|gb|AAX64860.1| putative Metallo-beta-lactamase [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|161364128|gb|ABX67896.1| hypothetical protein SPAB_02516 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194404773|gb|ACF64995.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194408387|gb|ACF68606.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|194458000|gb|EDX46839.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|194712986|gb|ACF92207.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|195630915|gb|EDX49501.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|197211286|gb|ACH48683.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|197239984|gb|EDY22604.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|197289784|gb|EDY29145.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|197940520|gb|ACH77853.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|199603570|gb|EDZ02116.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|204320971|gb|EDZ06172.1| metallo-beta-lactamase family protein [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
 gi|205271985|emb|CAR36829.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|205322462|gb|EDZ10301.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
 gi|205327282|gb|EDZ14046.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|205332464|gb|EDZ19228.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|205337128|gb|EDZ23892.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|205346901|gb|EDZ33532.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
 gi|206708191|emb|CAR32484.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|224467334|gb|ACN45164.1| hypothetical protein SPC_0998 [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|261246213|emb|CBG24017.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. D23580]
 gi|267992736|gb|ACY87621.1| putative metallo-beta-lactamase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 14028S]
 gi|301157540|emb|CBW17030.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. SL1344]
 gi|312911983|dbj|BAJ35957.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. T000240]
 gi|321223321|gb|EFX48390.1| Hypothetical metal-binding enzyme [Salmonella enterica subsp.
           enterica serovar Typhimurium str. TN061786]
 gi|322616427|gb|EFY13336.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315996572]
 gi|322619677|gb|EFY16552.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-1]
 gi|322622627|gb|EFY19472.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-3]
 gi|322629776|gb|EFY26551.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-4]
 gi|322632502|gb|EFY29248.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-1]
 gi|322637003|gb|EFY33706.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-2]
 gi|322641458|gb|EFY38096.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 531954]
 gi|322646076|gb|EFY42592.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. NC_MB110209-0054]
 gi|322649622|gb|EFY46053.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. OH_2009072675]
 gi|322654077|gb|EFY50400.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. CASC_09SCPH15965]
 gi|322658609|gb|EFY54871.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 19N]
 gi|322663466|gb|EFY59668.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 81038-01]
 gi|322670202|gb|EFY66342.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MD_MDA09249507]
 gi|322671438|gb|EFY67560.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 414877]
 gi|322676794|gb|EFY72861.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 366867]
 gi|322682718|gb|EFY78737.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 413180]
 gi|322686398|gb|EFY82380.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 446600]
 gi|322713992|gb|EFZ05563.1| putative metallo-beta-lactamase [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. A50]
 gi|323129262|gb|ADX16692.1| putative metallo-beta-lactamase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 4/74]
 gi|323195921|gb|EFZ81088.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609458-1]
 gi|323199791|gb|EFZ84880.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556150-1]
 gi|323202784|gb|EFZ87820.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609460]
 gi|323209055|gb|EFZ93992.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 507440-20]
 gi|323209976|gb|EFZ94883.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556152]
 gi|323217985|gb|EGA02700.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB101509-0077]
 gi|323219021|gb|EGA03528.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB102109-0047]
 gi|323226590|gb|EGA10795.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB110209-0055]
 gi|323229786|gb|EGA13909.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB111609-0052]
 gi|323233011|gb|EGA17107.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009083312]
 gi|323240746|gb|EGA24788.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009085258]
 gi|323243062|gb|EGA27083.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315731156]
 gi|323249775|gb|EGA33677.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2009159199]
 gi|323252752|gb|EGA36590.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008282]
 gi|323259166|gb|EGA42810.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008283]
 gi|323259989|gb|EGA43617.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008284]
 gi|323268010|gb|EGA51489.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008285]
 gi|323269858|gb|EGA53307.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008287]
 gi|326622674|gb|EGE29019.1| putative metallo-beta-lactamase [Salmonella enterica subsp.
           enterica serovar Dublin str. 3246]
 gi|326627248|gb|EGE33591.1| putative metallo-beta-lactamase [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 9]
 gi|332987888|gb|AEF06871.1| putative metallo-beta-lactamase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. UK-1]
          Length = 215

 Score =  192 bits (488), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 86/213 (40%), Positives = 139/213 (65%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++ I+ VT F QNC+ ++ E++  A +VDPGGD + IK  + +    + QI +THGH+D
Sbjct: 1   MNYRIIPVTAFSQNCSLIWCEQTRLAALVDPGGDAEKIKQEVDASGVTLMQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG A++L +   + +IGP K+D   +  +  Q+R+  +    +  + DRWL DGD + +
Sbjct: 61  HVGAASELAQHYGVPVIGPEKEDEFWLQGLPAQSRMFGLDEC-QPLTPDRWLNDGDRVSV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGHV++ + ++     GD +F+  +GR+D   GD+ QLI++I  K+
Sbjct: 120 GNVTLQVLHCPGHTPGHVVFFDEQSQLLISGDVIFKGGVGRSDFPRGDHTQLIDAIKRKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           LPLGD+++F+ GHGP ST+G ER  NPFL+  +
Sbjct: 180 LPLGDDVTFIPGHGPLSTLGYERLHNPFLQDEM 212


>gi|308186273|ref|YP_003930404.1| Zn-dependent hydrolase [Pantoea vagans C9-1]
 gi|308056783|gb|ADO08955.1| Putative Zn-dependent hydrolase [Pantoea vagans C9-1]
          Length = 209

 Score =  192 bits (488), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 90/210 (42%), Positives = 136/210 (64%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++HI+ VT F QNC+ ++ + + EA +VDPGGD ++IK  ++       QI +THGH+D
Sbjct: 1   MNYHIIPVTAFAQNCSVIWCDTTREAALVDPGGDAELIKQTLEQLKLKPAQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG A +L     + I+GP K DA  +  +  Q+R+  +   A   + DRWL++G+++ +
Sbjct: 61  HVGAAVELAAFYQIPIVGPQKRDAFWLEALPTQSRMFGLDECA-PFTPDRWLEEGESVQV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGHSPGHV++ +        GD +F   +GRTD   GD+QQLI++I  K+
Sbjct: 120 GLTTLDVLHCPGHSPGHVVFFDRPGRLLISGDVIFNGGVGRTDFPQGDHQQLIDAIRTKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           LPLGD+++F+ GHGP ST+G ER  NPFL+
Sbjct: 180 LPLGDDVTFLPGHGPISTLGHERISNPFLQ 209


>gi|292487845|ref|YP_003530720.1| hypothetical protein EAMY_1362 [Erwinia amylovora CFBP1430]
 gi|292899072|ref|YP_003538441.1| metallo-beta-lactamase superfamily protein [Erwinia amylovora ATCC
           49946]
 gi|291198920|emb|CBJ46030.1| metallo-beta-lactamase superfamily protein [Erwinia amylovora ATCC
           49946]
 gi|291553267|emb|CBA20312.1| Uncharacterized protein M6_Spy0554 [Erwinia amylovora CFBP1430]
          Length = 209

 Score =  192 bits (488), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 94/210 (44%), Positives = 138/210 (65%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++HI+ VT F QNC+ ++  E+ EA +VDPGGD   IK  I +    VKQI +THGH+D
Sbjct: 1   MNYHIIPVTAFAQNCSVIWCPETGEAALVDPGGDAQKIKHEIAALGLTVKQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L E   + I+GPHK D   +  + +Q+++      A   + DRWLQ+G+ +L+
Sbjct: 61  HVGAAAELAEHYDVPIVGPHKADKFWLDGLPQQSQMFGFDECA-PLTPDRWLQEGEVVLV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G  + +V  CPGH+PGH+++   +      GD +F   +GR+D   G +Q LI SI NK+
Sbjct: 120 GNTVLEVLLCPGHTPGHIVFFERKARLLVSGDVIFSGGVGRSDFPQGSHQDLIASILNKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           LPLGD+++F+ GHGP ST+GRER  NPFL+
Sbjct: 180 LPLGDDVTFIAGHGPMSTLGRERISNPFLQ 209


>gi|186474890|ref|YP_001856360.1| beta-lactamase domain-containing protein [Burkholderia phymatum
           STM815]
 gi|184191349|gb|ACC69314.1| beta-lactamase domain protein [Burkholderia phymatum STM815]
          Length = 214

 Score =  192 bits (487), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 92/213 (43%), Positives = 132/213 (61%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +   ++ VTPF+QN + L  E++  A +VDPGGDLDIIK  ++ +   V+++ +THGH+D
Sbjct: 1   MKVTLIPVTPFQQNSSLLVCEKTGRAAIVDPGGDLDIIKGEVERQKASVEKVLLTHGHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H  GA  L E   + I GPH D+   + ++ +Q  L      A      RWL+D DT+  
Sbjct: 61  HCAGAKTLAEHYGVPIEGPHIDERFWIDQLPQQ-SLRFGFPAAEAFEPTRWLKDKDTVTF 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V+HCPGH+PGHVI+ +  +  A +GD LF  SIGRTD   G++  LI SI  K+
Sbjct: 120 GDETLEVYHCPGHTPGHVIFFSRAHRLALVGDVLFAGSIGRTDFPRGNHGDLIRSIREKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            PLGD+++FV GHGP ST G ERR NP++   +
Sbjct: 180 WPLGDDVTFVPGHGPTSTFGDERRTNPYVADGV 212


>gi|218548443|ref|YP_002382234.1| metal-binding hydrolase [Escherichia fergusonii ATCC 35469]
 gi|218355984|emb|CAQ88600.1| putative metal-binding hydrolase [Escherichia fergusonii ATCC
           35469]
          Length = 215

 Score =  192 bits (487), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 87/213 (40%), Positives = 139/213 (65%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++ I+ VT F QNC+ ++ E++  A +VDPGGD + IK  + +    + QI +THGH+D
Sbjct: 1   MNYRIIPVTAFSQNCSLIWCEQTRLAALVDPGGDAEKIKQEVDASGLTLMQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L +   + ++GP K+D   +  +  Q+R+  +    +  + DRWL DGDT+ +
Sbjct: 61  HVGAAAELAQHYGVPVLGPEKEDEFWLQGLPAQSRMFGLDEC-QPLTPDRWLNDGDTISI 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGHV++ + +      GD +F+  +GR+D   GD+ QLI +I +K+
Sbjct: 120 GNVTLQVLHCPGHTPGHVVFFDDQAKLLISGDVIFKGGVGRSDFPRGDHNQLIAAIKDKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           LPLGD+++F+ GHGP ST+G ER  NPFL+  +
Sbjct: 180 LPLGDDVTFIPGHGPLSTLGYERLHNPFLQDEM 212


>gi|311280159|ref|YP_003942390.1| beta-lactamase-like protein [Enterobacter cloacae SCF1]
 gi|308749354|gb|ADO49106.1| beta-lactamase-like protein [Enterobacter cloacae SCF1]
          Length = 215

 Score =  192 bits (487), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 85/213 (39%), Positives = 138/213 (64%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++ I+ VT F QNC+ ++ E++  A +VDPGGD + IK  + +    + QI +THGH+D
Sbjct: 1   MNYRIIPVTAFAQNCSLIWCEQTKLAALVDPGGDAEHIKQEVAAAGVTLMQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L +   + +IGP K+D   +  +  Q+R+  +       + DRWL +GDT+ +
Sbjct: 61  HVGAAAELAQHYGVPVIGPEKEDEFWLQGLPAQSRMFGLEDC-PPLTPDRWLNEGDTVSV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGHV++ +  +     GD +F+  +GR+D   G++ +LI SI  K+
Sbjct: 120 GNVSLQVLHCPGHTPGHVVFFDDASRLLISGDVIFKGGVGRSDFPRGNHAELIASIKQKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           +PLGD+++F+ GHGP ST+G ER+ NPFL+  +
Sbjct: 180 MPLGDDVTFIPGHGPLSTLGYERQHNPFLQDEM 212


>gi|88801050|ref|ZP_01116598.1| glyoxylase II family protein [Reinekea sp. MED297]
 gi|88776189|gb|EAR07416.1| glyoxylase II family protein [Reinekea sp. MED297]
          Length = 216

 Score =  192 bits (487), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 90/213 (42%), Positives = 138/213 (64%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L + I+ VT   QNC+ ++ +++L+A++VD GG+++ +K V Q++  ++K +W+THGH+D
Sbjct: 2   LQYQIIPVTALAQNCSLVWCDQTLDAIIVDAGGEVEKLKSVAQAKGLNLKAVWLTHGHLD 61

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GGA  L+E L L +IGPH +D   +  +++Q ++  +    RN   D WL++G TL +
Sbjct: 62  HAGGAQDLREQLGLPVIGPHPEDQFWLEGIEQQCQMYGLSGM-RNVQPDEWLKEGATLQV 120

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V   PGH+PGHV+  +     A +GD LF  SIGRTD   GD+  LI SI  K+
Sbjct: 121 GQETLEVLETPGHTPGHVVLFHRAQKLAWVGDVLFAGSIGRTDFPRGDHGTLIRSITEKL 180

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            PLGD++ F+ GHGP ST G ERR NPF+  ++
Sbjct: 181 WPLGDDVRFIPGHGPESTFGAERRSNPFVSDSV 213


>gi|24374576|ref|NP_718619.1| metallo-beta-lactamase family protein [Shewanella oneidensis MR-1]
 gi|24349179|gb|AAN56063.1|AE015741_8 metallo-beta-lactamase family protein [Shewanella oneidensis MR-1]
          Length = 214

 Score =  192 bits (487), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 88/213 (41%), Positives = 133/213 (62%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + I+ VTPF+QNC+ ++ E++  A VVDPGG++D I   I      + ++ +THGH+D
Sbjct: 1   MKYQIIPVTPFQQNCSLIWCEKTKRAAVVDPGGNVDRILREIAKLGLTLDKVLLTHGHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVGGA  L +  ++ IIGPH+ D   +  + +Q++             D++L DG+T+ +
Sbjct: 61  HVGGAKLLAQQANVPIIGPHEADKFWIENLPKQSQNFGFPHC-DAFEPDQYLHDGNTVTV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGH+PGHV + +  +  A +GD LFRSSIGRTD    ++Q LI+SI +K+
Sbjct: 120 GEQSLTVLHCPGHTPGHVAFYSASSKLAWVGDILFRSSIGRTDFPQSNHQSLIHSITSKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            PLG ++ F+ GHGP ST G ER  NPF+   +
Sbjct: 180 WPLGADVEFIPGHGPISTFGEEREHNPFVADQL 212


>gi|56413954|ref|YP_151029.1| hypothetical protein SPA1801 [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|197362877|ref|YP_002142514.1| hypothetical protein SSPA1674 [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|56128211|gb|AAV77717.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|197094354|emb|CAR59866.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
          Length = 215

 Score =  192 bits (487), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 86/213 (40%), Positives = 139/213 (65%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++ I+ VT F QNC+ ++ E++  A +VDPGGD + IK  + +    + QI +THGH+D
Sbjct: 1   MNYRIIPVTAFSQNCSLIWCEQTRLAALVDPGGDAEKIKQEVDASGVTLMQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG A++L +   + +IGP K+D   +  +  Q+R+  +    +  + DRWL DGD + +
Sbjct: 61  HVGAASELAQHYGVPVIGPEKEDEFWLQGLPAQSRMFGLDER-QPLTPDRWLNDGDRVSV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGHV++ + ++     GD +F+  +GR+D   GD+ QLI++I  K+
Sbjct: 120 GNVTLQVLHCPGHTPGHVVFFDEQSQLLISGDVIFKGGVGRSDFPRGDHTQLIDAIKRKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           LPLGD+++F+ GHGP ST+G ER  NPFL+  +
Sbjct: 180 LPLGDDVTFIPGHGPLSTLGYERLHNPFLQDEM 212


>gi|82777549|ref|YP_403898.1| hypothetical protein SDY_2330 [Shigella dysenteriae Sd197]
 gi|309787800|ref|ZP_07682410.1| metallo-beta-lactamase superfamily protein [Shigella dysenteriae
           1617]
 gi|81241697|gb|ABB62407.1| conserved hypothetical protein [Shigella dysenteriae Sd197]
 gi|308924199|gb|EFP69696.1| metallo-beta-lactamase superfamily protein [Shigella dysenteriae
           1617]
          Length = 215

 Score =  191 bits (486), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 87/213 (40%), Positives = 138/213 (64%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++ I+ VT F QNC+ ++ E++  A +VDPGGD + IK  + +    + QI +THGH+D
Sbjct: 1   MNYRIIPVTAFSQNCSLIWCEQTRLAALVDPGGDAEKIKQEVDASGLTLMQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L +   + + GP K+D   +  +  Q+R+  +    +  + DRWL +GDT+ +
Sbjct: 61  HVGAAAELAQHYGMPVFGPEKEDEFWLQGLPAQSRMFGLEEC-QPLTPDRWLNEGDTISI 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGHV++ +        GD +F+  +GR+D   GD+ QLI+SI +K+
Sbjct: 120 GNVALQVLHCPGHTPGHVVFFDDRAKLLISGDVIFKGGVGRSDFPRGDHNQLISSIKDKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           LPLGD+++F+ GHGP ST+G ER  NPFL+  +
Sbjct: 180 LPLGDDVTFIPGHGPLSTLGYERLHNPFLQDEM 212


>gi|188534254|ref|YP_001908051.1| Putative metallo-beta-lactamase [Erwinia tasmaniensis Et1/99]
 gi|188029296|emb|CAO97173.1| Putative metallo-beta-lactamase [Erwinia tasmaniensis Et1/99]
          Length = 209

 Score =  191 bits (486), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 89/210 (42%), Positives = 137/210 (65%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + FHI+ VT F QNC+ ++  E+ +A +VDPGGD   IK  I +    +KQI +THGH+D
Sbjct: 1   MEFHIIPVTAFAQNCSVIWCPETGDAALVDPGGDAQKIKTEIAALGVTLKQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L E   ++IIGPHK D   +  + +Q+++      A   + +RWL++G+++ +
Sbjct: 61  HVGAAAELAEHYDVSIIGPHKADKFWLDGLPQQSQMFGFDECA-PLTPNRWLEEGESVHV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V  C GH+PGH+++ + E      GD +F   +GR+D   G +  LI SI++K+
Sbjct: 120 GHTELEVLLCSGHTPGHIVFFDREGRLLVSGDVIFNGGVGRSDFPQGSHDDLIASIHSKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           LPLGD+++F+ GHGP ST+GRER  NPFL+
Sbjct: 180 LPLGDDVAFIPGHGPMSTLGRERISNPFLQ 209


>gi|312171967|emb|CBX80224.1| Uncharacterized protein M6_Spy0554 [Erwinia amylovora ATCC
           BAA-2158]
          Length = 209

 Score =  191 bits (486), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 93/210 (44%), Positives = 137/210 (65%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++HI+ VT F QNC+ ++  E+ EA +VDPGGD   IK  I +    VKQI +THGH+D
Sbjct: 1   MNYHIIPVTAFAQNCSVIWCPETGEAALVDPGGDAQKIKHEIAALGLTVKQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L E   + I+GPHK D   +  + +Q+++      A   + DRWLQ+G+ + +
Sbjct: 61  HVGAAAELAEHYDVPIVGPHKADKFWLDGLPQQSQMFGFDECA-PLTPDRWLQEGEVVHV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G  + +V  CPGH+PGH+++   +      GD +F   +GR+D   G +Q LI SI NK+
Sbjct: 120 GNTVLEVLLCPGHTPGHIVFFERKARLLVSGDVIFSGGVGRSDFPQGSHQDLIASILNKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           LPLGD+++F+ GHGP ST+GRER  NPFL+
Sbjct: 180 LPLGDDVTFIAGHGPMSTLGRERISNPFLQ 209


>gi|331672463|ref|ZP_08373253.1| putative Metallo-beta-lactamase [Escherichia coli TA280]
 gi|331070369|gb|EGI41734.1| putative Metallo-beta-lactamase [Escherichia coli TA280]
          Length = 215

 Score =  191 bits (486), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 87/213 (40%), Positives = 139/213 (65%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++ I+ VT F QNC+ ++ E++  A +VDPGGD + IK  + +    + QI +THGH+D
Sbjct: 1   MNYRIIPVTAFSQNCSLIWCEQTRLAALVDPGGDAEKIKQEVDASGLTLMQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L +   +++ GP K+D   +  +  Q+R+  +    +  + DRWL +GDT+ +
Sbjct: 61  HVGAAAELAQHYGVSVFGPEKEDEFWLQGLPAQSRMFGLEEC-QPLTPDRWLNEGDTISI 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGHV++ +        GD +F+  +GR+D   GD+ QLI+SI +K+
Sbjct: 120 GNVALQVLHCPGHTPGHVVFFDDRAKLLISGDVIFKGGVGRSDFPRGDHNQLISSIKDKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           LPLGD+++F+ GHGP ST+G ER  NPFL+  +
Sbjct: 180 LPLGDDVTFIPGHGPLSTLGYERLHNPFLQDEM 212


>gi|325496865|gb|EGC94724.1| metal-binding hydrolase [Escherichia fergusonii ECD227]
          Length = 215

 Score =  191 bits (486), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 86/213 (40%), Positives = 139/213 (65%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++ I+ VT F QNC+ ++ E++  A +VDPGGD + IK  + +    + QI +THGH+D
Sbjct: 1   MNYRIIPVTAFSQNCSLIWCEQTRLAALVDPGGDAEKIKQEVDASGLTLMQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L +   + ++GP K+D   +  +  Q+R+  +    +  + DRWL +GDT+ +
Sbjct: 61  HVGAAAELAQHYGVPVLGPEKEDEFWLQGLPAQSRMFGLDEC-QPLTPDRWLNEGDTISI 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGHV++ + +      GD +F+  +GR+D   GD+ QLI +I +K+
Sbjct: 120 GNVTLQVLHCPGHTPGHVVFFDDQAKLLISGDVIFKGGVGRSDFPRGDHNQLIAAIKDKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           LPLGD+++F+ GHGP ST+G ER  NPFL+  +
Sbjct: 180 LPLGDDVTFIPGHGPLSTLGYERLHNPFLQDEM 212


>gi|56476961|ref|YP_158550.1| putative metallo-beta-lactamase family protein [Aromatoleum
           aromaticum EbN1]
 gi|56313004|emb|CAI07649.1| putative metallo-beta-lactamase family protein [Aromatoleum
           aromaticum EbN1]
          Length = 213

 Score =  191 bits (486), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 96/212 (45%), Positives = 133/212 (62%), Gaps = 1/212 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +   IV VTPF+QNC+ ++ +++ +A VVDPGGDL+ I    +     +++I ITHGH+D
Sbjct: 2   IDLRIVPVTPFEQNCSIVWCDKTRKAAVVDPGGDLERILAKAKELGVTIEKILITHGHID 61

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GG AQL  +L + + GP K D   +  + +QAR       A +   DRWL DGDT+ +
Sbjct: 62  HAGGTAQLARELGVPVEGPEKADLFWITGIPQQARTFGFPG-AESFEPDRWLHDGDTVTV 120

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V H PGH+PGHV + + +   A +GD LF  SIGRTD   GD+  LI SI  K+
Sbjct: 121 GDETLRVIHVPGHTPGHVAFFHADARLAIVGDVLFAGSIGRTDFPQGDHATLIRSIRQKL 180

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSN 215
            PLGD+I+FV GHGP ST G ERR NP++  +
Sbjct: 181 FPLGDDITFVPGHGPTSTFGEERRSNPYVGDH 212


>gi|114321333|ref|YP_743016.1| beta-lactamase domain-containing protein [Alkalilimnicola ehrlichii
           MLHE-1]
 gi|114227727|gb|ABI57526.1| beta-lactamase domain protein [Alkalilimnicola ehrlichii MLHE-1]
          Length = 215

 Score =  191 bits (485), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 84/209 (40%), Positives = 131/209 (62%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +  +++ VT F+QNC  +  E +  A VVDPGG++D +   ++     V +I +TH H+D
Sbjct: 1   MKLYVIPVTSFRQNCAVVACERTGLAAVVDPGGEVDKVLAEVEDLGLTVDRILLTHAHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVGG  ++ + L + I GPH+ D  ++ ++DEQAR+      A     D W++DG+ + +
Sbjct: 61  HVGGVREMADRLQVPIFGPHQADRELLSQLDEQARMF-GHPPAPAFEPDHWVEDGEIVRV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V   PGH+PGHV Y + E+ +A  GD LF+ +IGR+D   GD+  L+ SI  K+
Sbjct: 120 GEVALRVVLVPGHTPGHVAYFDPESRYALTGDLLFQGAIGRSDFPGGDHDTLVQSIREKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
            PLGD+++F+ GHGP S+ G ERR NPF+
Sbjct: 180 FPLGDDVTFIPGHGPASSFGEERRSNPFV 208


>gi|238757637|ref|ZP_04618821.1| hypothetical protein yaldo0001_19580 [Yersinia aldovae ATCC 35236]
 gi|238704142|gb|EEP96675.1| hypothetical protein yaldo0001_19580 [Yersinia aldovae ATCC 35236]
          Length = 225

 Score =  191 bits (485), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 86/211 (40%), Positives = 134/211 (63%), Gaps = 1/211 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + I+ VT F QNCT ++ E + +A +VDPGG+   I   +  +   V QI +THGH+D
Sbjct: 11  MKYQIIPVTAFSQNCTLIWCEATGQAALVDPGGEAAKIIAEVARQGVTVNQILLTHGHLD 70

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L     + I GP K+D   +  +  Q+++  +       +  RWL++GD +++
Sbjct: 71  HVGAAAELAAHFQIPIYGPEKEDTFWLEGLPAQSQMFGLTEC-DAFTPTRWLEEGDKIIV 129

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGH+PGH+++++ +   A +GD +F   +GR+D   GD+QQLI SI  K+
Sbjct: 130 GDIELSVLHCPGHTPGHIVFIDQKGRLALVGDVIFNGGVGRSDFPRGDHQQLITSIRTKL 189

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           LPLGD+++F+ GHGP STIG ER+ NPF++ 
Sbjct: 190 LPLGDDMTFIPGHGPMSTIGHERQTNPFIRE 220


>gi|163851997|ref|YP_001640040.1| beta-lactamase domain-containing protein [Methylobacterium
           extorquens PA1]
 gi|218530750|ref|YP_002421566.1| beta-lactamase [Methylobacterium chloromethanicum CM4]
 gi|254561719|ref|YP_003068814.1| metal-binding hydrolase [Methylobacterium extorquens DM4]
 gi|163663602|gb|ABY30969.1| beta-lactamase domain protein [Methylobacterium extorquens PA1]
 gi|218523053|gb|ACK83638.1| beta-lactamase domain protein [Methylobacterium chloromethanicum
           CM4]
 gi|254268997|emb|CAX24958.1| putative metal-binding hydrolase [Methylobacterium extorquens DM4]
          Length = 214

 Score =  191 bits (485), Expect = 7e-47,   Method: Composition-based stats.
 Identities = 95/207 (45%), Positives = 143/207 (69%), Gaps = 1/207 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           I+ VTPF+QNCT ++D+ +    VVDPGGDLD I+  I+++   V++I +THGH+DH GG
Sbjct: 9   IIPVTPFQQNCTLIWDDATKVGAVVDPGGDLDRIEAAIRAQGVTVEKILLTHGHIDHAGG 68

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           AA+LKE L + + GPH+ D  ++  + E      I   AR  + DRWL +G+T+ +G   
Sbjct: 69  AAELKERLGVPVEGPHEADKFLLDSLPETGASYGI-DGARAITPDRWLNEGETVTVGGLT 127

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
           F ++H PGHSPG V++++ +  FA +GD +F+ S+GRTD+  G ++QLI  I  K+LPLG
Sbjct: 128 FDIWHAPGHSPGSVVFMSRDARFALVGDVVFQGSVGRTDLPGGSHEQLIRMIREKVLPLG 187

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLKS 214
           D+++F+ GHGP  T+G+ER  NPFL+ 
Sbjct: 188 DDVAFIPGHGPTGTLGQERMTNPFLQG 214


>gi|270261210|ref|ZP_06189483.1| hypothetical protein SOD_a04350 [Serratia odorifera 4Rx13]
 gi|270044694|gb|EFA17785.1| hypothetical protein SOD_a04350 [Serratia odorifera 4Rx13]
          Length = 215

 Score =  191 bits (484), Expect = 7e-47,   Method: Composition-based stats.
 Identities = 90/211 (42%), Positives = 137/211 (64%), Gaps = 1/211 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + I+ VT F QNC+ ++ E + +A +VDPGG+ + +K  +  +   + QI +THGH+D
Sbjct: 1   MKYQIIPVTAFSQNCSLIWCESTQQAALVDPGGEAEKLKAEVAKQGVTITQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L E   + I GP K+DA  +  +  Q+R+  +   A   +  +WLQ+GD + +
Sbjct: 61  HVGAAAELAEHYQVPIYGPDKEDAFWLDGLPAQSRMFGLEECA-PLTPTQWLQEGDKVQV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   F V HCPGH+PGH++++N +   A +GD LF   +GR+D   GD+Q LINSI  K+
Sbjct: 120 GEMTFNVLHCPGHTPGHIVFINEKARLALVGDVLFNGGVGRSDFPRGDHQALINSIRTKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           LP GD+++F+ GHGP ST G+ER  NPFL+ 
Sbjct: 180 LPQGDDMAFIPGHGPMSTFGQERETNPFLRE 210


>gi|324113742|gb|EGC07717.1| metallo-beta-lactamase superfamily protein [Escherichia fergusonii
           B253]
          Length = 215

 Score =  191 bits (484), Expect = 7e-47,   Method: Composition-based stats.
 Identities = 86/213 (40%), Positives = 140/213 (65%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++ I+ VT F QNC+ ++ E++  A +VDPGGD + IK  + +    + QI +THGH+D
Sbjct: 1   MNYRIIPVTAFSQNCSLIWCEQTRLAALVDPGGDAEKIKQEVDASGLTLMQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L +   + ++GP K+D   +  +  Q+R+  +    +  + DRWL +GDT+ +
Sbjct: 61  HVGAAAELAQHYGVPVLGPEKEDEFWLQGLPAQSRMFGLDEC-QPLTPDRWLNEGDTISI 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGHV++ + +      GD +F+  +GR+D   GD+ QLI++I +K+
Sbjct: 120 GNVTLQVLHCPGHTPGHVVFFDDQAKLLISGDVIFKGGVGRSDFPRGDHNQLISAIKDKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           LPLGD+++F+ GHGP ST+G ER  NPFL+  +
Sbjct: 180 LPLGDDVTFIPGHGPLSTLGYERLHNPFLQDEM 212


>gi|224826028|ref|ZP_03699131.1| beta-lactamase domain protein [Lutiella nitroferrum 2002]
 gi|224601665|gb|EEG07845.1| beta-lactamase domain protein [Lutiella nitroferrum 2002]
          Length = 216

 Score =  191 bits (484), Expect = 7e-47,   Method: Composition-based stats.
 Identities = 89/214 (41%), Positives = 131/214 (61%), Gaps = 2/214 (0%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           MS L  H V VTPF QNC+ L+ + +L A +VDPGGD++ I   + +R+  V +I +THG
Sbjct: 1   MS-LKLHTVPVTPFAQNCSLLWCDVTLNAAIVDPGGDIERILAEVAARDLTVVKILLTHG 59

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DH G    L   L + + GP ++++  + ++  Q ++      A   + DRWL++GDT
Sbjct: 60  HIDHAGATMPLARRLGVPVEGPQREESFWLDQLPNQGQMFGFPP-AEAVTPDRWLEEGDT 118

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           + LG     V HCPGH+PGHV++ +        GD LF+ SIGRTD   G++QQLI++I 
Sbjct: 119 VTLGEETLAVLHCPGHTPGHVVFYSAAAGLLIAGDVLFQGSIGRTDFPRGNHQQLIDAIR 178

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
            K+  L +E   V GHGP +TIG E+R NPF+  
Sbjct: 179 GKLFVLPEETVVVPGHGPYTTIGDEKRHNPFVAD 212


>gi|222149317|ref|YP_002550274.1| hydrolase [Agrobacterium vitis S4]
 gi|221736301|gb|ACM37264.1| hydrolase [Agrobacterium vitis S4]
          Length = 215

 Score =  191 bits (484), Expect = 7e-47,   Method: Composition-based stats.
 Identities = 112/214 (52%), Positives = 152/214 (71%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M +L   I+ VTPF+QNCT  FD E+ E VVVDPGGD++ I  ++Q     +K+IW+THG
Sbjct: 1   MGQLQAGIIPVTPFQQNCTVFFDSETKEGVVVDPGGDVEEILRMVQENGITLKEIWLTHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DH GGA  LK+ L + IIGPH+DD  ++  ++ Q+   ++ +  RN + DR+L++GD 
Sbjct: 61  HLDHAGGAEDLKDALGIQIIGPHRDDKPLLDALEGQSARFNLPIKLRNVTPDRFLEEGDV 120

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           +    H F+V HCPGH+PGHV++ N   NFAHLGD LF  SIGRTD+  G+ QQL+ SI 
Sbjct: 121 VGFSGHEFEVLHCPGHAPGHVVFFNRVQNFAHLGDVLFNGSIGRTDLPGGNPQQLLASIR 180

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           +K+LPLGD++ F+CGHGP S IG ERR NPFLK 
Sbjct: 181 DKVLPLGDDVGFICGHGPGSRIGDERRSNPFLKG 214


>gi|94312364|ref|YP_585574.1| beta-lactamase-like protein [Cupriavidus metallidurans CH34]
 gi|93356216|gb|ABF10305.1| putative metal-binding hydrolase [Cupriavidus metallidurans CH34]
          Length = 222

 Score =  191 bits (484), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 93/215 (43%), Positives = 136/215 (63%), Gaps = 1/215 (0%)

Query: 2   SKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGH 61
           +++   ++ VTPF+QNC+ L DE +  A V DPGGDLD I   ++ +   +++I++THGH
Sbjct: 5   AQMKALLIPVTPFQQNCSLLIDETTQRAAVCDPGGDLDRILSAVKEQGVTLEKIFLTHGH 64

Query: 62  VDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
           VDH  GAA L   L + I GP +++   + ++ EQ R             DRWL++GDT+
Sbjct: 65  VDHCAGAATLSRQLGIPIEGPQQEERFWIEQLPEQTRRFGFGH-PEAFEPDRWLENGDTV 123

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
             G    +V+HCPGH+PGHV++ +  N  A +GD LF  SIGRTD   G++  LI SI  
Sbjct: 124 TFGNETLEVYHCPGHTPGHVVFFSRPNKLAIVGDVLFAGSIGRTDFPRGNHADLIRSIRT 183

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           ++ PLGD+++FV GHGP ST G ERR NPF+  ++
Sbjct: 184 RLWPLGDDVTFVPGHGPVSTFGEERRNNPFVADHL 218


>gi|238913230|ref|ZP_04657067.1| hypothetical protein SentesTe_19194 [Salmonella enterica subsp.
           enterica serovar Tennessee str. CDC07-0191]
          Length = 215

 Score =  191 bits (484), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 85/213 (39%), Positives = 139/213 (65%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++ I+ VT F QNC+ ++ E++  A +VDPGGD + IK  + +    + QI +THGH+D
Sbjct: 1   MNYRIIPVTAFSQNCSLIWCEQTRLAALVDPGGDAEKIKQEVDASGVTLMQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG A++L +   + +IGP K+D   +  +  Q+R+  +    +  + DRWL DGD + +
Sbjct: 61  HVGAASELAQHYGVPVIGPEKEDEFWLQGLPAQSRMFGLDEC-QPLTPDRWLNDGDRVSV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGHV++ + ++     GD +F+  +GR+D   GD+ +LI++I  K+
Sbjct: 120 GNVTLQVLHCPGHTPGHVVFFDEQSQLLISGDVIFKGGVGRSDFPRGDHTKLIDAIKRKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           LPLGD+++F+ GHGP ST+G ER  NPFL+  +
Sbjct: 180 LPLGDDVTFIPGHGPLSTLGYERLHNPFLQDEM 212


>gi|91781529|ref|YP_556735.1| putative metallo-beta-lactamase family protein [Burkholderia
           xenovorans LB400]
 gi|91685483|gb|ABE28683.1| Putative metallo-beta-lactamase family protein [Burkholderia
           xenovorans LB400]
          Length = 214

 Score =  191 bits (484), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 92/213 (43%), Positives = 134/213 (62%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +   ++ VTPF+QN + L  E +  A VVDPGGDLD+I+  I  +N  V+++++THGH+D
Sbjct: 1   MKVTLIPVTPFQQNSSLLVCEATGRAAVVDPGGDLDVIQGEIARQNVSVEKVFLTHGHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H  GA  L     + I GPH D+   + K+ +Q+        A     DRWLQ+G+T+  
Sbjct: 61  HCAGAKTLASRYDVPIEGPHPDERFWLDKLPDQSTRFGFPA-AEAFEPDRWLQNGETVQF 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G  I +V+HCPGH+PGHV++ +  +  A +GD LF  SIGRTD   G++  L+ SI  K+
Sbjct: 120 GDEILEVYHCPGHTPGHVVFFSRAHRLALVGDVLFAGSIGRTDFPRGNHADLVRSIREKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            PLGD+++FV GHGP ST G ERR NP++   +
Sbjct: 180 WPLGDDVTFVPGHGPTSTFGAERRTNPYVCDGV 212


>gi|117620793|ref|YP_856746.1| metallo-beta-lactamase family protein [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
 gi|117562200|gb|ABK39148.1| metallo-beta-lactamase family protein [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
          Length = 214

 Score =  191 bits (484), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 89/209 (42%), Positives = 133/209 (63%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L F ++ VT F QNC+ ++ +E+ +A ++DPGG+ D +   I  R   +  I +THGH+D
Sbjct: 2   LKFEVIPVTQFAQNCSLIWCDETHQAALIDPGGEADKLLAAIAKRGLTLTHILLTHGHLD 61

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L+E   + I GPHK+DA  +  + +Q+++     +    + D WL+ GD + +
Sbjct: 62  HVGAAAELREKTGVAITGPHKEDAFWLDMLPQQSQMFGF-AHTPAFTPDHWLEQGDKVKV 120

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V+ CPGH+PGHV+ ++     A +GD LF  SIGRTD   GD+  LI SI   +
Sbjct: 121 GQCELEVYFCPGHTPGHVVLLSQTERLAWVGDVLFAGSIGRTDFPRGDHGTLIKSITETL 180

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           LPLGD+I F+ GHGP+ST GRE+  NP+L
Sbjct: 181 LPLGDDIVFIPGHGPSSTFGREQASNPYL 209


>gi|34495542|ref|NP_899757.1| metallo-beta-lactamase [Chromobacterium violaceum ATCC 12472]
 gi|34101397|gb|AAQ57766.1| probable metallo-beta-lactamase [Chromobacterium violaceum ATCC
           12472]
          Length = 216

 Score =  191 bits (484), Expect = 9e-47,   Method: Composition-based stats.
 Identities = 85/214 (39%), Positives = 135/214 (63%), Gaps = 2/214 (0%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M+ L +H++ VTPF QNC+ L+ + S +A VVD GGD++ I+  +  +   V+++ +THG
Sbjct: 1   MA-LKYHVIPVTPFAQNCSVLWCDASRKAAVVDAGGDIERIQAWVDGQGLTVEKLLLTHG 59

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DH GGAA+L E L ++I GP + +   + ++  Q ++      +   +  RWL++GDT
Sbjct: 60  HIDHAGGAARLAEKLGVSIEGPQRAERFWLDQLPTQGQMFGFPR-SEPLTPQRWLEEGDT 118

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           + +G     V HCPGH+PGHV++ +        GD LF+ SIGRTD   G++QQLI++I 
Sbjct: 119 VTVGQETLDVIHCPGHTPGHVVFHSPAAKVLVAGDVLFQGSIGRTDFPMGNHQQLIDAIQ 178

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
            K+  L D+   + GHGP +TIG E+R NP++  
Sbjct: 179 QKLFVLPDDTVVIPGHGPFTTIGAEKRGNPYVAD 212


>gi|157146382|ref|YP_001453701.1| hypothetical protein CKO_02141 [Citrobacter koseri ATCC BAA-895]
 gi|157083587|gb|ABV13265.1| hypothetical protein CKO_02141 [Citrobacter koseri ATCC BAA-895]
          Length = 215

 Score =  191 bits (484), Expect = 9e-47,   Method: Composition-based stats.
 Identities = 86/213 (40%), Positives = 137/213 (64%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++ I+ VT F QNC+ ++ E++  A +VDPGGD   IK  + +    + QI +THGH+D
Sbjct: 1   MNYRIIPVTAFSQNCSLIWCEQTRLAALVDPGGDAQTIKQEVDASGVTLMQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L +   + +IGP K+D   +  +  Q+R+  +    +  + DRWL +GD + +
Sbjct: 61  HVGAAAELAKHYGVPVIGPEKEDEFWLQGLPAQSRMFGLEEC-QPLTPDRWLNEGDRISV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGH+++ +  +     GD +F+  +GR+D   GD+ QLI+SI  K+
Sbjct: 120 GNVTLQVLHCPGHTPGHIVFFDESSRLLISGDVIFKGGVGRSDFPRGDHAQLIDSIKRKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           LPLGD+++F+ GHGP ST+G ER  NPFL+  +
Sbjct: 180 LPLGDDVTFISGHGPMSTLGHERLHNPFLQDEM 212


>gi|315121921|ref|YP_004062410.1| hypothetical protein CKC_00855 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495323|gb|ADR51922.1| hypothetical protein CKC_00855 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 216

 Score =  190 bits (483), Expect = 9e-47,   Method: Composition-based stats.
 Identities = 185/216 (85%), Positives = 202/216 (93%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           MSKLSF+ ++VTPFKQNCTFLFDEESLEAVV+DPGGDLD IKDVI+SRNF VKQIWITHG
Sbjct: 1   MSKLSFYSLKVTPFKQNCTFLFDEESLEAVVIDPGGDLDRIKDVIKSRNFRVKQIWITHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DHVGGAAQLKEDLSL IIGPHKDDA MM  V+EQA+LLS+ MN RN SSD WLQDGD+
Sbjct: 61  HIDHVGGAAQLKEDLSLQIIGPHKDDAMMMNNVEEQAKLLSVCMNERNTSSDHWLQDGDS 120

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           + +G H+FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFR SIG+TDILHG+YQQL+NSIN
Sbjct: 121 VSVGKHVFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRDSIGKTDILHGNYQQLMNSIN 180

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           NKILPLGDEISFVCGHGPNSTIGRERRLNPFLKSN+
Sbjct: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNM 216


>gi|217968892|ref|YP_002354126.1| beta-lactamase [Thauera sp. MZ1T]
 gi|217506219|gb|ACK53230.1| beta-lactamase domain protein [Thauera sp. MZ1T]
          Length = 213

 Score =  190 bits (483), Expect = 9e-47,   Method: Composition-based stats.
 Identities = 98/205 (47%), Positives = 132/205 (64%), Gaps = 1/205 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           IV VTPF+QNC+ L+ E + +A VVDPGGDLD I   +      V++I ITHGH+DH GG
Sbjct: 6   IVPVTPFQQNCSILWCERTKKAAVVDPGGDLDRILAAVAELGVTVEKILITHGHIDHAGG 65

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
            A+L  +L + I GP ++D   +  + +Q+++        +   DRWL DGDT+ +G   
Sbjct: 66  TAKLARELGVPIEGPQEEDRFWIEGMPQQSKMFGFPD-VESFEPDRWLHDGDTVTVGEQT 124

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
            KV H PGH+PGHV++V+     A +GD LF  SIGRTD   GD+Q LI SI  K+ PLG
Sbjct: 125 LKVIHTPGHTPGHVVFVHEGARLAIVGDVLFAGSIGRTDFPRGDHQTLIRSIREKLFPLG 184

Query: 188 DEISFVCGHGPNSTIGRERRLNPFL 212
           D+I+F+ GHGP ST G ER  NPF+
Sbjct: 185 DDITFIPGHGPTSTFGEERDSNPFV 209


>gi|332162188|ref|YP_004298765.1| metallo-beta-lactamase superfamily protein [Yersinia enterocolitica
           subsp. palearctica 105.5R(r)]
 gi|325666418|gb|ADZ43062.1| metallo-beta-lactamase superfamily protein [Yersinia enterocolitica
           subsp. palearctica 105.5R(r)]
 gi|330860170|emb|CBX70491.1| uncharacterized protein ycbL [Yersinia enterocolitica W22703]
          Length = 244

 Score =  190 bits (483), Expect = 9e-47,   Method: Composition-based stats.
 Identities = 87/211 (41%), Positives = 136/211 (64%), Gaps = 1/211 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + I+ VT F QNCT ++ EE+ +A +VDPGG+   I   +   +  + QI +THGH+D
Sbjct: 30  MKYQIIPVTAFSQNCTLIWCEETGQAALVDPGGEAAKIIAEVARHHIQINQILLTHGHLD 89

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L     + I GP K+D   +  +  Q+R+  +       +  RWL++GD + +
Sbjct: 90  HVGAAAELAAHFQVPIYGPEKEDTFWLEGLPAQSRMFGLSEC-EAFTPTRWLEEGDKITV 148

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGH+PGH+++++ ++  A +GD +F   +GR+D   GD+QQLINSI  K+
Sbjct: 149 GAIELSVLHCPGHTPGHIVFIDQKDRLALVGDVIFNGGVGRSDFPRGDHQQLINSIRTKL 208

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           LPLGD+++F+ GHGP ST+G ER+ NPF++ 
Sbjct: 209 LPLGDDMTFIPGHGPMSTLGHERQTNPFIRE 239


>gi|323524502|ref|YP_004226655.1| beta-lactamase domain-containing protein [Burkholderia sp.
           CCGE1001]
 gi|323381504|gb|ADX53595.1| beta-lactamase domain protein [Burkholderia sp. CCGE1001]
          Length = 214

 Score =  190 bits (483), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 93/212 (43%), Positives = 130/212 (61%), Gaps = 1/212 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +   ++ VTPF+QNC+ L  E +  A VVDPGGDLDII+  I  +   V+++++THGH+D
Sbjct: 1   MKVTLIPVTPFQQNCSLLVCEATGRAAVVDPGGDLDIIQGEIARQKVSVEKVFLTHGHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H  GA  L     + I GPH D+   + K+ +Q+        A     DRWL DGDT+  
Sbjct: 61  HCAGAKTLAAHYGVPIEGPHPDERFWLDKLADQSTRFGFPA-AEAFEPDRWLHDGDTVQF 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V+HCPGH+PGHV++ +  +  A +GD LF  SIGRTD   G++  LI SI   +
Sbjct: 120 GDETLEVYHCPGHTPGHVVFFSRAHRLALVGDVLFAGSIGRTDFPRGNHADLIRSIRENL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSN 215
            PLGD+++FV GHGP ST G ERR NP++   
Sbjct: 180 WPLGDDVTFVPGHGPTSTFGAERRSNPYVADG 211


>gi|318606242|emb|CBY27740.1| hypothetical metal-binding enzyme, YcbL homolog [Yersinia
           enterocolitica subsp. palearctica Y11]
          Length = 244

 Score =  190 bits (483), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 87/211 (41%), Positives = 136/211 (64%), Gaps = 1/211 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + I+ VT F QNCT ++ EE+ +A +VDPGG+   I   +   +  + QI +THGH+D
Sbjct: 30  MKYQIIPVTAFSQNCTLIWCEETGQAALVDPGGEAAKIIAEVARHHIQINQILLTHGHLD 89

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L     + I GP K+D   +  +  Q+R+  +       +  RWL++GD + +
Sbjct: 90  HVGAAAELAAHFQVPIYGPEKEDTFWLEGLPAQSRMFGLNEC-EAFTPTRWLEEGDKITV 148

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGH+PGH+++++ ++  A +GD +F   +GR+D   GD+QQLINSI  K+
Sbjct: 149 GAIELSVLHCPGHTPGHIVFIDQKDRLALVGDVIFNGGVGRSDFPRGDHQQLINSIRTKL 208

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           LPLGD+++F+ GHGP ST+G ER+ NPF++ 
Sbjct: 209 LPLGDDMTFIPGHGPMSTLGHERQTNPFIRE 239


>gi|119476230|ref|ZP_01616581.1| metallo-beta-lactamase superfamily protein [marine gamma
           proteobacterium HTCC2143]
 gi|119450094|gb|EAW31329.1| metallo-beta-lactamase superfamily protein [marine gamma
           proteobacterium HTCC2143]
          Length = 214

 Score =  190 bits (483), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 97/212 (45%), Positives = 138/212 (65%), Gaps = 1/212 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +   IV VTP++QNC+ L  EE+ +A VVDPGGDL+ I+  +   +  +++I++THGH+D
Sbjct: 1   MKCAIVPVTPYQQNCSILVCEETKKAAVVDPGGDLEKIESALTQLDVVLEKIFLTHGHMD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H   AAQ++E   + I GPH DD   + K+ E  ++     +A    SDRWL +GDT+  
Sbjct: 61  HCAIAAQVREKYGIPIEGPHVDDKFWIEKLPESCQMSGF-PHADVFDSDRWLVEGDTVQF 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGH+PGHVI+ N E+  A +GD LF+ SIGRTD   GD++ L+ SI  K+
Sbjct: 120 GNQTLAVRHCPGHTPGHVIFFNAESRVAIVGDVLFQGSIGRTDFPRGDHETLVQSIREKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSN 215
            PLGD+++F+ GHGP ST G ER  NPF+  +
Sbjct: 180 WPLGDDVAFIPGHGPTSTFGHERETNPFVADS 211


>gi|240139125|ref|YP_002963600.1| putative metal-binding hydrolase [Methylobacterium extorquens AM1]
 gi|240009097|gb|ACS40323.1| putative metal-binding hydrolase [Methylobacterium extorquens AM1]
          Length = 214

 Score =  190 bits (483), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 95/207 (45%), Positives = 143/207 (69%), Gaps = 1/207 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           I+ VTPF+QNCT ++D+ +    VVDPGGDLD I+  I+++   V++I +THGH+DH GG
Sbjct: 9   IIPVTPFQQNCTLIWDDATKVGAVVDPGGDLDRIEAAIRAQGVTVEKILLTHGHIDHAGG 68

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           AA+LKE L + + GPH+ D  ++  + E      I   AR  + DRWL +G+T+ +G   
Sbjct: 69  AAELKERLGVPVEGPHEADKFLLDSLPETGVSYGI-DGARAITPDRWLNEGETVTVGGLT 127

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
           F ++H PGHSPG V++++ +  FA +GD +F+ S+GRTD+  G ++QLI  I  K+LPLG
Sbjct: 128 FDIWHAPGHSPGSVVFMSRDARFALVGDVVFQGSVGRTDLPGGSHEQLIRMIREKVLPLG 187

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLKS 214
           D+++F+ GHGP  T+G+ER  NPFL+ 
Sbjct: 188 DDVAFIPGHGPTGTLGQERMTNPFLQG 214


>gi|114047006|ref|YP_737556.1| beta-lactamase domain-containing protein [Shewanella sp. MR-7]
 gi|113888448|gb|ABI42499.1| beta-lactamase domain protein [Shewanella sp. MR-7]
          Length = 214

 Score =  190 bits (483), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 89/213 (41%), Positives = 133/213 (62%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + I+ VTPF+QNC+ ++ E++  A VVDPGG++D I   +      ++++ +THGH+D
Sbjct: 1   MKYQIIPVTPFQQNCSLIWCEKTKRAAVVDPGGNVDRILGEMDKLGLTLEKVLLTHGHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVGGA  L +  ++ IIGPH+ D   +  + +Q++             D++LQDGD + +
Sbjct: 61  HVGGAKLLAQQTNVPIIGPHEADKFWIDNLPKQSQNFGFPHC-EAFEPDQYLQDGDVVTV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGH+PGHV + + E   A +GD LFRSSIGRTD    ++Q LI+SI  K+
Sbjct: 120 GEQSLSVLHCPGHTPGHVAFYSAEAKLAWVGDILFRSSIGRTDFPQSNHQSLIHSITTKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            PLG ++ F+ GHGP ST G ER  NPF+   +
Sbjct: 180 WPLGADVEFIPGHGPMSTFGEEREHNPFVADQL 212


>gi|23009016|ref|ZP_00050224.1| COG0491: Zn-dependent hydrolases, including glyoxylases
           [Magnetospirillum magnetotacticum MS-1]
          Length = 214

 Score =  190 bits (483), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 97/207 (46%), Positives = 145/207 (70%), Gaps = 1/207 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           I+ VTPF+QNCT ++D+ +    VVDPGGDLD I+  I+S+   V++I +THGH+DH GG
Sbjct: 9   IIPVTPFQQNCTLIWDDATKVGAVVDPGGDLDRIEAAIRSQGVTVEKILLTHGHIDHAGG 68

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           AA+LKE L + + GPH+ D  ++  + E      +   AR  + DRWL +GDT+ +G   
Sbjct: 69  AAELKERLGVPVEGPHEADRYLLDSLPETGASYGL-DGARAVTPDRWLDEGDTVHVGGLT 127

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
           F + H PGHSPG V++++ +  FA +GD +F+ SIGRTD+  G+++QLI +I +K+LPLG
Sbjct: 128 FDILHAPGHSPGSVVFMSRDARFALVGDVVFQGSIGRTDLPGGNHEQLIRAIKDKVLPLG 187

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLKS 214
           D+++F+ GHGP  T+G+ER  NPFL+ 
Sbjct: 188 DDVAFIPGHGPTGTLGQERLSNPFLQG 214


>gi|212709811|ref|ZP_03317939.1| hypothetical protein PROVALCAL_00859 [Providencia alcalifaciens DSM
           30120]
 gi|212687622|gb|EEB47150.1| hypothetical protein PROVALCAL_00859 [Providencia alcalifaciens DSM
           30120]
          Length = 211

 Score =  190 bits (483), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 92/212 (43%), Positives = 137/212 (64%), Gaps = 1/212 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + I+ VTPF QNC  ++DE S++AV+VDPGG+ + +   I+SR   + +I +THGH D
Sbjct: 1   MKYTIIPVTPFMQNCQVIWDENSMKAVIVDPGGEAEKLISAIESRGLTLTKILLTHGHSD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G +A L +   + I GP K+DA  +  + EQ  +  I     + + D WL++GD++  
Sbjct: 61  HIGASAPLAKHFGVPIYGPQKEDAFWIESLAEQNAMFYIGDC-PDFTPDHWLEEGDSITC 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   F V HCPGH+PGH+++VN  +    +GD LF+  +GR+D   G++Q LI SI NK+
Sbjct: 120 GDIKFDVLHCPGHTPGHIVFVNHADKLISMGDVLFKGGVGRSDFPRGNHQDLIASIKNKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSN 215
           LPLGD+  F+ GHGP ST+G ER  NPFL+  
Sbjct: 180 LPLGDDYHFIPGHGPMSTLGYERISNPFLQGG 211


>gi|237749349|ref|ZP_04579829.1| Zn-dependent hydrolase [Oxalobacter formigenes OXCC13]
 gi|229380711|gb|EEO30802.1| Zn-dependent hydrolase [Oxalobacter formigenes OXCC13]
          Length = 211

 Score =  190 bits (482), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 92/211 (43%), Positives = 135/211 (63%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + F I+ VTPF+QNCT ++DE + +A VVDPGGD+  I D ++ R   ++++++THGH+D
Sbjct: 1   MKFQIIPVTPFQQNCTLMWDENTNKAAVVDPGGDISKISDALKQRGLTLEKVFVTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GGA +L E+  + I GPHKDDA ++ ++  +   +         +  RWL  GD + +
Sbjct: 61  HCGGAKKLAEEFDVPIEGPHKDDAYLLEQLGSEQSRMWGLPAGEPFTPTRWLDQGDEVTV 120

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    KVFHCPGHSPGH+I+ +  +  A  GD LF  S+GRTD+  G + QL  SI   +
Sbjct: 121 GNETLKVFHCPGHSPGHIIFFHAPSKVAISGDVLFAGSVGRTDLPKGSFTQLSKSIKENM 180

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
             LGD++ F+ GHGP S+IG ER+ N F+K 
Sbjct: 181 YTLGDDVQFIPGHGPVSSIGYERKGNAFVKG 211


>gi|117919941|ref|YP_869133.1| beta-lactamase domain-containing protein [Shewanella sp. ANA-3]
 gi|117612273|gb|ABK47727.1| beta-lactamase domain protein [Shewanella sp. ANA-3]
          Length = 214

 Score =  190 bits (482), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 88/213 (41%), Positives = 133/213 (62%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + I+ VTPF+QNC+ ++ E++  A VVDPGG++D I   +      +++I +THGH+D
Sbjct: 1   MKYQIIPVTPFQQNCSLIWCEKTKRAAVVDPGGNVDRILGEMNKLGLTLQKILLTHGHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVGGA  L +  ++ I+GPH  D   +  + +Q++             +++LQDGD + +
Sbjct: 61  HVGGAKSLAQQTNVPIVGPHVADKFWIDNLPKQSQNFGFPHC-DAFEPEQYLQDGDVVTV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    KV HCPGH+PGHV + + + + A +GD LFRSSIGRTD    ++Q LI SI  K+
Sbjct: 120 GEQSLKVLHCPGHTPGHVAFYSADAHLAWVGDILFRSSIGRTDFPQSNHQDLIQSITTKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            PLG ++ F+ GHGP ST G ER  NPF+   +
Sbjct: 180 WPLGADVEFIPGHGPMSTFGEEREHNPFVADQL 212


>gi|302608186|emb|CBW44442.1| putative metal-binding hydrolase [Marinobacter
           hydrocarbonoclasticus]
          Length = 215

 Score =  190 bits (482), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 101/215 (46%), Positives = 138/215 (64%), Gaps = 2/215 (0%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           MS L + IV VTPF+QNCT L+  E+ +A VVDPGGDLD I    +     +++I +TH 
Sbjct: 1   MS-LKYKIVPVTPFEQNCTLLWCTETHKAAVVDPGGDLDRILAAAEDEGVILEKILLTHA 59

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DH GG A+L +   L I GPHKDD   +  +  QA++          + +RWL+DGDT
Sbjct: 60  HIDHAGGTAELAKSAGLPIEGPHKDDNFWIQGLAMQAQMFGF-PAPEVFTPNRWLEDGDT 118

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           + +G    +V H PGH+PGHV++ +  +  A +GD LF  SIGRTD   GDY  LI+SI 
Sbjct: 119 VTVGNETLEVLHTPGHTPGHVVFFHRGSKLAQVGDVLFNGSIGRTDFPKGDYNTLIHSIR 178

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLKSN 215
            K+ PLGD++SF+CGHGP ST G+ER  NPF+  +
Sbjct: 179 EKLFPLGDDVSFICGHGPMSTFGQERATNPFVSDH 213


>gi|113969777|ref|YP_733570.1| beta-lactamase domain-containing protein [Shewanella sp. MR-4]
 gi|113884461|gb|ABI38513.1| beta-lactamase domain protein [Shewanella sp. MR-4]
          Length = 214

 Score =  190 bits (482), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 89/213 (41%), Positives = 133/213 (62%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + I+ VTPF+QNC+ ++ E++  A VVDPGG++D I   +      ++++ +THGH+D
Sbjct: 1   MKYQIIPVTPFQQNCSLIWCEKTKRAAVVDPGGNVDRILGEMDKLGLTLEKVLLTHGHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVGGA  L +  ++ IIGPH+ D   +  + +Q++             D++LQDGD + +
Sbjct: 61  HVGGAKLLAQQTNVPIIGPHEADKFWIDNLPKQSQNFGFPHC-EAFEPDQYLQDGDVVTV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGH+PGHV + + E   A +GD LFRSSIGRTD    ++Q LI+SI  K+
Sbjct: 120 GEQNLSVLHCPGHTPGHVAFYSAEAKLAWVGDILFRSSIGRTDFPQSNHQSLIHSITTKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            PLG ++ F+ GHGP ST G ER  NPF+   +
Sbjct: 180 WPLGADVEFIPGHGPMSTFGEEREHNPFVADQL 212


>gi|161503874|ref|YP_001570986.1| hypothetical protein SARI_01963 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|160865221|gb|ABX21844.1| hypothetical protein SARI_01963 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 215

 Score =  190 bits (482), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 85/213 (39%), Positives = 138/213 (64%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++ I+ VT F QNC+ ++ E++  A +VDPGGD + IK  + +    + QI +THGH+D
Sbjct: 1   MNYRIIPVTAFSQNCSLIWCEQTRLAALVDPGGDAEKIKQEVDASGVTLMQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG A++L +   + +IGP K+D   +  +  Q+R+  +    +  + DRWL +GD + +
Sbjct: 61  HVGAASELAQHYGVPVIGPEKEDEFWLQGLPAQSRMFGLDEC-QPLTPDRWLSEGDRISV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGHV++ + ++     GD +F+  +GR+D   GD+ QLI+ I  K+
Sbjct: 120 GNVNLQVLHCPGHTPGHVVFFDEQSQLLISGDVIFKGGVGRSDFPRGDHNQLIDVIKRKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           LPLGD+++F+ GHGP ST+G ER  NPFL+  +
Sbjct: 180 LPLGDDVTFIPGHGPLSTLGYERLHNPFLQDEV 212


>gi|120555435|ref|YP_959786.1| beta-lactamase domain-containing protein [Marinobacter aquaeolei
           VT8]
 gi|120325284|gb|ABM19599.1| beta-lactamase domain protein [Marinobacter aquaeolei VT8]
          Length = 215

 Score =  189 bits (481), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 101/215 (46%), Positives = 138/215 (64%), Gaps = 2/215 (0%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           MS L + IV VTPF+QNCT L+  E+ +A VVDPGGDLD I    +     ++++ +TH 
Sbjct: 1   MS-LKYKIVPVTPFEQNCTLLWCTETHKAAVVDPGGDLDRILAAAEDEGVILEKVLLTHA 59

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DH GG A+L +   L I GPHKDD   +  +  QA++          + DRWL+DGDT
Sbjct: 60  HIDHAGGTAELAKSAGLPIEGPHKDDNFWIQGLAMQAQMFGF-PAPEVFTPDRWLEDGDT 118

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           + +G    +V H PGH+PGHV++ +  +  A +GD LF  SIGRTD   GDY  LI+SI 
Sbjct: 119 VTVGNETLEVLHTPGHTPGHVVFFHRGSKLAQVGDVLFNGSIGRTDFPKGDYNTLIHSIR 178

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLKSN 215
            K+ PLGD++SF+CGHGP ST G+ER  NPF+  +
Sbjct: 179 EKLFPLGDDVSFICGHGPMSTFGQERATNPFVSDH 213


>gi|88704531|ref|ZP_01102245.1| metallo-beta-lactamase superfamily protein [Congregibacter
           litoralis KT71]
 gi|88701582|gb|EAQ98687.1| metallo-beta-lactamase superfamily protein [Congregibacter
           litoralis KT71]
          Length = 216

 Score =  189 bits (481), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 94/212 (44%), Positives = 138/212 (65%), Gaps = 2/212 (0%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           MS +   IV VTP++QNC+ L  E S +A +VDPGGD D I   ++     V++I +THG
Sbjct: 1   MS-IKVTIVPVTPYQQNCSILKCESSGKAAIVDPGGDTDRILAAVEQLGASVEKIILTHG 59

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DH   +  L++ LS+ I GPH+DD   + K+ E  ++ +    A     DRWL  GDT
Sbjct: 60  HMDHCAASDLLRQQLSVPIEGPHEDDRFWIDKLPEWCKMANF-PVAEAFEPDRWLAAGDT 118

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           + +G    +VFHCPGH+PGHV++++     A +GD +F+ SIGRTD   G++ +LI SI 
Sbjct: 119 VTVGEQTLRVFHCPGHTPGHVVFLHDGQRLAWVGDVIFQGSIGRTDFPRGNHDELIASIR 178

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           + + PLGD+I+F+ GHGP ST G+ER+ NPF+
Sbjct: 179 STLFPLGDDITFIPGHGPTSTFGQERQSNPFV 210


>gi|157369971|ref|YP_001477960.1| beta-lactamase domain-containing protein [Serratia proteamaculans
           568]
 gi|157321735|gb|ABV40832.1| beta-lactamase domain protein [Serratia proteamaculans 568]
          Length = 215

 Score =  189 bits (481), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 92/211 (43%), Positives = 138/211 (65%), Gaps = 1/211 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + +HI+ VT F QNC+ ++ E + +A +VDPGG+ + +K  I  +   V QI +THGH+D
Sbjct: 1   MKYHIIPVTAFSQNCSLIWCESTQQAALVDPGGEPEKLKAEIARQGVTVTQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L E   + I GP K DA  +  +  Q+R+  +   A   +  +WL++GD++ +
Sbjct: 61  HVGAAAELAEFYQVPIYGPDKRDAFWLDGLPAQSRMFGLEECA-PLTPTQWLEEGDSVQV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    KV HCPGH+PGH++++N +   A +GD LF   +GR+D   GD+Q LINSI  K+
Sbjct: 120 GEMTLKVLHCPGHTPGHIVFINDQARLALVGDVLFNGGVGRSDFPQGDHQALINSIRTKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           LP GD+++F+ GHGP ST G+ER  NPFL+ 
Sbjct: 180 LPQGDDMAFIPGHGPMSTFGQERETNPFLRE 210


>gi|300702574|ref|YP_003744174.1| hypothetical protein RCFBP_10212 [Ralstonia solanacearum CFBP2957]
 gi|299070235|emb|CBJ41526.1| putative enzyme with metallo-hydrolase/oxidoreductase domain
           [Ralstonia solanacearum CFBP2957]
          Length = 218

 Score =  189 bits (480), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 92/213 (43%), Positives = 132/213 (61%), Gaps = 2/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +   +V VTPF+QNCT L  ++   A V DPGGD+D I    + +   +++I +THGHVD
Sbjct: 1   MKVVVVPVTPFEQNCTLLIGDD-GRAAVTDPGGDIDRILSAARQQGARIEKILLTHGHVD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H   A  L+  L + I GPH+D+A  + ++  Q++       AR    DRWL+DGDT+  
Sbjct: 60  HCAAADALRTQLGVPIEGPHRDEAFWIDQLPTQSQRFGFPP-ARAFVPDRWLEDGDTVEA 118

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
                +VFHCPGH+PGHV++ +  +  A +GD LF  SIGRTD   G++  LI SI  K+
Sbjct: 119 AGRTLEVFHCPGHTPGHVVFFSRPDRIAIVGDVLFAGSIGRTDFPRGNHADLIRSIRTKL 178

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            PLGD+++FV GHGP ST G ER  NP++  ++
Sbjct: 179 WPLGDDVTFVPGHGPVSTFGDERATNPYVADSL 211


>gi|254470479|ref|ZP_05083883.1| hydrolase [Pseudovibrio sp. JE062]
 gi|211960790|gb|EEA95986.1| hydrolase [Pseudovibrio sp. JE062]
          Length = 221

 Score =  189 bits (480), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 99/213 (46%), Positives = 144/213 (67%), Gaps = 1/213 (0%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           +S +   +V VT F+QNC+ ++++ + +AVVVDPGGD+D I   ++     V+ I ITHG
Sbjct: 10  LSGIQITVVPVTAFQQNCSIVWNKNTQKAVVVDPGGDVDHILAALKELGVTVEHILITHG 69

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DH+GGAA+L E L + +IGPH+ D  ++ +V++QA+   +    R    D+WL +GD 
Sbjct: 70  HIDHIGGAAELAETLGVKVIGPHEADRPLIDRVEDQAKQFGL-DAVRKVEPDQWLVEGDV 128

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           +  G   F+V HCPGH+PGHV++ N +   A  GD LF  SIGRTD+  GD+  LI SI 
Sbjct: 129 VTAGGAEFQVLHCPGHAPGHVVFYNTDLKLAISGDVLFAGSIGRTDLPGGDHDTLIASIK 188

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
            K+LPLGD+I+F+ GHGP S++G ER  NP+LK
Sbjct: 189 EKLLPLGDDITFLPGHGPASSLGHERLNNPYLK 221


>gi|327393349|dbj|BAK10771.1| metallo-beta-lactamase family protein YcbL [Pantoea ananatis
           AJ13355]
          Length = 209

 Score =  189 bits (480), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 90/210 (42%), Positives = 139/210 (66%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++HI+ VT F QNC+ ++ E + E+ +VDPGGD D I+  +   +    QI +THGH+D
Sbjct: 1   MNYHIIPVTAFAQNCSVIWCETTRESALVDPGGDADTIRQTLAQLDLKPAQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L     + ++GP K DA  +  +  Q+++  +   A   + DRWL++GDT+ +
Sbjct: 61  HVGAAAELAAFWQVPLVGPQKQDAFWLESLPTQSQMFGLEYCA-PLTPDRWLEEGDTVQV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGH+PGH+++ + +      GD +F   +GRTD   G++Q LI++INNK+
Sbjct: 120 GQVTLDVLHCPGHTPGHIVFFDAKGRLLVSGDVIFSGGVGRTDFPQGNHQHLIDAINNKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           LPLGD+++F+ GHGP ST+GRER  NPFL+
Sbjct: 180 LPLGDDVTFLPGHGPVSTLGRERLTNPFLQ 209


>gi|16125435|ref|NP_419999.1| glyoxalase II family protein [Caulobacter crescentus CB15]
 gi|221234178|ref|YP_002516614.1| Zn-dependent hydrolase [Caulobacter crescentus NA1000]
 gi|13422507|gb|AAK23167.1| glyoxalase II family protein [Caulobacter crescentus CB15]
 gi|220963350|gb|ACL94706.1| Zn-dependent hydrolase, glyoxalase II family [Caulobacter
           crescentus NA1000]
          Length = 273

 Score =  189 bits (480), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 100/207 (48%), Positives = 140/207 (67%), Gaps = 1/207 (0%)

Query: 10  QVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAA 69
            VTP +QNCT ++  ++L+A V+DPGG++D +   I  +   +++IWITHGH+DH GGAA
Sbjct: 48  PVTPLQQNCTIVWCAKTLKAAVIDPGGEVDRLLKAIADKGLTLEKIWITHGHMDHAGGAA 107

Query: 70  QLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFK 129
           +LK    + I GPHKDD   + ++ +   +      AR   +DRWL DGDT+ LG   F+
Sbjct: 108 ELKARTGVPIEGPHKDDQFWIDRIQDSGEMY-GMPEARIFVTDRWLDDGDTVTLGETEFE 166

Query: 130 VFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDE 189
           VFHCPGH+PGHV++ + E  FA +GD LF+ SIGRTD   G++Q LI+SI  K+ PLG++
Sbjct: 167 VFHCPGHTPGHVVFFHRETKFAQVGDVLFQGSIGRTDFPMGNHQDLIDSITQKLWPLGED 226

Query: 190 ISFVCGHGPNSTIGRERRLNPFLKSNI 216
           + FV GHGP ST G ERR NPF+   +
Sbjct: 227 VRFVPGHGPMSTFGAERRGNPFVGDRV 253


>gi|254282948|ref|ZP_04957916.1| beta-lactamase domain protein [gamma proteobacterium NOR51-B]
 gi|219679151|gb|EED35500.1| beta-lactamase domain protein [gamma proteobacterium NOR51-B]
          Length = 216

 Score =  189 bits (480), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 97/214 (45%), Positives = 141/214 (65%), Gaps = 2/214 (0%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           MS L+  IV VTPF+QNC+ +    S +  +VDPGGD++ ++  I+     V++I +THG
Sbjct: 1   MS-LAVTIVPVTPFQQNCSVVKCRSSGKLALVDPGGDIERLQSAIEQLGGEVEKILLTHG 59

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DHVG A  L+E L + I GPH+DD   + ++ E  R + +   A     DRWL+ GD 
Sbjct: 60  HLDHVGAAGLLREQLGVPIEGPHRDDLFWLDQLPENCRAMGL-PVADAFVPDRWLEGGDR 118

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           + +G    +V HCPGH+PGHV++V+ ++  A +GD LF  SIGR+D   G++ QL+ SI 
Sbjct: 119 VTVGDAEMQVLHCPGHTPGHVVFVHEDDKIAFVGDVLFAGSIGRSDFPRGNHDQLVASIR 178

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
            ++ PLGD+I+FV GHGPNST G+ERR NPF+  
Sbjct: 179 ERLFPLGDDITFVPGHGPNSTFGQERRTNPFVAD 212


>gi|94501877|ref|ZP_01308388.1| Zn-dependent Hydrolase, including glyoxylases [Oceanobacter sp.
           RED65]
 gi|94426010|gb|EAT11007.1| Zn-dependent Hydrolase, including glyoxylases [Oceanobacter sp.
           RED65]
          Length = 214

 Score =  189 bits (480), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 93/210 (44%), Positives = 133/210 (63%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L + IV VTPF+QNC+ ++  E+ EA VVDPGGDL +I+  +      VKQ+ +TH H+D
Sbjct: 3   LEYRIVPVTPFQQNCSIIWCSETKEAAVVDPGGDLHLIEQAVDDLGVQVKQVLLTHCHID 62

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H G    + E   + I+GP K++   +  + +QA + +    A++ S DRWL++GD + +
Sbjct: 63  HAGMTQDVSEKHQVPIVGPQKEEQFWIDMLPQQAAMFNFPQ-AKSFSPDRWLEEGDEVKV 121

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGH+PGHV++ N  +  A +GD LF   IGRTD   GD+Q LIN+I  K+
Sbjct: 122 GNETLSVLHCPGHTPGHVVFYNANSQLAIVGDVLFMGGIGRTDFPMGDHQTLINAIQQKL 181

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
             L +E  F+ GHGP STIG E+R NPF+K
Sbjct: 182 FALPEETQFIPGHGPMSTIGHEKRSNPFVK 211


>gi|207722180|ref|YP_002252617.1| beta-lactamase-like protein [Ralstonia solanacearum MolK2]
 gi|206587355|emb|CAQ17938.1| beta-lactamase-like protein [Ralstonia solanacearum MolK2]
          Length = 218

 Score =  189 bits (480), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 92/213 (43%), Positives = 132/213 (61%), Gaps = 2/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +   +V VTPF+QNCT L  ++   A V DPGGD+D I    + +   +++I +THGHVD
Sbjct: 1   MKVVVVPVTPFEQNCTLLIGDD-GSAAVTDPGGDIDRILSAARQQGARIEKILLTHGHVD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H   A  L+  L + I GPH+D+A  + ++  Q++       AR    DRWL+DGDT+  
Sbjct: 60  HCAAADALRTQLGVPIEGPHRDEAFWIDQLPTQSQRFGFPP-ARAFVPDRWLEDGDTVEA 118

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
                +VFHCPGH+PGHV++ +  +  A +GD LF  SIGRTD   G++  LI SI  K+
Sbjct: 119 AGCTLEVFHCPGHTPGHVVFFSRPDRIAIVGDVLFAGSIGRTDFPRGNHADLIRSIRTKL 178

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            PLGD+++FV GHGP ST G ER  NP++  ++
Sbjct: 179 WPLGDDVTFVPGHGPVSTFGDERATNPYVADSL 211


>gi|300689884|ref|YP_003750879.1| enzyme with metallo-hydrolase/oxidoreductase domain [Ralstonia
           solanacearum PSI07]
 gi|299076944|emb|CBJ49557.1| putative enzyme with metallo-hydrolase/oxidoreductase domain
           [Ralstonia solanacearum PSI07]
          Length = 218

 Score =  189 bits (479), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 93/211 (44%), Positives = 129/211 (61%), Gaps = 2/211 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +   +V VTPF+QNCT L  ++   A V DPGGD+D I    + +   +++I +THGHVD
Sbjct: 1   MKVVVVPVTPFEQNCTLLIGDD-GRAAVTDPGGDIDRILTAARQQGARIEKILLTHGHVD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H   A  L+  L + I GPHKD+A  + ++  Q++       AR    DRWL DGDT+  
Sbjct: 60  HCAAADALRAQLGVPIEGPHKDEAFWIDQLPAQSQRFGFPP-ARAFVPDRWLDDGDTVEA 118

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
                +VFHCPGH+PGHV++ +  +  A +GD LF  SIGRTD   G++  LI SI  K+
Sbjct: 119 AGRTLEVFHCPGHTPGHVVFFSRPDRIAIVGDVLFAGSIGRTDFPRGNHADLIRSIRTKL 178

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
            PLGD+++FV GHGP ST G ER  NP++  
Sbjct: 179 WPLGDDVTFVPGHGPVSTFGEERATNPYVAD 209


>gi|183598379|ref|ZP_02959872.1| hypothetical protein PROSTU_01771 [Providencia stuartii ATCC 25827]
 gi|188020555|gb|EDU58595.1| hypothetical protein PROSTU_01771 [Providencia stuartii ATCC 25827]
          Length = 215

 Score =  189 bits (479), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 93/213 (43%), Positives = 140/213 (65%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++ I+ VTPF+QNC  ++DE ++EAV+VDPGG+ + +   I+ R   + +I +THGH D
Sbjct: 1   MNYMIIPVTPFQQNCQVIWDENTMEAVIVDPGGEAEKLIAAIEERGLKLTKILLTHGHAD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G  A + +  S  I GP K+DA  +  + EQ  + +I     + + D WL++G T+  
Sbjct: 61  HIGATAIISKHFSAPIYGPQKEDAFWIEALAEQHAMFNI-EGGPSFTPDYWLEEGQTVHC 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           GT  F V HCPGH+PGH+I+VN  +    +GD LF+  +GR+D   GD+Q LI SI NK+
Sbjct: 120 GTMAFDVLHCPGHTPGHIIFVNHADKLISMGDVLFKGGVGRSDFPRGDHQALIASIKNKV 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           LPLGD+  F+ GHGP S +G ER+ NPFL+ ++
Sbjct: 180 LPLGDDYQFIPGHGPMSDLGHERKTNPFLQDDL 212


>gi|304312538|ref|YP_003812136.1| Metallo-beta-lactamase family protein [gamma proteobacterium HdN1]
 gi|301798271|emb|CBL46493.1| Metallo-beta-lactamase family protein [gamma proteobacterium HdN1]
          Length = 220

 Score =  189 bits (479), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 97/209 (46%), Positives = 138/209 (66%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L F +V VTP++QNCT L+ +E+L+A VVDPGGDLD +  V +     V++I +TH H+D
Sbjct: 8   LKFQVVPVTPYEQNCTVLWCDETLKAAVVDPGGDLDRVLAVCKKHGVQVEKILLTHPHID 67

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H G AA L E L + I GP K D   +  + +Q  ++     A+  + DRWL+DGD + +
Sbjct: 68  HAGAAATLAEKLGVPIEGPQKADLFWIQGLPQQ-SVMMRFPPAKLFTPDRWLEDGDQVSV 126

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G  +F V HCPGH+PGHV++   +   A +GD LF  SIGRTD   G+++ L++SI  K+
Sbjct: 127 GNVVFDVIHCPGHTPGHVVFYQPDAKLALVGDVLFNGSIGRTDFPLGNFESLVHSIRQKL 186

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
            PLGD+I+F+ GHGP ST G ER+ NPF+
Sbjct: 187 FPLGDDIAFIPGHGPMSTFGHERKTNPFV 215


>gi|71906480|ref|YP_284067.1| Beta-lactamase-like [Dechloromonas aromatica RCB]
 gi|71846101|gb|AAZ45597.1| Beta-lactamase-like protein [Dechloromonas aromatica RCB]
          Length = 213

 Score =  189 bits (479), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 91/209 (43%), Positives = 131/209 (62%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + IV VTPF+QNCT  + E + +A V+DPGGD++ I  +++     + +I +THGH+D
Sbjct: 1   MRYAIVPVTPFEQNCTVFWCENTRQAAVIDPGGDVERILRLLEDEKLTLAKILVTHGHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GG A L E   + I GPH++D   +  + +Q+++     N R+    RWL  GD +  
Sbjct: 61  HAGGVAVLAEQTGVPIEGPHEEDRFWIEGMPQQSKMFGF-PNVRSFEPTRWLNAGDKVTF 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGH+PGHV++ +  +  A +GD LF+ SIGRTD   GDY  LI SI  ++
Sbjct: 120 GEVELDVLHCPGHTPGHVVFFHAPSRLAQVGDVLFQGSIGRTDFPRGDYDTLIRSITEQL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
            PLGD++ F+ GHGP ST G ER+ NPFL
Sbjct: 180 FPLGDDVDFIPGHGPMSTFGEERKYNPFL 208


>gi|86747841|ref|YP_484337.1| Beta-lactamase-like [Rhodopseudomonas palustris HaA2]
 gi|86570869|gb|ABD05426.1| Beta-lactamase-like [Rhodopseudomonas palustris HaA2]
          Length = 222

 Score =  189 bits (479), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 103/209 (49%), Positives = 143/209 (68%), Gaps = 1/209 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           I+ VTPF+QNCT L+ E + +AVVVDPGGD+  I   I+     V++IW+THGH+DHVGG
Sbjct: 15  IIPVTPFQQNCTLLWCEATRKAVVVDPGGDVPEILAAIEKTGVSVEKIWLTHGHIDHVGG 74

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           AA+L++ L + I GPH+DD  ++  V    R   I    R+ ++DRWL  GD++ +G   
Sbjct: 75  AAELRDALKVPIEGPHRDDQFLLDNVVASGRSFGI-AGVRDVTTDRWLDQGDSVSVGELT 133

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
           F++ HCPGHSPG V++ N    FA +GD LF  S+GRTD+  G +  LI SI +K+LPLG
Sbjct: 134 FQILHCPGHSPGSVVFFNEAMRFALVGDVLFAGSVGRTDLPGGSHATLIRSITDKLLPLG 193

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           D++ F+CGHGP S+IG+ER  NPFL   +
Sbjct: 194 DDVGFICGHGPGSSIGQERMTNPFLTGAM 222


>gi|120598397|ref|YP_962971.1| beta-lactamase domain-containing protein [Shewanella sp. W3-18-1]
 gi|146293524|ref|YP_001183948.1| beta-lactamase domain-containing protein [Shewanella putrefaciens
           CN-32]
 gi|120558490|gb|ABM24417.1| beta-lactamase domain protein [Shewanella sp. W3-18-1]
 gi|145565214|gb|ABP76149.1| beta-lactamase domain protein [Shewanella putrefaciens CN-32]
 gi|319426829|gb|ADV54903.1| beta-lactamase domain-containing protein [Shewanella putrefaciens
           200]
          Length = 214

 Score =  189 bits (479), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 88/213 (41%), Positives = 134/213 (62%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + I+ VTPF+QNC+ ++ E++  A VVDPGG++D I+  +  R   +++I +THGH+D
Sbjct: 1   MKYQIIPVTPFQQNCSLIWCEKTKLAAVVDPGGNIDRIQAEVAKRGLTLEKILLTHGHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVGGA  L +  ++ IIGPH  D   +  + +Q++              ++LQDGD + +
Sbjct: 61  HVGGAKSLAQSANIPIIGPHIADKFWIDNLPKQSQNFGFPHC-DAFEPAQYLQDGDIVKV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGH+PGH+ + + ++  A +GD LFRSSIGRTD    ++Q LI+SI  K+
Sbjct: 120 GEQSLSVLHCPGHTPGHIAFYSAQSKLAWVGDILFRSSIGRTDFPQSNHQDLIHSITEKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            PLG ++ F+ GHGP ST G ER  NPF+   +
Sbjct: 180 WPLGADVEFIPGHGPLSTFGEEREHNPFVADQL 212


>gi|262280805|ref|ZP_06058588.1| metallo-beta-lactamase superfamily protein [Acinetobacter
           calcoaceticus RUH2202]
 gi|262257705|gb|EEY76440.1| metallo-beta-lactamase superfamily protein [Acinetobacter
           calcoaceticus RUH2202]
          Length = 214

 Score =  189 bits (479), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 86/209 (41%), Positives = 129/209 (61%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L   IV VT F QNC+ ++D E+ EAV++D GGD  ++K  +++    VK +W+THGH+D
Sbjct: 2   LQVKIVPVTAFAQNCSLVWDSETKEAVLIDAGGDAAVLKKEVEALGLKVKALWLTHGHLD 61

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H G   +L ++ S+ +IGPHK+D   +  + E +         +    D+WL+ G+ L L
Sbjct: 62  HAGAVGELAKEWSVPVIGPHKEDQFWLDMIQEVSARYGF-PIPQPVKVDQWLEGGEVLKL 120

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   F+V   PGH+PGHV++ N ++     GD LF+ SIGRTD   G+++QLI SI  + 
Sbjct: 121 GEDEFEVRFAPGHTPGHVVFYNKKHGLLWTGDVLFKGSIGRTDFPRGNHEQLIESIKREC 180

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
             L D+  F+ GHGP STIG E++ NPF+
Sbjct: 181 FSLPDDTQFISGHGPMSTIGYEKQFNPFV 209


>gi|114706406|ref|ZP_01439308.1| HYDROXYACYLGLUTATHIONE HYDROLASE [Fulvimarina pelagi HTCC2506]
 gi|114538267|gb|EAU41389.1| HYDROXYACYLGLUTATHIONE HYDROLASE [Fulvimarina pelagi HTCC2506]
          Length = 215

 Score =  188 bits (478), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 105/212 (49%), Positives = 145/212 (68%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M++L+  I+ VT F+QNCT LFD+E+   VVVDPGG+ + I+  +++    V+ IW+THG
Sbjct: 1   MAQLNAQIIPVTEFQQNCTLLFDDETKTGVVVDPGGEAEKIESAVKAAGVTVEAIWLTHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DH GGA +LKE L + IIG HKDD  +M  + EQ ++  +R   RN + DRWL +GD 
Sbjct: 61  HIDHAGGAMELKELLGVDIIGSHKDDKLLMDNLAEQGKMFGLRNEIRNCTPDRWLDEGDR 120

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           +    H F+V H PGH+PGHVI+      F  +GD LF  SIGRTD+  G+++ L+ SI 
Sbjct: 121 VSFAGHEFEVLHTPGHAPGHVIFAYRAAKFIVMGDVLFNGSIGRTDLPGGNHETLLASIR 180

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           +K+LPLGD+  F+CGHGP S +G ERR NPFL
Sbjct: 181 DKVLPLGDDFGFLCGHGPGSRLGDERRSNPFL 212


>gi|207744751|ref|YP_002261143.1| beta-lactamase-like protein [Ralstonia solanacearum IPO1609]
 gi|206596161|emb|CAQ63088.1| beta-lactamase-like protein [Ralstonia solanacearum IPO1609]
          Length = 218

 Score =  188 bits (478), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 92/213 (43%), Positives = 132/213 (61%), Gaps = 2/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +   +V VTPF+QNCT L  ++   A V DPGGD+D I    + +   +++I +THGHVD
Sbjct: 1   MKVVVVPVTPFEQNCTLLIGDD-GSAAVTDPGGDIDRILSAARQQGARIEKILLTHGHVD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H   A  L+  L + I GPH+D+A  + ++  Q++       AR    DRWL+DGDT+  
Sbjct: 60  HCAAADALRTQLGVPIEGPHRDEAFWIDQLPTQSQRFGFPP-ARAFVPDRWLEDGDTVEA 118

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
                +VFHCPGH+PGHV++ +  +  A +GD LF  SIGRTD   G++  LI SI  K+
Sbjct: 119 AGRTLEVFHCPGHTPGHVVFFSRPDRIAIVGDVLFAGSIGRTDFPRGNHADLIRSIRTKL 178

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            PLGD+++FV GHGP ST G ER  NP++  ++
Sbjct: 179 WPLGDDVTFVPGHGPVSTFGDERATNPYVADSL 211


>gi|288941205|ref|YP_003443445.1| hypothetical protein Alvin_1479 [Allochromatium vinosum DSM 180]
 gi|288896577|gb|ADC62413.1| conserved hypothetical protein [Allochromatium vinosum DSM 180]
          Length = 210

 Score =  188 bits (478), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 94/209 (44%), Positives = 137/209 (65%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + F I+ VT F+QNCT L+   +  A +VDPGG+ D I+ ++       ++I +THGH+D
Sbjct: 1   MEFQILPVTGFQQNCTLLWCARTRRAAIVDPGGEPDRIEALLSQLELEPERILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG +A+L + L++ I GPH DDA +   + EQ R+      A     DRWLQ GD + +
Sbjct: 61  HVGASAELAQRLAIPIEGPHPDDAFLFQSLPEQCRMFGFPPVAV-FEPDRWLQHGDRIAV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGH+++   E+  A +GD LFR SIGRTD   G+++QL++SI +++
Sbjct: 120 GDESLEVIHCPGHTPGHIVFHQAESQLAQVGDVLFRGSIGRTDFPRGNHRQLLDSIRHRL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
            PLGD + F+ GHGP ST G+ERR NPF+
Sbjct: 180 FPLGDAVRFIPGHGPMSTFGKERRSNPFV 208


>gi|113869519|ref|YP_728008.1| hydroxyacylglutathione hydrolase [Ralstonia eutropha H16]
 gi|113528295|emb|CAJ94640.1| hydroxyacylglutathione hydrolase [Ralstonia eutropha H16]
          Length = 216

 Score =  188 bits (478), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 93/213 (43%), Positives = 140/213 (65%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +   ++ VTPF+QNC+ L DE +  A V DPGGDLD I++ ++ +   +++I++THGHVD
Sbjct: 1   MKALLIPVTPFQQNCSLLIDESTGRAAVCDPGGDLDRIREAVREQGVTLEKIFLTHGHVD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H  GAA L  +L + I GP +D+   + ++ EQ R       A +   DRWL++GDT+  
Sbjct: 61  HCAGAAALARELDIPIEGPQQDERFWIEQLPEQTRRFGFGH-AESFEPDRWLENGDTVQF 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V+HCPGH+PGHV++ +  N  A +GD LF  SIGRTD+  G++  LI SI  ++
Sbjct: 120 GNETLEVYHCPGHTPGHVVFFSRANRLAVVGDVLFAGSIGRTDLPRGNHADLIRSIRTRL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            PLG++++F+ GHGP ST G ERR NPF+  ++
Sbjct: 180 WPLGEDVTFIPGHGPVSTFGVERRNNPFVADHL 212


>gi|293396752|ref|ZP_06641028.1| metallo-beta-lactamase [Serratia odorifera DSM 4582]
 gi|291421016|gb|EFE94269.1| metallo-beta-lactamase [Serratia odorifera DSM 4582]
          Length = 215

 Score =  188 bits (478), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 92/211 (43%), Positives = 140/211 (66%), Gaps = 1/211 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++ I+ VT F QNCT ++ +E+ +A +VDPGG+ + ++  +      + QI +THGH+D
Sbjct: 1   MNYKIIPVTAFSQNCTLIWCDETRQAALVDPGGEAEKLQAAVAEAGVTLTQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L E   + I GP K+DA  +  +  Q+R+  +   A   +  RWL +GDT+ +
Sbjct: 61  HVGAAAELAEHYQVPIYGPDKEDAFWLDGLPAQSRMFGLEECA-PLTPTRWLAEGDTVQV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    KV HCPGH+PGH++++N E   A +GD LF   +GRTD   GD+Q LIN+I++K+
Sbjct: 120 GAMTLKVLHCPGHTPGHIVFINDEARLALVGDVLFNGGVGRTDFPRGDHQALINAIHSKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           LP GD+++F+ GHGP ST G+ER  NPFL+ 
Sbjct: 180 LPQGDDMAFIPGHGPMSTFGQERLHNPFLRE 210


>gi|304391313|ref|ZP_07373257.1| beta-lactamase domain-containing protein [Ahrensia sp. R2A130]
 gi|303296669|gb|EFL91025.1| beta-lactamase domain-containing protein [Ahrensia sp. R2A130]
          Length = 213

 Score =  188 bits (478), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 105/212 (49%), Positives = 146/212 (68%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M KL+  IV VT F+QNCT ++D ++   VV+DPGGD+  I+  I+     V+ IW+THG
Sbjct: 1   MGKLNIQIVPVTAFQQNCTLIWDADTNTGVVIDPGGDVGKIRKAIEDSGIKVEAIWLTHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DH GGA  LK+ L + IIGPH+ D  ++ ++++QA++  +    RN + DRWL  G+T
Sbjct: 61  HIDHAGGAMDLKDALGIDIIGPHEADIPLLSQLEKQAQMFGLDDEVRNVTPDRWLTSGET 120

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           L +G H F V HCPGH+PGHV++ N  N FAH+GD LF  SIGRTD+  GD++ L+NSI 
Sbjct: 121 LSIGEHDFTVSHCPGHAPGHVVFYNEANGFAHVGDVLFAGSIGRTDLPGGDHETLLNSIR 180

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
             ++   DE+ F+CGHG  STIG+ER  NPFL
Sbjct: 181 TVLMEWPDEVQFMCGHGAPSTIGQERASNPFL 212


>gi|238753521|ref|ZP_04614884.1| hypothetical protein yruck0001_20510 [Yersinia ruckeri ATCC 29473]
 gi|238708474|gb|EEQ00829.1| hypothetical protein yruck0001_20510 [Yersinia ruckeri ATCC 29473]
          Length = 215

 Score =  188 bits (478), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 91/209 (43%), Positives = 138/209 (66%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + +HI+ VT F QNCT ++ E +  A +VDPGGD + I   +      V Q+ +THGH+D
Sbjct: 1   MKYHIIPVTAFSQNCTLIWCETTSLAALVDPGGDAEKIIAEVSRMGVTVTQLLLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L E   + I+GP K+D   +  +  Q+R+  +    ++    RWL++GD + +
Sbjct: 61  HVGAAAELAEFYQVPILGPEKEDRFWLEGLPAQSRMFGLSEC-QSFEPTRWLEEGDEVSV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGH+PGH++++N ++  A  GD +F+  +GR+D   GD+QQLINSI NK+
Sbjct: 120 GNMRLSVLHCPGHTPGHIVFINQDDRLALTGDVIFKGGVGRSDFPRGDHQQLINSIRNKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           LPLGD+++F+ GHGP ST+G ER+ NPF+
Sbjct: 180 LPLGDDMAFIPGHGPMSTMGHERQTNPFI 208


>gi|330829589|ref|YP_004392541.1| metallo-beta-lactamase family protein [Aeromonas veronii B565]
 gi|328804725|gb|AEB49924.1| Metallo-beta-lactamase family protein [Aeromonas veronii B565]
          Length = 214

 Score =  188 bits (478), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 92/209 (44%), Positives = 133/209 (63%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L F ++ VT F QNC+ ++ +E+ +A ++DPGG+ D +   I  R   +  I +THGH+D
Sbjct: 2   LKFEVIPVTQFAQNCSLIWCDETHQAALIDPGGEADKLLTAIAKRGLTLTHILLTHGHLD 61

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L+E   + I GPHK+D   +  + +Q+++     +    + DRWL+ GD + L
Sbjct: 62  HVGAAAELREKTGVAITGPHKEDTFWLDMLPQQSQMFGF-AHTPAFTPDRWLEQGDKVQL 120

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V+ CPGH+PGH++ +N     A +GD LF  SIGRTD   GD+  LI SIN  +
Sbjct: 121 GQCELDVYFCPGHTPGHIVLLNQAEKLAWVGDVLFAGSIGRTDFPRGDHGTLIKSINETL 180

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           LPLGDEI F+ GHGP+ST GRE+  NP+L
Sbjct: 181 LPLGDEIVFIPGHGPSSTFGREKVSNPYL 209


>gi|299771735|ref|YP_003733761.1| Metallo-beta-lactamase superfamily protein [Acinetobacter sp. DR1]
 gi|298701823|gb|ADI92388.1| Metallo-beta-lactamase superfamily protein [Acinetobacter sp. DR1]
          Length = 214

 Score =  188 bits (477), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 87/209 (41%), Positives = 128/209 (61%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L   IV VT F QNC+ ++D E+ EAV++D GGD  ++K  +++    VK +W+THGH+D
Sbjct: 2   LQVKIVPVTAFAQNCSLVWDSETKEAVLIDAGGDAAVLKKEVEALGLKVKALWLTHGHLD 61

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H G   +L ++ S+ +IGPHK+D   +  + E +         +    D+WL+ G+ L L
Sbjct: 62  HAGAVGELAKEWSVPVIGPHKEDQFWLDMIQEVSARYGF-PIPQPVKVDQWLEGGEVLKL 120

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   F+V   PGH+PGHVI+ N  +     GD LF+ SIGRTD   G+++QLI SI  + 
Sbjct: 121 GEDEFEVRFAPGHTPGHVIFYNKNHGLLWTGDVLFKGSIGRTDFPRGNHEQLIESIKREC 180

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
             L D+  F+ GHGP STIG E++ NPF+
Sbjct: 181 FSLPDDTQFISGHGPMSTIGYEKQFNPFV 209


>gi|259908905|ref|YP_002649261.1| Putative metallo-beta-lactamase [Erwinia pyrifoliae Ep1/96]
 gi|224964527|emb|CAX56037.1| Putative metallo-beta-lactamase [Erwinia pyrifoliae Ep1/96]
 gi|283478900|emb|CAY74816.1| Uncharacterized protein M6_Spy0554 [Erwinia pyrifoliae DSM 12163]
          Length = 209

 Score =  188 bits (477), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 93/210 (44%), Positives = 138/210 (65%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++HI+ VT F QNC+ ++  E+ EA +VDPGGD   I+  I      VKQI +THGH+D
Sbjct: 1   MNYHIIPVTAFAQNCSVIWCPETGEAALVDPGGDAHKIRHEIAGLGITVKQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L E   + ++GPH+ D   +  + +Q+++      A  A  DRWLQ+G+ + +
Sbjct: 61  HVGAAAELAEHYGVPVVGPHRADKFWLDGLPQQSQMFGFDECAPLA-PDRWLQEGEVVHV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G  + +V  CPGH+PGH+++ + E      GD +F   +GR+D   G +QQLI SI NK+
Sbjct: 120 GNTVLEVLLCPGHTPGHIVFFDREGRLLVSGDVIFSGGVGRSDFPQGSHQQLIASILNKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           LPLGD+++F+ GHGP ST+GRER  NPFL+
Sbjct: 180 LPLGDDVTFIAGHGPMSTLGRERISNPFLQ 209


>gi|330445735|ref|ZP_08309387.1| metallo-beta-lactamase superfamily protein [Photobacterium
           leiognathi subsp. mandapamensis svers.1.1.]
 gi|328489926|dbj|GAA03884.1| metallo-beta-lactamase superfamily protein [Photobacterium
           leiognathi subsp. mandapamensis svers.1.1.]
          Length = 217

 Score =  188 bits (477), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 95/216 (43%), Positives = 138/216 (63%), Gaps = 2/216 (0%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           MS L + IV VTPF+QNC+ ++ +E+ +A +VDPGGD++ +K V++     V Q+ +THG
Sbjct: 1   MS-LKYQIVPVTPFQQNCSIIWCDETNQAAIVDPGGDVEQLKKVVEELGVTVTQLILTHG 59

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DHVGG   L E L++ +IGPHKDD   +  +  Q+ +             +WL+DGD 
Sbjct: 60  HLDHVGGTEPLAEALNVPVIGPHKDDVFWLQGLPRQSEMFGF-PMTEAFDPTQWLEDGDE 118

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           + +G    +VFH PGH+PGHV+  N +   A +GD LF+  IGRTD   GD+  LIN+I 
Sbjct: 119 IKVGNQTLQVFHTPGHTPGHVVLFNDDAKIAFVGDVLFKGGIGRTDFPRGDHPTLINAIK 178

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            K+ PLG++++FV GHGP ST G ER  NPF+   +
Sbjct: 179 TKLWPLGNDVTFVPGHGPLSTFGHERATNPFVADEM 214


>gi|329298734|ref|ZP_08256070.1| hypothetical protein Pstas_23584 [Plautia stali symbiont]
          Length = 209

 Score =  188 bits (477), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 87/210 (41%), Positives = 133/210 (63%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++ I+ VT F QNC+ ++D+E+ +A +VDPGGD + I   +  R     QI +THGH+D
Sbjct: 1   MNYLIIPVTAFSQNCSVIWDDETQQAALVDPGGDAETIIAELAERGLTPSQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L +   + I+GP   DA  +  +  Q+R+  +   A   + DRWL++G+T+ L
Sbjct: 61  HVGAAAELAQHYQVPIVGPQPADAFWLDNLPTQSRMFGLPECA-PLTPDRWLEEGETVQL 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+ GH+++ +        GD +F   +GRTD   G +  LI +I +K+
Sbjct: 120 GNVTLEVLHCPGHTLGHIVFFDRAGRLLISGDVIFNGGVGRTDFPQGSHSDLIAAIRDKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           LPLGD+++FV GHGP ST+G ER  NPFL+
Sbjct: 180 LPLGDDVTFVPGHGPISTLGHERVSNPFLQ 209


>gi|325124355|gb|ADY83878.1| enzyme with metallo-hydrolase/oxidoreductase domain [Acinetobacter
           calcoaceticus PHEA-2]
          Length = 214

 Score =  188 bits (477), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 86/209 (41%), Positives = 127/209 (60%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L   IV VT F QNC+ ++D E+ EAV++D GGD  ++K  +++    VK +W+THGH+D
Sbjct: 2   LQVKIVPVTAFAQNCSLVWDSETKEAVLIDAGGDASVLKKEVEALGLKVKALWLTHGHLD 61

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H G   +L ++ ++ +IGPHK+D   +  + E +         +    D+WL+ G+ L L
Sbjct: 62  HAGAVGELAKEWNVPVIGPHKEDQFWLDMIQEVSARYGF-PIPQPVKVDQWLEGGEVLKL 120

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   F+V   PGH+PGHVI+ N  +     GD LF+ SIGRTD   G++ QLI SI  + 
Sbjct: 121 GEDEFEVRFAPGHTPGHVIFYNKNHGLLWTGDVLFKGSIGRTDFPRGNHDQLIESIKREC 180

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
             L D+  F+ GHGP STIG E++ NPF+
Sbjct: 181 FSLPDDTQFISGHGPMSTIGYEKQFNPFV 209


>gi|332527474|ref|ZP_08403528.1| beta-lactamase domain-containing protein [Rubrivivax
           benzoatilyticus JA2]
 gi|332111883|gb|EGJ11861.1| beta-lactamase domain-containing protein [Rubrivivax
           benzoatilyticus JA2]
          Length = 212

 Score =  188 bits (477), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 95/211 (45%), Positives = 133/211 (63%), Gaps = 1/211 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L +  V VTPF+QNC+ L+ +E+ EA V+DPGGD+  I   +Q  +   + I +TH H+D
Sbjct: 2   LQYRTVPVTPFQQNCSILWCDETREAAVLDPGGDVPAILAALQRLDVVPRLILLTHAHID 61

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GGA +L  +LSL I+GPH+ D   +  + +QA +      A      RWL+DGDT+ +
Sbjct: 62  HAGGAGRLARELSLPIVGPHEGDRFWIDGLAQQAAMFGFPA-AEPFVPARWLKDGDTVAV 120

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGH+PGHV++ + E   A +GD LF  SIGRTD   GD+  LI+SI  ++
Sbjct: 121 GRSALAVRHCPGHTPGHVVFHSAEAKRAFVGDVLFAGSIGRTDFPGGDHATLIDSIVQRL 180

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
            P+GD+  FV GHGP ST G ERR NP+++ 
Sbjct: 181 WPMGDDTVFVPGHGPESTFGDERRHNPYVRG 211


>gi|89073967|ref|ZP_01160473.1| hypothetical glyoxylase II family protein [Photobacterium sp.
           SKA34]
 gi|89050295|gb|EAR55799.1| hypothetical glyoxylase II family protein [Photobacterium sp.
           SKA34]
          Length = 217

 Score =  188 bits (477), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 95/216 (43%), Positives = 136/216 (62%), Gaps = 2/216 (0%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           MS L + IV VTPF+QNC+ ++ +E+ +A +VDPGGD++ +  V+      V Q+ +THG
Sbjct: 1   MS-LKYQIVPVTPFQQNCSIIWCDETNQAAIVDPGGDIEQLTKVVDELGLTVTQLILTHG 59

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DHVGG A L + L++ +IGPHKDD   +  +  Q+ +             +WL DGD 
Sbjct: 60  HLDHVGGTAPLSQSLNVPVIGPHKDDEFWLQGLPRQSEMFGF-PMTEAFEPTQWLNDGDK 118

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           + +G    +V H PGH+PGHVI  + + N A +GD LF+  IGRTD   GD+  LIN+I 
Sbjct: 119 INVGNQTLQVLHTPGHTPGHVILFSSDANVAFVGDVLFKGGIGRTDFPRGDHPTLINAIK 178

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            K+ PLGD+++FV GHGP ST G ER  NPF+   +
Sbjct: 179 TKLWPLGDDVTFVPGHGPLSTFGHERATNPFVADEM 214


>gi|293610180|ref|ZP_06692481.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292827412|gb|EFF85776.1| conserved hypothetical protein [Acinetobacter sp. SH024]
          Length = 214

 Score =  187 bits (476), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 86/209 (41%), Positives = 127/209 (60%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L   IV VT F QNC+ ++D E+ EAV++D GGD  ++K  +++    VK +W+THGH+D
Sbjct: 2   LQVKIVPVTAFAQNCSLVWDSETKEAVLIDAGGDAAVLKKEVEALGLKVKALWLTHGHLD 61

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H G   +L ++ S+ +IGPHK+D   +  + E +         +    D+WL+ G+ L L
Sbjct: 62  HAGAVGELAKEWSVPVIGPHKEDQFWLDMIQEVSARYGF-PIPQPVKVDQWLEGGEVLKL 120

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   F+V   PGH+PGHV++ N  +     GD LF+ SIGRTD   G++ QLI SI  + 
Sbjct: 121 GEDEFEVRFAPGHTPGHVVFYNKNHGLLWTGDVLFKGSIGRTDFPRGNHDQLIESIKREC 180

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
             L D+  F+ GHGP STIG E++ NPF+
Sbjct: 181 FSLPDDTQFISGHGPMSTIGYEKQFNPFV 209


>gi|169797363|ref|YP_001715156.1| putative enzyme [Acinetobacter baumannii AYE]
 gi|213155823|ref|YP_002317867.1| beta-lactamase domain protein [Acinetobacter baumannii AB0057]
 gi|301345464|ref|ZP_07226205.1| beta-lactamase domain protein [Acinetobacter baumannii AB056]
 gi|301511094|ref|ZP_07236331.1| beta-lactamase domain protein [Acinetobacter baumannii AB058]
 gi|301596666|ref|ZP_07241674.1| beta-lactamase domain protein [Acinetobacter baumannii AB059]
 gi|169150290|emb|CAM88187.1| putative enzyme [Acinetobacter baumannii AYE]
 gi|213054983|gb|ACJ39885.1| beta-lactamase domain protein [Acinetobacter baumannii AB0057]
          Length = 214

 Score =  187 bits (476), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 86/209 (41%), Positives = 127/209 (60%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L   IV VT F QNC+ ++D E+ EAV++D GGD  ++K  +++    VK +W+THGH+D
Sbjct: 2   LQVKIVPVTAFAQNCSLVWDSETKEAVLIDAGGDAAVLKKEVEALGLKVKALWLTHGHLD 61

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H G   +L +  S+ ++GPHK+D   +  + E +         +    D+WL+ G+ L L
Sbjct: 62  HAGAVGELAKQWSVPVVGPHKEDQFWLDMIQEVSARYGF-PIPQPVKVDQWLEGGEVLKL 120

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   F+V   PGH+PGHV++ N  +     GD LF+ SIGRTD   G+++QLI SI  + 
Sbjct: 121 GEDEFEVRFAPGHTPGHVMFYNKNHGLLWTGDVLFKGSIGRTDFPRGNHEQLIESIQREC 180

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
             L DE  F+ GHGP STIG E++ NPF+
Sbjct: 181 FSLPDETQFISGHGPMSTIGYEKQFNPFV 209


>gi|16759866|ref|NP_455483.1| hypothetical protein STY0999 [Salmonella enterica subsp. enterica
           serovar Typhi str. CT18]
 gi|29142361|ref|NP_805703.1| hypothetical protein t1937 [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|213160798|ref|ZP_03346508.1| hypothetical protein Salmoneentericaenterica_12368 [Salmonella
           enterica subsp. enterica serovar Typhi str. E00-7866]
 gi|213581707|ref|ZP_03363533.1| hypothetical protein SentesTyph_11074 [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-0664]
 gi|213620685|ref|ZP_03373468.1| hypothetical protein SentesTyp_25617 [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-2068]
 gi|213650526|ref|ZP_03380579.1| hypothetical protein SentesTy_26783 [Salmonella enterica subsp.
           enterica serovar Typhi str. J185]
 gi|213852478|ref|ZP_03382010.1| hypothetical protein SentesT_06134 [Salmonella enterica subsp.
           enterica serovar Typhi str. M223]
 gi|289825303|ref|ZP_06544575.1| hypothetical protein Salmonellentericaenterica_07921 [Salmonella
           enterica subsp. enterica serovar Typhi str. E98-3139]
 gi|25311010|pir||AC0616 conserved hypothetical protein ycbL [imported] - Salmonella
           enterica subsp. enterica serovar Typhi (strain CT18)
 gi|16502159|emb|CAD05397.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Typhi]
 gi|29137991|gb|AAO69552.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
          Length = 215

 Score =  187 bits (476), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 85/213 (39%), Positives = 138/213 (64%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++ I+ VT F QNC+ ++ E++  A +VDPGGD + IK  + +    + QI +THGH+D
Sbjct: 1   MNYRIIPVTAFSQNCSLIWCEQTRLAALVDPGGDAEKIKQEVDASGVTLMQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG A++L +   + +IGP K+D   +  +  Q+R+  +    +  + DRWL DGD + +
Sbjct: 61  HVGAASELAQHYGVPVIGPEKEDEFWLQGLPAQSRMFGLDEC-QPLTPDRWLNDGDRVSV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGHV++ + ++     GD +F+  +GR+D   GD+ QLI++I  K+
Sbjct: 120 GNVTLQVLHCPGHTPGHVVFFDEQSQLLISGDVIFKGGVGRSDFPRGDHTQLIDAIKRKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           LPLGD+++F+ GHGP ST+G ER  N FL+  +
Sbjct: 180 LPLGDDVTFIPGHGPLSTLGYERLHNSFLQDEM 212


>gi|83648380|ref|YP_436815.1| Zn-dependent hydrolase [Hahella chejuensis KCTC 2396]
 gi|83636423|gb|ABC32390.1| Zn-dependent Hydrolase, including glyoxylases [Hahella chejuensis
           KCTC 2396]
          Length = 210

 Score =  187 bits (476), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 94/211 (44%), Positives = 133/211 (63%), Gaps = 1/211 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + IV VTPF QNCT L+ E++ +A VVDPGGDL  I+ V+      ++++ +TH H+D
Sbjct: 1   MKYEIVPVTPFVQNCTVLWCEKTRQAAVVDPGGDLAKIEAVLSRNGLTLEKVLLTHAHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GG A+L E   + I GP  +D   +  + +Q+ +      A+  + DRWL +GD + +
Sbjct: 61  HAGGTAELAEAHEIPIEGPEYEDKFWIDALPQQSMMFGFPT-AKQFTPDRWLNEGDEVSV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGHVI+ +     A +GD LF  SIGRTD   GD+  LI SI  K+
Sbjct: 120 GEETLQVLHCPGHTPGHVIFFHQGARLALVGDVLFNGSIGRTDFPKGDHATLIQSIKTKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
            PLGD++SF+ GHGP ST G ER+ NPF+K 
Sbjct: 180 WPLGDDVSFIPGHGPMSTFGAERKTNPFVKD 210


>gi|148556454|ref|YP_001264036.1| beta-lactamase domain-containing protein [Sphingomonas wittichii
           RW1]
 gi|148501644|gb|ABQ69898.1| beta-lactamase domain protein [Sphingomonas wittichii RW1]
          Length = 483

 Score =  187 bits (476), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 89/212 (41%), Positives = 125/212 (58%), Gaps = 2/212 (0%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M  L   I+ VT F+QNCT ++   +++   VD GGDL+ +K         ++++ +THG
Sbjct: 267 MPPLKAAIIPVTAFQQNCTLIWCTATMKGAFVDAGGDLERLKAAAAEHGVTIEKLLVTHG 326

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DH GG   L E L + I GPH +D   + ++ +  R   I    R    DRWL DGD 
Sbjct: 327 HIDHCGGTGILAEQLGVPIEGPHPEDRFWIARLGDDGRGYGI--EGRPFEPDRWLDDGDQ 384

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           + +G  +  V HCPGH+PGHV++ +  +N A +GD LF+ SIGRTD   G++  LI SI 
Sbjct: 385 VTVGDLVLDVIHCPGHTPGHVVFHHAPSNLALVGDVLFQGSIGRTDFPRGNHGDLIASIT 444

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
            K+ PLG E +FV GHGP ST   ER  NPF+
Sbjct: 445 KKLWPLGGETAFVPGHGPMSTFAHERATNPFV 476


>gi|189426391|ref|YP_001953568.1| beta-lactamase [Geobacter lovleyi SZ]
 gi|189422650|gb|ACD97048.1| beta-lactamase domain protein [Geobacter lovleyi SZ]
          Length = 208

 Score =  187 bits (476), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 74/209 (35%), Positives = 108/209 (51%), Gaps = 2/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + F  V V     NC  L  E + + VVVDPG ++D I   ++ R   +  I  THGH D
Sbjct: 1   MIFDTVVVGALGVNCFVLGCEATGQGVVVDPGDEVDRILAQVKQRGLTIVAIINTHGHFD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVGG  QL +     +   H+ DA ++ +V + A +  +     +   DR L+DG  +  
Sbjct: 61  HVGGNRQLTQATGAPLY-IHQADAPLLERVAKTAGMYGLPG-ENSPQPDRLLEDGMQIEF 118

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           GTH  +V H PGH+ G              GDTLF   +GRTD+  G + QL+ SI  ++
Sbjct: 119 GTHRLQVIHTPGHTQGGCCLYLEAEGRLIAGDTLFADGVGRTDLPGGSHTQLVESIKTRL 178

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
             L D++    GHGP ++IG E+R NP+L
Sbjct: 179 FTLPDQVQVYPGHGPTTSIGHEKRHNPYL 207


>gi|169634509|ref|YP_001708245.1| putative enzyme [Acinetobacter baumannii SDF]
 gi|215484803|ref|YP_002327038.1| Metallo-beta-lactamase superfamily protein [Acinetobacter baumannii
           AB307-0294]
 gi|260556256|ref|ZP_05828475.1| metallo-beta-lactamase superfamily protein [Acinetobacter baumannii
           ATCC 19606]
 gi|332851880|ref|ZP_08433783.1| metallo-beta-lactamase domain protein [Acinetobacter baumannii
           6013150]
 gi|332867938|ref|ZP_08437926.1| metallo-beta-lactamase domain protein [Acinetobacter baumannii
           6013113]
 gi|169153301|emb|CAP02407.1| putative enzyme [Acinetobacter baumannii]
 gi|193076219|gb|ABO10842.2| hypothetical protein A1S_0383 [Acinetobacter baumannii ATCC 17978]
 gi|213987918|gb|ACJ58217.1| Metallo-beta-lactamase superfamily protein [Acinetobacter baumannii
           AB307-0294]
 gi|260410311|gb|EEX03610.1| metallo-beta-lactamase superfamily protein [Acinetobacter baumannii
           ATCC 19606]
 gi|332729665|gb|EGJ61001.1| metallo-beta-lactamase domain protein [Acinetobacter baumannii
           6013150]
 gi|332733639|gb|EGJ64798.1| metallo-beta-lactamase domain protein [Acinetobacter baumannii
           6013113]
          Length = 214

 Score =  187 bits (476), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 86/209 (41%), Positives = 128/209 (61%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L   IV VT F QNC+ ++D E+ EAV++D GGD  ++K  +++    VK +W+THGH+D
Sbjct: 2   LQVKIVPVTAFAQNCSLVWDSETKEAVLIDAGGDAAVLKKEVEALGLKVKALWLTHGHLD 61

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H G   +L ++ S+ ++GPHK+D   +  + E +         +    D+WL+ G+ L L
Sbjct: 62  HAGAVGELAKEWSVPVVGPHKEDQFWLDMIQEVSARYGF-PIPQPVKVDQWLEGGEVLKL 120

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   F+V   PGH+PGHV++ N  +     GD LF+ SIGRTD   G+++QLI SI  + 
Sbjct: 121 GEDEFEVRFAPGHTPGHVMFYNKNHGLLWTGDVLFKGSIGRTDFPRGNHEQLIESIQREC 180

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
             L DE  F+ GHGP STIG E++ NPF+
Sbjct: 181 FSLPDETQFISGHGPMSTIGYEKQFNPFV 209


>gi|92115864|ref|YP_575593.1| beta-lactamase-like [Nitrobacter hamburgensis X14]
 gi|91798758|gb|ABE61133.1| beta-lactamase-like protein [Nitrobacter hamburgensis X14]
          Length = 230

 Score =  187 bits (476), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 104/211 (49%), Positives = 145/211 (68%), Gaps = 1/211 (0%)

Query: 6   FHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHV 65
             I+ VTPF+QNCT L+ E + +AVV+DPGGD+ +I+  I+     V++IW+THGH+DHV
Sbjct: 21  VTIIPVTPFRQNCTLLWCETTRDAVVIDPGGDVPLIRTSIEQSGVTVRRIWLTHGHIDHV 80

Query: 66  GGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGT 125
           GGAA+L++ L + I GPH  D  ++  V E  R   +    RN + DRWL++G+ + +G 
Sbjct: 81  GGAAELRDALKVPIEGPHIADKFLLDHVVESGRGYGMTGM-RNFTPDRWLEEGEKVKIGE 139

Query: 126 HIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILP 185
             F V HCPGHSPG V++ N E  FAH+GD LF  S+GRTD+  G +  LI SI +K+LP
Sbjct: 140 LEFDVLHCPGHSPGSVVFFNREMRFAHVGDVLFNGSVGRTDLPGGSHATLIKSITDKLLP 199

Query: 186 LGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           LGD+++F+CGHGP S+IG ER  NPFL   +
Sbjct: 200 LGDDVAFICGHGPGSSIGHERASNPFLTDGM 230


>gi|255321269|ref|ZP_05362435.1| metallo-beta-lactamase family protein [Acinetobacter radioresistens
           SK82]
 gi|262380047|ref|ZP_06073202.1| conserved hypothetical protein [Acinetobacter radioresistens SH164]
 gi|255301823|gb|EET81074.1| metallo-beta-lactamase family protein [Acinetobacter radioresistens
           SK82]
 gi|262298241|gb|EEY86155.1| conserved hypothetical protein [Acinetobacter radioresistens SH164]
          Length = 214

 Score =  187 bits (476), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 87/209 (41%), Positives = 130/209 (62%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L   IV VT F QNC+ ++D E+ EA+++D GGD + +K  +++   +VK +W+THGH+D
Sbjct: 2   LQVKIVPVTAFAQNCSIVWDAETKEAILIDAGGDAEKLKAEVEALGINVKALWLTHGHLD 61

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H G   +L     + +IGPHK+D   +  + E +         +    D+WL+ G+TL L
Sbjct: 62  HAGAVGELANTWDVPVIGPHKEDQFWLDMIQEVSARYGF-PIPQPVKVDQWLEGGETLKL 120

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   F+V   PGH+PGHVI+ N ++     GD LF+ SIGRTD   G+++QL++SI  + 
Sbjct: 121 GKSEFEVRFTPGHTPGHVIFYNAQHGLLWTGDVLFKGSIGRTDFPRGNHRQLLDSIQREC 180

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
             L D+  F+CGHGP STIG E++ NPFL
Sbjct: 181 FTLPDDTQFICGHGPMSTIGFEKQHNPFL 209


>gi|83592857|ref|YP_426609.1| beta-lactamase-like [Rhodospirillum rubrum ATCC 11170]
 gi|83575771|gb|ABC22322.1| Beta-lactamase-like [Rhodospirillum rubrum ATCC 11170]
          Length = 214

 Score =  187 bits (476), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 93/212 (43%), Positives = 138/212 (65%), Gaps = 2/212 (0%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M+ L   I+ VTPF+QNCT L+ +E++   +VD GGD+D +   ++     ++++ +THG
Sbjct: 1   MA-LKATILPVTPFQQNCTLLWCDETMAGALVDAGGDVDRLLQAVEKTGVRLEKLLVTHG 59

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DH GG A+++E L L + GPH DDA ++  + +Q  L       R+   DRWL  GD 
Sbjct: 60  HLDHAGGVAEIQERLGLPVEGPHADDAFLIEGMADQ-ALRFGFPEGRSFVPDRWLVQGDK 118

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           + LG    +V HCPGH+PGHV++       A +GD LFR SIGRTD   GD+  L+ SI+
Sbjct: 119 VSLGALTLEVLHCPGHTPGHVVFFEPTARVAQVGDVLFRGSIGRTDFPRGDHATLLASIH 178

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           +++LPLGD+++ + GHGP ST+G ERR NP+L
Sbjct: 179 DRLLPLGDDVTIIPGHGPLSTLGEERRTNPYL 210


>gi|261344274|ref|ZP_05971918.1| metallo-beta-lactamase family protein [Providencia rustigianii DSM
           4541]
 gi|282567877|gb|EFB73412.1| metallo-beta-lactamase family protein [Providencia rustigianii DSM
           4541]
          Length = 215

 Score =  187 bits (476), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 91/213 (42%), Positives = 140/213 (65%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + I+ VTPF QNC  ++D+ S+EAV+VDPGG+ + + + I+S    + +I +THGH D
Sbjct: 1   MKYTIIPVTPFMQNCHIIWDDNSMEAVIVDPGGETEKLINAIESLGLTLTKILLTHGHSD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G +A L +   + I GP K+DA  +  + +Q  + +I     + + D WL++GD++  
Sbjct: 61  HIGASAPLAKHFGVPIYGPQKEDAFWIENLAQQNAMFNIGDC-PDFTPDHWLEEGDSVSC 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   F V HCPGH+PGH+++VN  +    +GD LF+  +GR+D   G++Q LI+SI NK+
Sbjct: 120 GNIKFDVLHCPGHTPGHIVFVNHGDKLISMGDVLFKGGVGRSDFPRGNHQDLISSIKNKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           LPLGDE  F+ GHGP ST+G ER  NPFL+  +
Sbjct: 180 LPLGDEYQFIPGHGPMSTLGHERISNPFLQDEL 212


>gi|39933645|ref|NP_945921.1| hydrolase [Rhodopseudomonas palustris CGA009]
 gi|39647491|emb|CAE26012.1| probable hydrolase [Rhodopseudomonas palustris CGA009]
          Length = 221

 Score =  187 bits (476), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 104/205 (50%), Positives = 139/205 (67%), Gaps = 1/205 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           I+ VTPF+QNCT L+ E + +AVVVDPGGD+  I   I+     V  IW+THGH+DHVGG
Sbjct: 14  IIPVTPFQQNCTLLWCEATRKAVVVDPGGDVPEILAAIEKTKVDVGAIWLTHGHIDHVGG 73

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           AA L++ L + +IGPH+DD  ++  V    R   I    R+ + DRWL DGD++ +G   
Sbjct: 74  AADLRDALKVEVIGPHRDDQFLLDNVVNSGRSFGI-DGVRDVTPDRWLDDGDSVSIGELN 132

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
           F++ HCPGHSPG V++ N    FA +GD LF  S+GRTD+  G +  LI SI  K+LPLG
Sbjct: 133 FQILHCPGHSPGSVVFFNDAMRFAFVGDVLFAGSVGRTDLPGGSHATLIQSITQKLLPLG 192

Query: 188 DEISFVCGHGPNSTIGRERRLNPFL 212
           D++ F+CGHGP S+ G+ERR NPFL
Sbjct: 193 DDVGFICGHGPGSSFGQERRTNPFL 217


>gi|149907596|ref|ZP_01896343.1| glyoxylase II family protein [Moritella sp. PE36]
 gi|149809266|gb|EDM69195.1| glyoxylase II family protein [Moritella sp. PE36]
          Length = 209

 Score =  187 bits (476), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 79/210 (37%), Positives = 118/210 (56%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +   ++ VTPF+QNC+ L   E+ +A +VDPGGD+D I   ++     V++I++TH H+D
Sbjct: 1   MQVKVIPVTPFEQNCSLLICPETNKAAIVDPGGDIDKIISQVKQHGVEVEKIFLTHAHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVGG   L   L++TI GPH  D   + K+  Q ++             RWL+ GD +  
Sbjct: 61  HVGGTEALAAALNVTIEGPHIADKFWLDKLPMQGQMFGF-PEVPPFEPQRWLEHGDIITF 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G       H PGH+PGHV++ +       +GD LF  S+GRTD   G +  L+ +I  ++
Sbjct: 120 GNQQLTALHTPGHTPGHVVFNHVATKQVIVGDVLFNGSVGRTDFPQGCFNTLMTAIKGQL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
             L +E  F  GHGP STIG E+R NP ++
Sbjct: 180 WTLPEETVFFPGHGPTSTIGHEKRTNPHVR 209


>gi|149925325|ref|ZP_01913589.1| beta-lactamase-like protein [Limnobacter sp. MED105]
 gi|149825442|gb|EDM84650.1| beta-lactamase-like protein [Limnobacter sp. MED105]
          Length = 214

 Score =  187 bits (475), Expect = 8e-46,   Method: Composition-based stats.
 Identities = 91/211 (43%), Positives = 141/211 (66%), Gaps = 1/211 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L +H + VTPF QNC+ ++  E+ +A ++DPGGDLD +   I  RN  ++ IW+TH H+D
Sbjct: 2   LRYHTIPVTPFAQNCSIVWCSETNKAAIIDPGGDLDQLTKAIADRNLELQAIWLTHAHID 61

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GG A+L   L+L IIGPH+ D   + ++ +Q+R+ +    ++  + +RWL DGDT+ +
Sbjct: 62  HAGGVAELAAKLNLPIIGPHEGDQFWIDRLADQSRMFNF-PLSKPFTPNRWLADGDTVQI 120

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGH+PGHV++ + E   A +GD LF  S+GRTD   GD++ LI+SI N++
Sbjct: 121 GNCTLNVRHCPGHTPGHVVFHSEEAKRAFVGDVLFVGSMGRTDFPGGDHETLIDSIRNRL 180

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
            P+G++  F+ GHGP  + G+ERR NP+++ 
Sbjct: 181 WPMGNDTVFIPGHGPEGSFGQERRSNPYVRD 211


>gi|77165190|ref|YP_343715.1| metallo-beta-lactamase family protein [Nitrosococcus oceani ATCC
           19707]
 gi|254433141|ref|ZP_05046649.1| metallo-beta-lactamase superfamily, putative [Nitrosococcus oceani
           AFC27]
 gi|76883504|gb|ABA58185.1| metallo-beta-lactamase family protein [Nitrosococcus oceani ATCC
           19707]
 gi|207089474|gb|EDZ66745.1| metallo-beta-lactamase superfamily, putative [Nitrosococcus oceani
           AFC27]
          Length = 212

 Score =  187 bits (475), Expect = 8e-46,   Method: Composition-based stats.
 Identities = 96/213 (45%), Positives = 133/213 (62%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + F I+ VT F QNCT L  EES +A VVDPGGD++ I    ++    +++I +THGH+D
Sbjct: 1   MKFEILPVTRFMQNCTLLGCEESGKAAVVDPGGDVEQILARAEAGCLKIEKILLTHGHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GGA +L   L + I GP  +D   +  +  Q+ +       R    DRWL+ GD +  
Sbjct: 61  HAGGAGELARRLEVPIEGPQIEDEFWIDSLPAQSEMFGFPP-VRAFVPDRWLEQGDRVSF 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G  +  V+HCPGH+PGHVI+ + E++ A +GD LF+ SIGRTD   GDY  LI+SI  ++
Sbjct: 120 GKVVLNVYHCPGHTPGHVIFFHPESHLALVGDVLFKGSIGRTDFPRGDYDALIHSIRKRL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            PLGDE+ F+ GHGP ST G ER+ NPF+   I
Sbjct: 180 FPLGDEVRFIPGHGPMSTFGEERQSNPFVGEKI 212


>gi|296282445|ref|ZP_06860443.1| glyoxalase II family protein [Citromicrobium bathyomarinum JL354]
          Length = 213

 Score =  187 bits (475), Expect = 9e-46,   Method: Composition-based stats.
 Identities = 95/209 (45%), Positives = 139/209 (66%), Gaps = 2/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +   I+ VTP +QNC+ ++  ++ +A ++DPGGDLD +K  +      +++I ITHGH+D
Sbjct: 1   MKAAILPVTPLQQNCSLIWCTQTNKAALIDPGGDLDKLKAGVAKAGVELEKILITHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H G A  L ++L L I GPH+ D   + ++DE       +M A +   DRWL+DGDT+ +
Sbjct: 61  HCGQAGMLAQELGLPIEGPHEADRFWIARLDEDGARF--QMEAASFEPDRWLEDGDTVTV 118

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGHVI+ N +  FA +GD LF+ SIGRTD    D+Q LI++I  K+
Sbjct: 119 GNLTLEVIHCPGHTPGHVIFFNRDRKFAIVGDVLFQGSIGRTDFPMSDHQSLIDAITRKL 178

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
            PLGD+++F+ GHGP ST G+ERR NPF+
Sbjct: 179 WPLGDDVTFIPGHGPTSTFGQERRTNPFV 207


>gi|254516771|ref|ZP_05128829.1| metallo-beta-lactamase superfamily protein [gamma proteobacterium
           NOR5-3]
 gi|219674276|gb|EED30644.1| metallo-beta-lactamase superfamily protein [gamma proteobacterium
           NOR5-3]
          Length = 216

 Score =  187 bits (475), Expect = 9e-46,   Method: Composition-based stats.
 Identities = 94/214 (43%), Positives = 138/214 (64%), Gaps = 2/214 (0%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           MS +   IV VT ++QNC+ L  E + +A +VDPGGD+D +   ++     V++I +THG
Sbjct: 1   MS-IKVTIVPVTAYQQNCSILKCEVTGKAAIVDPGGDIDRVLAAVEQLGASVEKIILTHG 59

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DH   +  L++ LS+ I GPH+ D   + K+ E  ++ +    A     DRWL  GDT
Sbjct: 60  HMDHCAASDVLRQQLSVPIEGPHEGDRFWIDKLPEWCKMSNF-PIAEAFEPDRWLVAGDT 118

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           + +G    +VFHCPGH+PGHV++V+     A +GD +F+ SIGRTD   G++ +LINSI 
Sbjct: 119 VTVGAQTLQVFHCPGHTPGHVVFVHDGQRVAWVGDVIFQGSIGRTDFPKGNHDELINSIR 178

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           N + PLGD+I+F+ GHGP ST GRER+ NPF+  
Sbjct: 179 NTLFPLGDDITFIPGHGPTSTFGRERQSNPFVAD 212


>gi|310767194|gb|ADP12144.1| Putative metallo-beta-lactamase [Erwinia sp. Ejp617]
          Length = 209

 Score =  187 bits (474), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 92/210 (43%), Positives = 138/210 (65%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++HI+ VT F QNC+ ++  E+ EA +VDPGGD   I+  I      VKQI +THGH+D
Sbjct: 1   MNYHIIPVTAFAQNCSVIWCPETGEAALVDPGGDAHKIRHEIAGLGITVKQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L E   + ++GPHK D   +  + +Q+++      A  A  DRWL++G+ + +
Sbjct: 61  HVGAAAELAEHYGVPVVGPHKADKFWLDGLPQQSQMFGFDECAPLA-PDRWLREGEVVHV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G  + +V  CPGH+PGH+++ + E+     GD +F   +GR+D     +QQLI SI NK+
Sbjct: 120 GNTVLEVLWCPGHTPGHIVFFDRESRLLVSGDVIFSGGVGRSDFPQCSHQQLIASILNKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           LPLGD+++F+ GHGP ST+GRER  NPFL+
Sbjct: 180 LPLGDDVTFIAGHGPMSTLGRERISNPFLQ 209


>gi|241205716|ref|YP_002976812.1| beta-lactamase [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240859606|gb|ACS57273.1| beta-lactamase domain protein [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 219

 Score =  187 bits (474), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 116/214 (54%), Positives = 150/214 (70%), Gaps = 1/214 (0%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M  L   I+ VTPF+QNCT  FD ++ E VVVDPGGD+ +I   I      +K+IW+THG
Sbjct: 1   MGMLQAGIIPVTPFQQNCTIFFDPDTKEGVVVDPGGDVPLILQAIAQNGLTIKEIWLTHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DH GGA++LKE L + +IGPH+DD  ++ +++ QA         RN   DRWL+DGD 
Sbjct: 61  HLDHAGGASELKEALGIDVIGPHQDDLPLLQRIETQAEKY-GMSGLRNVVPDRWLKDGDK 119

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           +  G H F+V H PGH+PGHVIY N   NFAHLGD LF  SIGRTD+  GD+QQL++SI 
Sbjct: 120 ISFGAHEFEVHHTPGHAPGHVIYFNRAQNFAHLGDVLFNGSIGRTDLPGGDHQQLLDSIR 179

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           +K+LPLGD++ F+CGHGP S IG ERR NPFL+ 
Sbjct: 180 DKVLPLGDDVGFICGHGPGSRIGDERRSNPFLQE 213


>gi|145299052|ref|YP_001141893.1| metallo-beta-lactamase superfamily protein [Aeromonas salmonicida
           subsp. salmonicida A449]
 gi|142851824|gb|ABO90145.1| metallo-beta-lactamase superfamily protein [Aeromonas salmonicida
           subsp. salmonicida A449]
          Length = 214

 Score =  187 bits (474), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 89/209 (42%), Positives = 131/209 (62%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L F ++ VT F QNC+ ++ +E+ +A ++DP G+ D +   I  R   +  I +THGH+D
Sbjct: 2   LKFEVIPVTQFAQNCSLIWCDETHQAALIDPCGEADKLLAAITQRGLTLTHILLTHGHLD 61

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L+E   + I GPHK+DA  +  +  Q+++     +    + + WL+ GD + +
Sbjct: 62  HVGAAAELRETTGVAITGPHKEDAFWLDMLPRQSQMFGF-AHTPAFTPNSWLEQGDKVKV 120

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V+ CPGH+PGHVI ++     A +GD LF  SIGRTD   GD+  LI SI   +
Sbjct: 121 GNCELEVYFCPGHTPGHVILLSQAEKLAWVGDVLFAGSIGRTDFPRGDHATLIKSITETL 180

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           LPLGDEI F+ GHGP+ST GRE+  NP+L
Sbjct: 181 LPLGDEIVFIPGHGPSSTFGREKASNPYL 209


>gi|227822823|ref|YP_002826795.1| metallo-beta-lactamase family protein [Sinorhizobium fredii NGR234]
 gi|227341824|gb|ACP26042.1| metallo-beta-lactamase family protein [Sinorhizobium fredii NGR234]
          Length = 213

 Score =  187 bits (474), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 117/207 (56%), Positives = 151/207 (72%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           I+ VT F+QNCT LFD E+ E V+VDPGGD+D+I   I+     +K IW+THGH+DH GG
Sbjct: 6   IIPVTHFQQNCTVLFDSETKEGVIVDPGGDVDVILQTIRENGLALKAIWLTHGHIDHAGG 65

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           A +LKE L L IIGPHKDD  ++ +++ QA    + M  +N   DRWL DGDT+  G H+
Sbjct: 66  AKELKEALGLEIIGPHKDDLPLLERLESQAERFGLAMKVQNVLPDRWLNDGDTVSFGDHV 125

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
           F+V HCPGH+PGHV+Y N   NFAH+GD LF  SIGRTD+  GD+QQL++SI +KILPLG
Sbjct: 126 FEVLHCPGHAPGHVVYFNRAQNFAHVGDVLFHGSIGRTDLPGGDHQQLLDSIRDKILPLG 185

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLKS 214
           D++ F+CGHGP   IG ERR NP+L+ 
Sbjct: 186 DDVGFICGHGPGGRIGEERRTNPYLRG 212


>gi|126174941|ref|YP_001051090.1| beta-lactamase domain-containing protein [Shewanella baltica OS155]
 gi|125998146|gb|ABN62221.1| beta-lactamase domain protein [Shewanella baltica OS155]
          Length = 214

 Score =  187 bits (474), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 88/213 (41%), Positives = 133/213 (62%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + I+ VTPF+QNC+ ++ E++  A VVDPGG++D I++ +      + +I +THGH+D
Sbjct: 1   MKYQIIPVTPFQQNCSLIWCEKTKRAAVVDPGGNIDRIQNEVTKLGLVLDKIILTHGHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVGGA  L +  ++ IIGPH  D   +  + +Q++             D++LQDGD + +
Sbjct: 61  HVGGAKALAQATNVPIIGPHIADKFWIDNLPKQSQNFGFPHC-DAFEPDQYLQDGDNVQV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGH+PGH+   + ++  A +GD LFRSSIGRTD    ++Q LI+SI  K+
Sbjct: 120 GEQSLSVLHCPGHTPGHIALFSAQSKLAWVGDILFRSSIGRTDFPQSNHQDLIHSITEKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            PLG ++ F+ GHGP ST G ER  NPF+   +
Sbjct: 180 WPLGVDVEFIPGHGPISTFGEEREHNPFVADQL 212


>gi|184156713|ref|YP_001845052.1| Zn-dependent hydrolase [Acinetobacter baumannii ACICU]
 gi|332873123|ref|ZP_08441080.1| metallo-beta-lactamase domain protein [Acinetobacter baumannii
           6014059]
 gi|183208307|gb|ACC55705.1| Zn-dependent hydrolase, including glyoxylase [Acinetobacter
           baumannii ACICU]
 gi|322506602|gb|ADX02056.1| Zn-dependent hydrolase, including glyoxylase [Acinetobacter
           baumannii 1656-2]
 gi|323516479|gb|ADX90860.1| Zn-dependent hydrolase, including glyoxylase [Acinetobacter
           baumannii TCDC-AB0715]
 gi|332738635|gb|EGJ69505.1| metallo-beta-lactamase domain protein [Acinetobacter baumannii
           6014059]
          Length = 214

 Score =  187 bits (474), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 86/209 (41%), Positives = 127/209 (60%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L   IV VT F QNC+ ++D E+ EAV++D GGD  ++K  +++    VK +W+THGH+D
Sbjct: 2   LQVKIVPVTAFAQNCSLVWDSETKEAVLIDAGGDAAVLKKEVEALGLKVKALWLTHGHLD 61

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H G   +L ++ S+ ++GPHK+D   +  + E +         +    D+WL+ G+ L L
Sbjct: 62  HAGAVGELAKEWSVPVVGPHKEDQFWLDMIQEVSARYGF-PIPQPVKVDQWLEGGEVLKL 120

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   F+V   PGH+PGHV++ N  +     GD LF+ SIGRTD   G++ QLI SI  + 
Sbjct: 121 GEDEFEVRFAPGHTPGHVMFYNKNHGLLWTGDVLFKGSIGRTDFPRGNHDQLIESIQREC 180

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
             L DE  F+ GHGP STIG E++ NPF+
Sbjct: 181 FSLPDETQFISGHGPMSTIGYEKQFNPFV 209


>gi|83747433|ref|ZP_00944472.1| Hypothetical Protein RRSL_02814 [Ralstonia solanacearum UW551]
 gi|83725890|gb|EAP73029.1| Hypothetical Protein RRSL_02814 [Ralstonia solanacearum UW551]
          Length = 224

 Score =  187 bits (474), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 92/215 (42%), Positives = 133/215 (61%), Gaps = 2/215 (0%)

Query: 2   SKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGH 61
           + +   +V VTPF+QNCT L  ++   A V DPGGD+D I    + +   +++I +THGH
Sbjct: 5   NHMKVVVVPVTPFEQNCTLLIGDD-GSAAVTDPGGDIDRILSAARQQGARIEKILLTHGH 63

Query: 62  VDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
           VDH   A  L+  L + I GPH+D+A  + ++  Q++       AR    DRWL+DGDT+
Sbjct: 64  VDHCAAADALRTQLGVPIEGPHRDEAFWIDQLPTQSQRFGFPP-ARAFVPDRWLEDGDTV 122

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
                  +VFHCPGH+PGHV++ +  +  A +GD LF  SIGRTD   G++  LI SI  
Sbjct: 123 EAAGRTLEVFHCPGHTPGHVVFFSRPDRIAIVGDVLFAGSIGRTDFPRGNHADLIRSIRT 182

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           K+ PLGD+++FV GHGP ST G ER  NP++  ++
Sbjct: 183 KLWPLGDDVTFVPGHGPVSTFGDERATNPYVADSL 217


>gi|239500884|ref|ZP_04660194.1| Zn-dependent hydrolase, including glyoxylase [Acinetobacter
           baumannii AB900]
          Length = 214

 Score =  187 bits (474), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 86/209 (41%), Positives = 127/209 (60%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L   IV VT F QNC+ ++D E+ EAV++D GGD  ++K  +++    VK +W+THGH+D
Sbjct: 2   LQVKIVPVTAFAQNCSLVWDSETKEAVLIDAGGDAAVLKKEVEALGLKVKALWLTHGHLD 61

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H G   +L ++ S+ ++GPHK+D   +  + E +         +    D+WL+ G+ L L
Sbjct: 62  HAGAVGELAKEWSVPVVGPHKEDQFWLDMIQEVSARYGF-PIPQPVKVDQWLEGGEVLKL 120

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   F+V   PGH+PGHV++ N  +     GD LF+ SIGRTD   G++ QLI SI  + 
Sbjct: 121 GEDEFEVRFAPGHTPGHVMFYNKNHGLLWTGDVLFKGSIGRTDFPRGNHDQLIESIQREC 180

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
             L DE  F+ GHGP STIG E++ NPF+
Sbjct: 181 FSLPDETQFISGHGPMSTIGYEKQFNPFV 209


>gi|268590139|ref|ZP_06124360.1| metallo-beta-lactamase family protein [Providencia rettgeri DSM
           1131]
 gi|291314412|gb|EFE54865.1| metallo-beta-lactamase family protein [Providencia rettgeri DSM
           1131]
          Length = 215

 Score =  187 bits (474), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 92/213 (43%), Positives = 138/213 (64%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + I+ VTPF QNC  ++DE +L+AVVVDPGG+ + +   I++    + +I +THGH D
Sbjct: 1   MKYTIIPVTPFMQNCQVIWDENTLDAVVVDPGGEAEKLISAIENLGLKLTKILLTHGHSD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G +A L +  S+ I GP K+DA  +  + EQ  +  I     + + D WL++GD +  
Sbjct: 61  HIGASATLSKHFSVPIYGPQKEDAFWIENLAEQNAMFYIGEC-PDFTPDYWLEEGDKVTC 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   F V HCPGH+PGH+I+VN  +    +GD LF+  +GR+D   G++Q LI+SI NK+
Sbjct: 120 GNITFDVLHCPGHTPGHIIFVNHADKLISMGDVLFKGGVGRSDFPRGNHQDLISSIKNKV 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           LPLGD+  F+ GHGP S +G ER+ NPFL+  +
Sbjct: 180 LPLGDDYQFIPGHGPMSNLGFERKTNPFLQDEL 212


>gi|217972802|ref|YP_002357553.1| beta-lactamase domain-containing protein [Shewanella baltica OS223]
 gi|217497937|gb|ACK46130.1| beta-lactamase domain protein [Shewanella baltica OS223]
          Length = 214

 Score =  187 bits (474), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 89/213 (41%), Positives = 133/213 (62%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + I+ VTPF+QNC+ ++ E++  A VVDPGG++D I++ +      + +I +THGH+D
Sbjct: 1   MKYQIIPVTPFQQNCSLIWCEKTKRAAVVDPGGNIDRIQNEVTKLGLVLDKIILTHGHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVGGA  L +  ++ IIGPH  D   +  + +Q++             D++LQDGD + +
Sbjct: 61  HVGGAKALAQATNVPIIGPHIADKFWIDNLPKQSQNFGFPHC-DAFEPDQYLQDGDNVQV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGH+PGH+   + ++  A +GD LFRSSIGRTD    ++Q LI+SI  K+
Sbjct: 120 GEQSLSVLHCPGHTPGHIALFSAQSKLAWVGDILFRSSIGRTDFPQSNHQDLIHSITEKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            PLG E+ F+ GHGP ST G ER  NPF+   +
Sbjct: 180 WPLGIEVEFIPGHGPMSTFGEEREHNPFVADQL 212


>gi|90579551|ref|ZP_01235360.1| hypothetical glyoxylase II family protein [Vibrio angustum S14]
 gi|90439125|gb|EAS64307.1| hypothetical glyoxylase II family protein [Vibrio angustum S14]
          Length = 217

 Score =  186 bits (473), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 95/216 (43%), Positives = 136/216 (62%), Gaps = 2/216 (0%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           MS L + IV VTPF+QNC+ ++ +E+ +A +VDPGGD++ +  V+      V Q+ +THG
Sbjct: 1   MS-LKYQIVPVTPFQQNCSIIWCDETNQAAIVDPGGDIEQLTKVVDELGLTVTQLILTHG 59

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DHVGG A L + L++ +IGPHKDD   +  +  Q+ +             +WL DGD 
Sbjct: 60  HLDHVGGTAPLAQSLNVPVIGPHKDDEFWLQGLPRQSEMFGF-PMTEAFEPTQWLNDGDE 118

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           + +G    +V H PGH+PGHVI  + + N A +GD LF+  IGRTD   GD+  LIN+I 
Sbjct: 119 IHVGNQTLQVLHTPGHTPGHVILFSNDANVAFVGDVLFKGGIGRTDFPRGDHPTLINAIK 178

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            K+ PLGD+++FV GHGP ST G ER  NPF+   +
Sbjct: 179 TKLWPLGDDVTFVPGHGPLSTFGHERATNPFVADEM 214


>gi|296160812|ref|ZP_06843625.1| beta-lactamase domain protein [Burkholderia sp. Ch1-1]
 gi|295888904|gb|EFG68709.1| beta-lactamase domain protein [Burkholderia sp. Ch1-1]
          Length = 214

 Score =  186 bits (473), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 91/213 (42%), Positives = 132/213 (61%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +   ++ VTPF+QN + L  E +  A VVDPGGDLDII+  I  +N  V+++++THGH+D
Sbjct: 1   MKVTLIPVTPFQQNSSLLVCEATGRAAVVDPGGDLDIIQGEISRQNVSVEKVFLTHGHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H  GA  L     + I GPH D+   + K+ +Q+        A     DRWLQ+G+ +  
Sbjct: 61  HCAGAKTLASHYGVPIEGPHPDERFWLDKLPDQSTRFGFPA-AEAFEPDRWLQNGEAVHF 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G  I +V+HCPGH+PGHV++ +  +  A +GD LF  SIGRTD   G++  L+ SI  K+
Sbjct: 120 GDEILEVYHCPGHTPGHVVFFSRAHRLALVGDVLFAGSIGRTDFPRGNHADLVRSIREKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            PLGD+++FV GHGP ST   ERR NP++   +
Sbjct: 180 WPLGDDVTFVPGHGPTSTFSAERRTNPYVADGV 212


>gi|41582327|gb|AAS07941.1| metallo-beta-lactamase family protein [uncultured marine bacterium
           463]
          Length = 216

 Score =  186 bits (473), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 92/214 (42%), Positives = 136/214 (63%), Gaps = 3/214 (1%)

Query: 4   LSFH--IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGH 61
           +S    IV VTP++QNC+ +  + S +A +VDPGGD++ I + +   +  V++I +TH H
Sbjct: 1   MSIQCTIVPVTPYQQNCSIIKCQASGKAAIVDPGGDVERILEAVAKMDATVEKIILTHAH 60

Query: 62  VDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
           +DH   A  L++ L +TI GP K D   + K+ E  ++      A     DRWL+DGDT+
Sbjct: 61  MDHCAAADVLRQQLQITIEGPEKADNFWLEKLPEWCKMSGFPH-ADAFEPDRWLEDGDTV 119

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
            +G    +V HCPGH+PGHV++++   N A +GD LF+ SIGRTD   G+++ L+ SI  
Sbjct: 120 TVGEQTLQVLHCPGHTPGHVVFLHQAQNVAWVGDVLFQGSIGRTDFPMGNHEDLVASIRG 179

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFLKSN 215
           K+ PLGD I+F+ GHGP ST G ERR NPF+  +
Sbjct: 180 KLFPLGDNITFIPGHGPTSTFGEERRSNPFVSDS 213


>gi|269102896|ref|ZP_06155593.1| hydroxyacylglutathione hydrolase [Photobacterium damselae subsp.
           damselae CIP 102761]
 gi|268162794|gb|EEZ41290.1| hydroxyacylglutathione hydrolase [Photobacterium damselae subsp.
           damselae CIP 102761]
          Length = 217

 Score =  186 bits (473), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 92/216 (42%), Positives = 141/216 (65%), Gaps = 2/216 (0%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           MS L + IV VTPF+QNC+ ++ +++ +A ++DPGGD+++IK  +Q     V ++ +THG
Sbjct: 1   MS-LQYRIVPVTPFQQNCSIVWCDKTNQAAIIDPGGDINVIKQHVQELGLTVTKLLLTHG 59

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DHVGG   L ++L++ +IGP K+D   +  +  Q+ +        +    +WL+DGDT
Sbjct: 60  HLDHVGGTEPLAQELNVPVIGPQKEDIFWLQGLPRQSEMFGF-PMTESFDPTQWLEDGDT 118

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           + +G  +  V H PGH+PGHV++ +     A +GD LF   IGRTD   GDYQ LINSI 
Sbjct: 119 VTVGEEVLSVLHTPGHTPGHVVFFSDSAKVAFVGDVLFNGGIGRTDFPRGDYQTLINSIK 178

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            K+ PLG++++F+ GHGP+ST GRER  NPF+   +
Sbjct: 179 GKLWPLGNDVTFIPGHGPSSTFGRERASNPFVADEM 214


>gi|160875938|ref|YP_001555254.1| beta-lactamase domain-containing protein [Shewanella baltica OS195]
 gi|160861460|gb|ABX49994.1| beta-lactamase domain protein [Shewanella baltica OS195]
 gi|315268133|gb|ADT94986.1| beta-lactamase domain protein [Shewanella baltica OS678]
          Length = 214

 Score =  186 bits (472), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 89/213 (41%), Positives = 133/213 (62%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + I+ VTPF+QNC+ ++ E++  A VVDPGG++D I++ +      + QI +THGH+D
Sbjct: 1   MKYQIIPVTPFQQNCSLIWCEKTKRAAVVDPGGNIDRIQNEVTKLGLVLDQIILTHGHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVGGA  L +  ++ IIGPH  D   +  + +Q++             D++LQDGD + +
Sbjct: 61  HVGGAKALAQAANVPIIGPHIADKFWIDNLPKQSQNFGFPHC-DAFEPDQYLQDGDIVKV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGH+PGH+   + ++  A +GD LFRSSIGRTD    ++Q LI+SI  K+
Sbjct: 120 GEQSLSVLHCPGHTPGHIALFSAQSKLAWVGDILFRSSIGRTDFPQSNHQDLIHSITEKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            PLG ++ F+ GHGP ST G ER  NPF+   +
Sbjct: 180 WPLGVDVEFIPGHGPISTFGEEREHNPFVADQL 212


>gi|328542848|ref|YP_004302957.1| enzyme with metallo-hydrolase/oxidoreductase domain (YcbL-like)
           [polymorphum gilvum SL003B-26A1]
 gi|326412594|gb|ADZ69657.1| Putative enzyme with metallo-hydrolase/oxidoreductase domain
           (YcbL-like) [Polymorphum gilvum SL003B-26A1]
          Length = 224

 Score =  186 bits (472), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 98/213 (46%), Positives = 144/213 (67%), Gaps = 1/213 (0%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           +  +   ++ VT F+QNC+ ++D  +L+  VVDPGGD+  I + ++  +  V++I +THG
Sbjct: 13  LPPIQVAVIPVTAFQQNCSLIWDPRTLKGAVVDPGGDVARILEAVKKYDVTVERIVLTHG 72

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DH+GGAA+L E L++ + GPH+ D  ++ +V+EQAR   +    R+   DRWL++GD+
Sbjct: 73  HIDHIGGAAELAEALAVPVEGPHEADRPLIARVEEQARQFGV-AGVRSVEPDRWLEEGDS 131

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           + +    F V HCPGH+PGHV+  + E  FA  GD LF  SIGRTD+  GD+  LI SI 
Sbjct: 132 VEIAGRSFAVLHCPGHAPGHVVLFDAELRFAISGDVLFAGSIGRTDLPGGDHATLIRSIV 191

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
            K+LPLGD++SF+ GHGP ST G ER  NPFL+
Sbjct: 192 TKLLPLGDDVSFLPGHGPASTFGHERETNPFLR 224


>gi|260549198|ref|ZP_05823419.1| metallo-beta-lactamase superfamily protein [Acinetobacter sp.
           RUH2624]
 gi|260407926|gb|EEX01398.1| metallo-beta-lactamase superfamily protein [Acinetobacter sp.
           RUH2624]
          Length = 214

 Score =  186 bits (472), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 85/209 (40%), Positives = 128/209 (61%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L   IV VT F QNC+ ++D E+ EAV++D GGD  ++K  +++    VK +W+THGH+D
Sbjct: 2   LQVKIVPVTAFAQNCSLVWDSETKEAVLIDAGGDAAVLKKEVEALGLKVKALWLTHGHLD 61

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H G   +L ++ S+ ++GPHK+D   +  + E +         +    D+WL+ G+ L L
Sbjct: 62  HAGAVGELAQEWSVPVVGPHKEDQFWLDMIQEVSARYGF-PIPQPVKVDQWLEGGEVLKL 120

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   F+V   PGH+PGHV++ N  +     GD LF+ SIGRTD   G+++QLI SI  + 
Sbjct: 121 GEDEFEVRFAPGHTPGHVMFYNKNHGLLWTGDVLFKGSIGRTDFPRGNHEQLIESIQREC 180

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
             L D+  F+ GHGP STIG E++ NPF+
Sbjct: 181 FSLPDQTQFISGHGPMSTIGYEKQFNPFV 209


>gi|299065247|emb|CBJ36413.1| putative enzyme with metallo-hydrolase/oxidoreductase domain
           [Ralstonia solanacearum CMR15]
          Length = 218

 Score =  186 bits (472), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 91/211 (43%), Positives = 128/211 (60%), Gaps = 2/211 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +   +V VTPF+QNCT L  ++   A V DPGGD+D I    + +   +++I +THGHVD
Sbjct: 1   MKVVVVPVTPFEQNCTLLIGDD-GRAAVTDPGGDIDRILSAARQQGARIEKILLTHGHVD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H   A  L+  L + I GPH+D+A  + ++  Q++       A     DRWL DGDT+  
Sbjct: 60  HCAAADALRTQLGVPIEGPHRDEAFWIDQLPTQSQRFGFPP-ALAFVPDRWLDDGDTVEA 118

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
                +VFHCPGH+PGHV++ +  +  A +GD LF  SIGRTD   G++  LI SI  K+
Sbjct: 119 AGRTLEVFHCPGHTPGHVVFFSRPDRIAIVGDVLFAGSIGRTDFPRGNHADLIRSIRTKL 178

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
            PLGD+++FV GHGP ST G ER  NP++  
Sbjct: 179 WPLGDDVTFVPGHGPVSTFGDERATNPYVAD 209


>gi|239994602|ref|ZP_04715126.1| probable metallo-beta-lactamase [Alteromonas macleodii ATCC 27126]
          Length = 213

 Score =  186 bits (472), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 78/209 (37%), Positives = 128/209 (61%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +   ++ VTPF QNC+ ++D  + +   VDPGGD++ + +   ++   +++I +THGH+D
Sbjct: 1   MEIQVIPVTPFAQNCSLIWDSSTNKGAFVDPGGDVETLIEAATNKGVSIEKIILTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVGG   + E   + I+GPH  D   +  + +Q+++      A+  + + WL D DT+ +
Sbjct: 61  HVGGTVAIAEHYGVPIVGPHIGDKFWLDALMQQSQMFGFPP-AQPFAPNEWLNDNDTISV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGHV+ V   +N   +GD +F  SIGRTD   G++QQLI+SI  KI
Sbjct: 120 GNLTLEVLHCPGHTPGHVVLVERSSNRVIVGDVIFAGSIGRTDFPQGNHQQLIDSIKQKI 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           + L D ++   GHGP +T+  E+  NP++
Sbjct: 180 MVLPDNMTIYPGHGPTTTVATEKATNPYV 208


>gi|187930531|ref|YP_001901018.1| beta-lactamase domain-containing protein [Ralstonia pickettii 12J]
 gi|187727421|gb|ACD28586.1| beta-lactamase domain protein [Ralstonia pickettii 12J]
          Length = 218

 Score =  186 bits (472), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 90/211 (42%), Positives = 130/211 (61%), Gaps = 2/211 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +   +V VTPF+QNCT L  ++   A V DPGGD++ I    +     +++I +THGHVD
Sbjct: 1   MKVVVVPVTPFEQNCTLLIGDD-GTAAVTDPGGDIERILAAAKQHGARIEKILLTHGHVD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H   A  L+  L + I GP KD+A  + ++  Q++       A+    DRWL+DGDT+  
Sbjct: 60  HCAAADALRTQLGVPIEGPQKDEAFWIDQLPAQSQRFGFPP-AKAFVPDRWLEDGDTVEA 118

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
                +VFHCPGH+PGHV++ + ++  A +GD LF  SIGRTD   G++  LIN+I  K+
Sbjct: 119 AGRTLQVFHCPGHTPGHVVFFSAQDRVAIVGDVLFAGSIGRTDFPRGNHADLINAIRTKL 178

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
            PLGD+++FV GHGP ST G ER  NP++  
Sbjct: 179 WPLGDDVTFVPGHGPVSTFGEERASNPYVAD 209


>gi|304411881|ref|ZP_07393492.1| beta-lactamase domain-containing protein [Shewanella baltica OS183]
 gi|307303351|ref|ZP_07583106.1| beta-lactamase domain-containing protein [Shewanella baltica BA175]
 gi|304349741|gb|EFM14148.1| beta-lactamase domain-containing protein [Shewanella baltica OS183]
 gi|306913711|gb|EFN44133.1| beta-lactamase domain-containing protein [Shewanella baltica BA175]
          Length = 214

 Score =  186 bits (471), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 88/213 (41%), Positives = 133/213 (62%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + I+ VTPF+QNC+ ++ E++  A VVDPGG++D I++ +      + +I +THGH+D
Sbjct: 1   MKYQIIPVTPFQQNCSLIWCEKTKRAAVVDPGGNIDRIQNEVTKLGLVLDKIILTHGHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVGGA  L +  ++ IIGPH  D   +  + +Q++             D++LQDGD + +
Sbjct: 61  HVGGAKALAQAANVPIIGPHIADKFWIENLPKQSQNFGFPHC-DAFEPDQYLQDGDNVQV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGH+PGH+   + ++  A +GD LFRSSIGRTD    ++Q LI+SI  K+
Sbjct: 120 GEQSLSVLHCPGHTPGHIALFSAQSKLAWVGDILFRSSIGRTDFPQSNHQDLIHSITEKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            PLG ++ F+ GHGP ST G ER  NPF+   +
Sbjct: 180 WPLGVDVEFIPGHGPISTFGEEREHNPFVADQL 212


>gi|192289001|ref|YP_001989606.1| beta-lactamase domain protein [Rhodopseudomonas palustris TIE-1]
 gi|192282750|gb|ACE99130.1| beta-lactamase domain protein [Rhodopseudomonas palustris TIE-1]
          Length = 221

 Score =  186 bits (471), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 103/205 (50%), Positives = 138/205 (67%), Gaps = 1/205 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           I+ VTPF+QNCT L+ E + +AVVVDPGGD+  I   I+     V  IW+THGH+DHVGG
Sbjct: 14  IIPVTPFQQNCTLLWCEATRKAVVVDPGGDVPEILAAIEKTKVDVGAIWLTHGHIDHVGG 73

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           AA L++ L + +IGPH+DD  ++  V    R   I    R+ + DRWL DGD++ +G   
Sbjct: 74  AADLRDALKVEVIGPHRDDQFLLDNVVNSGRSFGI-DGVRDVTPDRWLDDGDSVSIGELN 132

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
           F++ HCPGHSPG V++ N    FA +GD LF  S+GRTD+  G +  LI SI  K+LPLG
Sbjct: 133 FQILHCPGHSPGSVVFFNDAMRFAFVGDVLFAGSVGRTDLPGGSHATLIQSITQKLLPLG 192

Query: 188 DEISFVCGHGPNSTIGRERRLNPFL 212
           D++ F+CGHGP S+ G+ER  NPFL
Sbjct: 193 DDVGFICGHGPGSSFGQERLTNPFL 217


>gi|254481006|ref|ZP_05094252.1| metallo-beta-lactamase domain protein, putative [marine gamma
           proteobacterium HTCC2148]
 gi|214038801|gb|EEB79462.1| metallo-beta-lactamase domain protein, putative [marine gamma
           proteobacterium HTCC2148]
          Length = 216

 Score =  186 bits (471), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 92/214 (42%), Positives = 135/214 (63%), Gaps = 3/214 (1%)

Query: 4   LSFH--IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGH 61
           +S    IV VTP++QNC+ +  + S +A +VDPGGD++ I + +   +  V++I +TH H
Sbjct: 1   MSIQCTIVPVTPYQQNCSIIKCQASGKAAIVDPGGDVERILEAVAKMDATVEKIILTHAH 60

Query: 62  VDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
           +DH   A  L++ L +TI GP K D   + K+ E  ++      A     DRWL DGDT+
Sbjct: 61  MDHCAAADVLRQQLQITIEGPEKADNFWLEKLPEWCKMSGFPH-ADAFEPDRWLADGDTV 119

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
            +G    +V HCPGH+PGHV++++   N A +GD LF+ SIGRTD   G+++ L+ SI  
Sbjct: 120 TVGEQTLQVLHCPGHTPGHVVFLHQAQNVAWVGDVLFQGSIGRTDFPMGNHEDLVASIRG 179

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFLKSN 215
           K+ PLGD I+F+ GHGP ST G ERR NPF+  +
Sbjct: 180 KLFPLGDNITFIPGHGPTSTFGEERRSNPFVSDS 213


>gi|197105365|ref|YP_002130742.1| glyoxalase II family protein [Phenylobacterium zucineum HLK1]
 gi|196478785|gb|ACG78313.1| glyoxalase II family protein [Phenylobacterium zucineum HLK1]
          Length = 225

 Score =  186 bits (471), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 95/207 (45%), Positives = 136/207 (65%), Gaps = 1/207 (0%)

Query: 10  QVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAA 69
            VTP +QNCT ++  ++++A V+DPGG++  +   ++ +   +++IWITHGH+DH GG A
Sbjct: 16  PVTPLQQNCTIVWCVKTMKAAVIDPGGEVPRLLQALKDQGLTLEKIWITHGHLDHAGGTA 75

Query: 70  QLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFK 129
            LKE     I GPH DDA  +  + E +       +AR+   DRWLQDGD + LG   F+
Sbjct: 76  ALKEATGAPIEGPHPDDAFWIEDI-ESSGARWGMPDARSFIPDRWLQDGDVVTLGETEFE 134

Query: 130 VFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDE 189
           V HCPGH+PGHV++ + +  FA +GD LF+ SIGRTD   G++  LI SI  K+ PLG++
Sbjct: 135 VIHCPGHTPGHVVFFHRQARFAQVGDVLFQGSIGRTDFPRGNHADLIASITKKLWPLGED 194

Query: 190 ISFVCGHGPNSTIGRERRLNPFLKSNI 216
           + FV GHGP ST G+ERR NPF+   +
Sbjct: 195 VRFVPGHGPMSTFGQERRSNPFVADAV 221


>gi|86358615|ref|YP_470507.1| putative hydrolase protein [Rhizobium etli CFN 42]
 gi|86282717|gb|ABC91780.1| putative hydrolase protein [Rhizobium etli CFN 42]
          Length = 230

 Score =  186 bits (471), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 113/214 (52%), Positives = 152/214 (71%), Gaps = 1/214 (0%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M  L   I+ VTPF+QNCT  FD ++ E VVVDPGGD+ +I   I+     +K+IW+THG
Sbjct: 1   MGMLQAGIIPVTPFQQNCTVFFDPDTQEGVVVDPGGDVPLILQAIEKSGLTIKEIWLTHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DH GGA++LKE L + ++GPH+DD  ++ +++ QA    I    RN   DRWL+DGD 
Sbjct: 61  HLDHAGGASELKEALGIEVVGPHQDDLPLLQRIETQAAKYGI-TGLRNVIPDRWLKDGDK 119

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           +  G H F+V+  PGH+PGHVIY N   NFAHLGD LF  SIGRTD+  G++QQL++SI 
Sbjct: 120 VSFGAHEFEVYRAPGHAPGHVIYFNRAQNFAHLGDVLFNGSIGRTDLPGGNHQQLLDSIR 179

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           +K+LPLGD++ F+CGHGP S IG ERR NP+L+ 
Sbjct: 180 DKVLPLGDDVGFICGHGPGSRIGDERRSNPYLQE 213


>gi|17547985|ref|NP_521387.1| hypothetical protein RSc3268 [Ralstonia solanacearum GMI1000]
 gi|17430291|emb|CAD17056.1| putative beta-lactamase-like protein [Ralstonia solanacearum
           GMI1000]
          Length = 224

 Score =  186 bits (471), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 92/213 (43%), Positives = 130/213 (61%), Gaps = 2/213 (0%)

Query: 2   SKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGH 61
           + +   +V VTPF+QNCT L  ++   A V DPGGD+D I    + +   +++I +THGH
Sbjct: 5   NHMKVVVVPVTPFEQNCTLLIGDD-GRAAVTDPGGDIDRILSAARQQGARIEKILLTHGH 63

Query: 62  VDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
           VDH   A  L+  L + I GPH+D+A  + ++  Q++       AR    DRWL DGDT+
Sbjct: 64  VDHCAAADALRTQLGVPIEGPHRDEAFWIDQLPTQSQRFGFPP-ARAFVPDRWLDDGDTV 122

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
                  +VFHCPGH+PGHV++ +  +  A +GD LF  SIGRTD   G++  LI SI  
Sbjct: 123 EAAGRTLEVFHCPGHTPGHVVFFSRPDRIAIVGDVLFAGSIGRTDFPRGNHADLIRSIRT 182

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           K+ PLGD+++FV GHGP ST G ER  NP++  
Sbjct: 183 KLWPLGDDVTFVPGHGPVSTFGDERATNPYVAD 215


>gi|237747191|ref|ZP_04577671.1| beta-lactamase domain-containing protein [Oxalobacter formigenes
           HOxBLS]
 gi|229378542|gb|EEO28633.1| beta-lactamase domain-containing protein [Oxalobacter formigenes
           HOxBLS]
          Length = 213

 Score =  186 bits (471), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 88/211 (41%), Positives = 137/211 (64%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + F I+ VTPF+QNCT ++DE + +A VVDPGGD++ I D +  RN  ++++++THGH+D
Sbjct: 1   MKFQIIPVTPFQQNCTLMWDENTNKAAVVDPGGDIEKISDALNQRNLTLEKVFVTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GGA +L +  ++ I GP+++DA ++ +++     +         + DRWL  GD + +
Sbjct: 61  HCGGARKLADLYNVPIEGPNQEDAWLLEQLNSDQTRMWGLPPGEPFTPDRWLNQGDNVTV 120

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +VFHCPGHSPGHV++ +     A  GD LF  S+GRTD+  G ++ L  SI   +
Sbjct: 121 GNETLQVFHCPGHSPGHVVFFHAPTKVAISGDVLFAGSVGRTDLPKGSFKALEKSIRENM 180

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
             LGD++ F+ GHGP S+IG+ERR N F++ 
Sbjct: 181 YKLGDDVQFIPGHGPVSSIGQERRGNAFVRD 211


>gi|119502757|ref|ZP_01624842.1| metallo-beta-lactamase family protein [marine gamma proteobacterium
           HTCC2080]
 gi|119461103|gb|EAW42193.1| metallo-beta-lactamase family protein [marine gamma proteobacterium
           HTCC2080]
          Length = 216

 Score =  186 bits (471), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 88/211 (41%), Positives = 135/211 (63%), Gaps = 1/211 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L+  IV VT ++QNC+ +  + + +A +VDPGGD++ I   ++  +  V++I +THGH+D
Sbjct: 3   LAVTIVPVTQYQQNCSIVKCQATGKAAIVDPGGDIEKILAAVEQMDAQVEKILLTHGHMD 62

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H   +  L++ L + I GP + D   + K+ E  ++ +    A     DRWL+DG+T+ +
Sbjct: 63  HCAASDVLRQRLQIPIEGPEEGDRFWIDKLPEWCQMANFPH-ADAFEPDRWLKDGETVTV 121

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   F+V HCPGH+PGHV++++     A +GD +F  SIGRTD   G++  LINSI  K+
Sbjct: 122 GEAQFQVIHCPGHTPGHVVFLHTPQKLAWVGDVIFAGSIGRTDFPMGNHDDLINSIREKL 181

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
            PLGD+I F+ GHGP+ST GRER  NPF+  
Sbjct: 182 FPLGDDIQFIPGHGPDSTFGRERASNPFVAD 212


>gi|325293561|ref|YP_004279425.1| hydrolase [Agrobacterium sp. H13-3]
 gi|325061414|gb|ADY65105.1| probable hydrolase [Agrobacterium sp. H13-3]
          Length = 222

 Score =  186 bits (471), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 115/214 (53%), Positives = 157/214 (73%), Gaps = 1/214 (0%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M KL   I+ VTPF+QNCT LFDE++ E VVVDPGGD+D+I  V+      +K+IW+THG
Sbjct: 9   MGKLQAGIIPVTPFEQNCTILFDEDTKEGVVVDPGGDVDVILQVVSENGITLKEIWLTHG 68

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DH GGA +L+E LSL +IGPH+DD  ++ +++ QA    I    +N   DRWL +GDT
Sbjct: 69  HLDHAGGAKELREKLSLPVIGPHEDDRPLLERIETQAEKYGI-SGLQNVLPDRWLNEGDT 127

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           +  G H+F+V+HCPGH+PGHVIY N +  FAH+GD LF  S+GRTD+  G+++QL+ SI 
Sbjct: 128 VSFGDHVFEVYHCPGHAPGHVIYYNRDQQFAHVGDVLFAGSVGRTDLPGGNHEQLMASIR 187

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           +K+LPLGD++ F+CGHGP   +G ERR NP+LK 
Sbjct: 188 DKLLPLGDDVGFICGHGPGGRLGEERRTNPYLKG 221


>gi|315633945|ref|ZP_07889234.1| metallo-beta-lactamase [Aggregatibacter segnis ATCC 33393]
 gi|315477195|gb|EFU67938.1| metallo-beta-lactamase [Aggregatibacter segnis ATCC 33393]
          Length = 213

 Score =  186 bits (471), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 81/213 (38%), Positives = 135/213 (63%), Gaps = 2/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           ++  I+ VT F+QNC+ ++D+E  +A ++DPGG+ + +   I+    +++ I +THGH+D
Sbjct: 1   MNIEIIPVTTFQQNCSLIWDDE-KKAAIIDPGGEAEKLIKRIEELGLNLQVILLTHGHLD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQ-DGDTLL 122
           HVG A +LK+  ++ I G +  D      + +Q+    +         DRWL  +G+TL 
Sbjct: 60  HVGAAEKLKQHFNVQIWGSNSQDDYWFKNLPQQSEKFGMLFEVSAFEPDRWLNQEGETLN 119

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
           +G   F+V H PGH+PGH+ ++  +   A  GD LF++ IGRTD   G Y+++++SI NK
Sbjct: 120 IGDFTFEVLHLPGHTPGHIGFIEHQKRIAFTGDVLFKNGIGRTDFPGGSYEEILSSIRNK 179

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFLKSN 215
           + PLGD++  V GHGP +TIG E+R NP++K++
Sbjct: 180 LYPLGDDMIVVPGHGPYTTIGEEKRTNPYVKAS 212


>gi|254501195|ref|ZP_05113346.1| metallo-beta-lactamase superfamily, putative [Labrenzia alexandrii
           DFL-11]
 gi|222437266|gb|EEE43945.1| metallo-beta-lactamase superfamily, putative [Labrenzia alexandrii
           DFL-11]
          Length = 232

 Score =  185 bits (470), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 99/212 (46%), Positives = 140/212 (66%), Gaps = 1/212 (0%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M  +   IV VT F+QNC+ +++  ++   VVDPGGD+D I   ++ +   V++I +THG
Sbjct: 21  MPPIQIMIVPVTGFQQNCSVIWNPATMVGAVVDPGGDVDTIMAAVKEKGVKVEKIVLTHG 80

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DH+GGAA L E LS+ + GPH+ D  ++ +V +QA        A+  S D+W+Q+GD 
Sbjct: 81  HIDHIGGAADLAERLSVPVEGPHEADQPLIDRVADQAAQF-GMGEAKPVSPDKWMQEGDV 139

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           L +    F V HCPGHSPGH+++++ E   A  GD LF  SIGRTD+  G ++ LI SI 
Sbjct: 140 LTMAGREFDVLHCPGHSPGHLVFIDKELRLAISGDVLFAGSIGRTDLPGGSHETLIKSIT 199

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
            K+LPLGD+ISF+ GHGP ST G ER+ NPFL
Sbjct: 200 EKLLPLGDDISFLPGHGPASTFGHERQTNPFL 231


>gi|90407611|ref|ZP_01215792.1| putative metallo-beta-lactamase family protein [Psychromonas sp.
           CNPT3]
 gi|90311314|gb|EAS39418.1| putative metallo-beta-lactamase family protein [Psychromonas sp.
           CNPT3]
          Length = 209

 Score =  185 bits (470), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 77/210 (36%), Positives = 135/210 (64%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +   ++ VTPF+QNC+ +  E++ +A +VDPGGD+  I DV++ +N  + ++ +THGH+D
Sbjct: 1   MKIIVIPVTPFEQNCSLIICEQTNKAAIVDPGGDVQRILDVVKQQNVIIDKVILTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVGGA ++   L ++IIGP K+D   +  ++EQ++     M+  +   ++WL++G+ + +
Sbjct: 61  HVGGAQRIANKLKVSIIGPEKEDLFWLESLEEQSQHFGFPMHT-SFLPEKWLEEGEIVNV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V H PGH+PGH+  ++ ++    +GD LF  ++GR+D   GD+ QLI  I +K+
Sbjct: 120 GNIKLQVLHIPGHTPGHIALLDEQSQQVIVGDILFCGAVGRSDFPRGDHNQLIRGIKSKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           L L        GHGP ++I +E+R NP+L+
Sbjct: 180 LTLPGATLVYPGHGPITSIAKEKRSNPYLR 209


>gi|119900112|ref|YP_935325.1| hypothetical protein azo3823 [Azoarcus sp. BH72]
 gi|119672525|emb|CAL96439.1| conserved hypothetical protein [Azoarcus sp. BH72]
          Length = 252

 Score =  185 bits (470), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 93/212 (43%), Positives = 135/212 (63%), Gaps = 1/212 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L   IV VT F+QNC+ L+ + S++A VVDPGGDL+ I   ++     V++I ITHGH+D
Sbjct: 41  LQIQIVPVTAFEQNCSILWCDRSMKAAVVDPGGDLERIHAAVKKLGVSVEKILITHGHID 100

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GG A+L  DL + + GP ++D   +  + +Q+++            DRWL DGDT+ +
Sbjct: 101 HAGGTARLARDLGVPVEGPQQEDRFWIVAMPQQSKMFGFPD-VEAFEPDRWLGDGDTVSV 159

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V H PGH+PGHV++   E   A +GD LF  SIGRTD   G++ +LI+SI NK+
Sbjct: 160 GEETLQVIHAPGHTPGHVVFFQPEARLAVVGDVLFAGSIGRTDFPRGNHAELISSIRNKL 219

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSN 215
            PLGD+++F+ GHGP ST G ER  NP++  +
Sbjct: 220 FPLGDDVTFIPGHGPASTFGDERDSNPYVGDH 251


>gi|290473858|ref|YP_003466732.1| metallo-hydrolase/oxidoreductase domain-containing protein
           [Xenorhabdus bovienii SS-2004]
 gi|289173165|emb|CBJ79938.1| putative enzyme with metallo-hydrolase/oxidoreductase domain
           [Xenorhabdus bovienii SS-2004]
          Length = 210

 Score =  185 bits (470), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 90/211 (42%), Positives = 135/211 (63%), Gaps = 1/211 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++HI+ VT   QNCT ++ EE+LEA +VDPGG+ + +   I+ R   + QI +THGH D
Sbjct: 1   MNYHIIPVTTVMQNCTLIWCEETLEAAIVDPGGEAEKLISEIEQRGLKLTQILLTHGHYD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG    +    ++ + GPHK DA  +  ++ Q ++  +     + + +RWL +GDTL +
Sbjct: 61  HVGATVDVATHFNVPVHGPHKADAFWIEALEVQCQMFGVEAC-PSFTPERWLDEGDTLQI 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   F V HCPGH+PGH+I+V+  +    +GD LF+ SIGRTD   G+Y  LI SI  K+
Sbjct: 120 GNIEFSVLHCPGHTPGHIIFVSHTDKLISMGDVLFKGSIGRTDFPGGNYDDLIQSIKEKV 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           +P+GD+  F+ GHG  ST+G ER+ NPFL+ 
Sbjct: 180 IPIGDDFHFIPGHGSMSTLGHERKTNPFLQD 210


>gi|284007572|emb|CBA73118.1| metallo-beta-lactamase superfamily protein [Arsenophonus nasoniae]
          Length = 210

 Score =  185 bits (469), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 90/211 (42%), Positives = 134/211 (63%), Gaps = 1/211 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + F I+ VT F+QNCT ++DE SL+AV+VDPGG+   +   I+ R+ ++  I +THGH D
Sbjct: 1   MKFKIIPVTDFRQNCTLIWDENSLDAVIVDPGGEAAKLIAEIEKRSLNLHYILLTHGHFD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG  A++    S+ I GP K+D  ++  +  Q+++  +     + + DR+LQ+GD +  
Sbjct: 61  HVGACAEIAAHFSVPIYGPQKEDEFLIKGLAVQSQMFGVAQC-PDFTPDRYLQEGDEIRF 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
                 V HCPGH+PGH+I+VN  +    +GD LF+ S+GRTD   GD+  LI+SI  KI
Sbjct: 120 ADIKLSVLHCPGHTPGHIIFVNHADKLISMGDVLFQGSVGRTDFPQGDHATLIHSIKTKI 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           LPLGD+  F+ GHG  S +  ER+ NPFL+ 
Sbjct: 180 LPLGDDYQFIPGHGAMSNLAAERQFNPFLQD 210


>gi|300114071|ref|YP_003760646.1| metallo-beta-lactamase family protein [Nitrosococcus watsonii
           C-113]
 gi|299540008|gb|ADJ28325.1| metallo-beta-lactamase family protein [Nitrosococcus watsonii
           C-113]
          Length = 219

 Score =  185 bits (469), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 91/209 (43%), Positives = 130/209 (62%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + F I+ VT F QNCT L   ES +A VVDPGGD++ I + ++     ++++ +THGH+D
Sbjct: 1   MKFEILPVTRFMQNCTLLSCAESGKAAVVDPGGDVEKILEKVEVNRLKIEKVLLTHGHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GGA +L   L + I GP  +D   +  +  Q+ +       +    DRWL+  DT+  
Sbjct: 61  HAGGAGELAHRLEVPIEGPQIEDEFWINSLPAQSEMFGFPP-VKAFVPDRWLEQRDTVSF 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G  +  V+HCPGH+PGHVI+ + ++  A +GD LF+ SIGRTD   GDY  LI SI  ++
Sbjct: 120 GKVVLNVYHCPGHTPGHVIFFHPDSRLALVGDVLFKGSIGRTDFPRGDYDALIRSIRERL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
            PLGDE+ F+ GHGP ST G ER+ NPF+
Sbjct: 180 FPLGDEVRFIPGHGPMSTFGEERQSNPFV 208


>gi|257093969|ref|YP_003167610.1| beta-lactamase domain-containing protein [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
 gi|257046493|gb|ACV35681.1| beta-lactamase domain protein [Candidatus Accumulibacter phosphatis
           clade IIA str. UW-1]
          Length = 210

 Score =  185 bits (469), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 89/208 (42%), Positives = 133/208 (63%), Gaps = 1/208 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + I+ VTPF+QNC+ L+ E++    VVDPGGD+  I   +++    +++I +THGH+D
Sbjct: 1   MKYQIIPVTPFEQNCSLLWCEQTKRGAVVDPGGDVSRILRAVEANGVQLEKILVTHGHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H G  A+L   LSL I GP  +D   +  +  Q+++     N R  + DRWL+ GD++  
Sbjct: 61  HAGAVAELAARLSLPIEGPQCEDKFWIDGMPAQSKMFGF-PNVRAFTPDRWLEQGDSVSF 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGH+PGHV++ +     A +GD LF+ SIGRTD   GD+  LI+SI +++
Sbjct: 120 GNVEMDVLHCPGHTPGHVVFFDKRGRLAVVGDVLFQGSIGRTDFPKGDFDTLISSIRHRL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPF 211
            PLG++++F+ GHGP ST G ERR NPF
Sbjct: 180 WPLGNDVAFIPGHGPMSTFGAERRSNPF 207


>gi|118591838|ref|ZP_01549233.1| probable hydrolase [Stappia aggregata IAM 12614]
 gi|118435481|gb|EAV42127.1| probable hydrolase [Stappia aggregata IAM 12614]
          Length = 229

 Score =  185 bits (469), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 96/212 (45%), Positives = 139/212 (65%), Gaps = 1/212 (0%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M  +   ++ VTPF+QNC+ ++D  ++   VVDPGGD+D I   ++ +   V++I +THG
Sbjct: 18  MPPIQVMVLAVTPFQQNCSLIWDPSTMRGTVVDPGGDVDKILAAVKKQGVKVEKIVLTHG 77

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DHVGGAA L E L + + GPH+ D  ++ +V +QA    +    +  + DRW+ +GD 
Sbjct: 78  HIDHVGGAADLAEALKVPVEGPHEADQMLIDRVADQAVQFGV-EGVKPVTPDRWMVEGDQ 136

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           + +   +F V HCPGHSPGH+++ + E  FA  GD LF  SIGRTD+  GD+  LI SI 
Sbjct: 137 VEIAGRMFDVLHCPGHSPGHLVFFDKELRFAISGDVLFAGSIGRTDLPGGDHATLIKSIR 196

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
            K+LPLGD+++F+ GHG  STIG ER  NPFL
Sbjct: 197 EKLLPLGDDVAFLPGHGQASTIGHERETNPFL 228


>gi|262374077|ref|ZP_06067354.1| metallo-beta-lactamase superfamily protein [Acinetobacter junii
           SH205]
 gi|262311088|gb|EEY92175.1| metallo-beta-lactamase superfamily protein [Acinetobacter junii
           SH205]
          Length = 214

 Score =  185 bits (469), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 90/209 (43%), Positives = 129/209 (61%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L   IV VT F QNC+ L+D ES EAV++D GGD  ++K  +++    VK +W+THGH+D
Sbjct: 2   LQVKIVPVTAFAQNCSILWDSESKEAVLIDAGGDAAVLKKEVEALGLTVKALWLTHGHLD 61

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H G   +L E   + +IGPHK+D   +  + E +         +    D+WL+ G+TL L
Sbjct: 62  HAGAVGELAEAWKIPVIGPHKEDQFWLDMIQEVSARYGF-PIPQPVKVDQWLEGGETLKL 120

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   F+V   PGH+PGHV++ N ++     GD LF+ SIGRTD   G++QQL++SI  + 
Sbjct: 121 GEDEFEVRFAPGHTPGHVMFYNQKHGLLWTGDVLFKGSIGRTDFPKGNHQQLLDSIKREC 180

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
             L DE  F+ GHGP STIG E++ NPF+
Sbjct: 181 FSLPDETQFISGHGPISTIGYEKQFNPFV 209


>gi|226951881|ref|ZP_03822345.1| beta-lactamase domain-containing protein [Acinetobacter sp. ATCC
           27244]
 gi|294649138|ref|ZP_06726580.1| metallo-beta-lactamase [Acinetobacter haemolyticus ATCC 19194]
 gi|226837421|gb|EEH69804.1| beta-lactamase domain-containing protein [Acinetobacter sp. ATCC
           27244]
 gi|292825021|gb|EFF83782.1| metallo-beta-lactamase [Acinetobacter haemolyticus ATCC 19194]
          Length = 214

 Score =  185 bits (469), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 86/209 (41%), Positives = 127/209 (60%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L   IV VT F QNC+ L+D E+ EA+++D GGD  ++K  ++     VK +W+THGH+D
Sbjct: 2   LQVKIVPVTAFAQNCSILWDSETKEAILIDAGGDAAVLKKEVEDLGLKVKALWLTHGHLD 61

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H G   +L E   + +IGPHK+D   +  + E +         +    ++WL+ G+ L L
Sbjct: 62  HAGAVGELAEAWKIPVIGPHKEDQFWLDMIQEVSARYGF-PIPQPVKVNQWLEGGEVLKL 120

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   F+V   PGH+PGHV++ N ++     GD LF+ SIGRTD   G++QQL++SI  + 
Sbjct: 121 GEDEFEVRFAPGHTPGHVMFYNKKHGLLWTGDVLFKGSIGRTDFPRGNHQQLLDSIQREC 180

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
             L DE  F+ GHGP STIG E++ NPF+
Sbjct: 181 FSLPDETQFISGHGPISTIGYEKQFNPFV 209


>gi|209965760|ref|YP_002298675.1| metallo-beta-lactamase superfamily [Rhodospirillum centenum SW]
 gi|209959226|gb|ACI99862.1| metallo-beta-lactamase superfamily [Rhodospirillum centenum SW]
          Length = 237

 Score =  185 bits (469), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 87/209 (41%), Positives = 126/209 (60%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L   ++ VTPF QNC+ L+   +  A VVDPGG +  I + ++     V++I +THGHVD
Sbjct: 21  LRVAVIPVTPFAQNCSLLWCTATRRAAVVDPGGGVPTILEAVRRHGLTVERILVTHGHVD 80

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H    A L E L + + GP + D   + ++            AR  + DRWL DGDT+ +
Sbjct: 81  HAAAVADLAERLKVPVEGPGRQDDYWIAELAGHGAAY-GMPYARPFTPDRWLGDGDTVTV 139

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGHV++ +  + FA +GD LFR S+GRTD   G ++ L  SI  K+
Sbjct: 140 GALTLQVLHCPGHTPGHVVFFHAPSRFAVVGDVLFRGSVGRTDFPGGSFEALAASIRGKL 199

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
            PLGD+++F+ GHG  ST G+ER+ NPF+
Sbjct: 200 FPLGDDVTFLPGHGETSTFGQERQGNPFV 228


>gi|120608985|ref|YP_968663.1| beta-lactamase domain-containing protein [Acidovorax citrulli
           AAC00-1]
 gi|120587449|gb|ABM30889.1| beta-lactamase domain protein [Acidovorax citrulli AAC00-1]
          Length = 240

 Score =  184 bits (468), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 94/211 (44%), Positives = 132/211 (62%), Gaps = 1/211 (0%)

Query: 2   SKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGH 61
             L +H   VT F+QNC+ ++ + +  A V+DPGGDLD +   ++ R   ++QIW+TH H
Sbjct: 28  PMLHYHTHPVTAFQQNCSLVWCDATQAAAVIDPGGDLDQVLAEVERRGLRLEQIWLTHAH 87

Query: 62  VDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
           +DH GGA +L E LSL I GPH  D   +  + +Q+ +      AR  +  RWL DGDT+
Sbjct: 88  IDHAGGAGELAERLSLPITGPHPGDQFWIDGLPQQSAMFGFPP-ARPFTPTRWLHDGDTV 146

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
            +G     V HCPGH+PGHV++   +     +GD LF  SIGRTD   G++Q LI+SI  
Sbjct: 147 QIGNETLHVRHCPGHTPGHVVFHAPQIQRCFVGDVLFAGSIGRTDFPQGNHQDLIDSIVQ 206

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           ++ P+GDE  F+ GHGP ST GRERR NP++
Sbjct: 207 RLWPMGDETVFIPGHGPESTFGRERRSNPYV 237


>gi|170727296|ref|YP_001761322.1| beta-lactamase domain-containing protein [Shewanella woodyi ATCC
           51908]
 gi|169812643|gb|ACA87227.1| beta-lactamase domain protein [Shewanella woodyi ATCC 51908]
          Length = 214

 Score =  184 bits (468), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 88/213 (41%), Positives = 140/213 (65%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + I+ VTPF+QNC+ ++ +E+++A V+DPGGD+D I   ++     ++++++THGH+D
Sbjct: 1   MKYQIIPVTPFQQNCSLVWCDETMKAAVIDPGGDIDRILSEVKKLGVSLEKVFLTHGHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVGGA QL E L++ IIGPHK D   +  + EQ++   ++      +S ++L+DGD++ +
Sbjct: 61  HVGGAKQLSEQLNIPIIGPHKADIFWLDNLVEQSQHFGLKAC-EPFTSTQYLEDGDSVTI 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGHV++   +   A +GD LF  S+GRTD    ++  LI SI  K+
Sbjct: 120 GNLTLQVLHCPGHTPGHVVFFCEKAKTAWVGDVLFHGSVGRTDFPQSNHDDLILSITKKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            PLG ++ F+ GHGP ST G ER  NPF+   +
Sbjct: 180 WPLGRDVEFIPGHGPISTFGSERDQNPFVADQL 212


>gi|116253200|ref|YP_769038.1| beta-lactamase family protein [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115257848|emb|CAK08946.1| putative beta-lactamase family protein [Rhizobium leguminosarum bv.
           viciae 3841]
          Length = 214

 Score =  184 bits (468), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 115/214 (53%), Positives = 152/214 (71%), Gaps = 1/214 (0%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M  L   I+ VTPF+QNCT  FD ++ E VVVDPGGD+ +I   I      +K+IW+THG
Sbjct: 1   MGMLQAGIIPVTPFQQNCTIFFDPDTKEGVVVDPGGDVPLILQAITQNGLTIKEIWLTHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DH GGA++LKE L + ++GPH+DD  ++ +++ QA    I    R+   DRWL+DGD 
Sbjct: 61  HLDHAGGASELKEALGIDVVGPHQDDLPLLQRIETQAEKYGI-SGLRDVVPDRWLKDGDK 119

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           +  G H F+V+H PGH+PGHVIY N   NFAHLGD LF  SIGRTD+  G++QQL++SI 
Sbjct: 120 ISFGAHEFEVYHTPGHAPGHVIYFNRAQNFAHLGDVLFNGSIGRTDLPGGNHQQLLDSIR 179

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           +K+LPLGD++ F+CGHGP S IG ERR NPFLK 
Sbjct: 180 DKVLPLGDDVGFICGHGPGSRIGDERRSNPFLKE 213


>gi|225025591|ref|ZP_03714783.1| hypothetical protein EIKCOROL_02493 [Eikenella corrodens ATCC
           23834]
 gi|224941629|gb|EEG22838.1| hypothetical protein EIKCOROL_02493 [Eikenella corrodens ATCC
           23834]
          Length = 212

 Score =  184 bits (468), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 87/212 (41%), Positives = 127/212 (59%), Gaps = 1/212 (0%)

Query: 3   KLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHV 62
            L+  +  VTPF+QNC+ L+DEES EAV +D GGD+  + +         K IW+THGH+
Sbjct: 2   PLNLTVFAVTPFRQNCSLLWDEESKEAVWIDVGGDVPQLLEEAAKLGVQPKAIWLTHGHL 61

Query: 63  DHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLL 122
           DH GG  ++ +   L +IGPH+DD  ++  + E        ++A   S  RWL++GD L 
Sbjct: 62  DHAGGVTEMIQHTQLPVIGPHRDDQWLLDNLPEITANFGFPVSA-PVSPSRWLEEGDELS 120

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
           +G + F+V H PGH+PGHV++   E N    GD LF  SIGRTD     +  L+ +I  K
Sbjct: 121 VGAYRFQVLHIPGHTPGHVVFYCAEQNLLIAGDVLFYESIGRTDFERSSHADLLRNIREK 180

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           +L L ++   + GHG ++TIG E+R NPFL+ 
Sbjct: 181 LLVLPEDTIVLPGHGRSTTIGHEKRHNPFLQD 212


>gi|239832398|ref|ZP_04680727.1| beta-lactamase domain-containing protein [Ochrobactrum intermedium
           LMG 3301]
 gi|239824665|gb|EEQ96233.1| beta-lactamase domain-containing protein [Ochrobactrum intermedium
           LMG 3301]
          Length = 218

 Score =  184 bits (468), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 113/214 (52%), Positives = 141/214 (65%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M +L   IV VTPF+QNCT LFD E+ + VV+DPGGDLD I D I S+   V+ IWITHG
Sbjct: 1   MGQLQAIIVPVTPFQQNCTILFDSETKKGVVIDPGGDLDRILDAIGSQGVEVEAIWITHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DH G A  LKE L + IIGPHKDD  ++  +        +    RN + DRWL +GD 
Sbjct: 61  HIDHAGAALDLKEALDVDIIGPHKDDKFLLDNLATTGLKYGLTEGVRNVTPDRWLNEGDK 120

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           + +  H F+VFH PGH+PGHV++ N E  FA +GD LF  S+GRTD+  GD+  LI SI 
Sbjct: 121 VSVAGHEFEVFHTPGHAPGHVVFFNPEARFAIVGDVLFNGSVGRTDLPGGDHAALIRSIK 180

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
            K+LPLGD+I F+CGHGP    G ERR NPFL  
Sbjct: 181 EKLLPLGDDIGFICGHGPGGRFGEERRSNPFLND 214


>gi|91974616|ref|YP_567275.1| beta-lactamase-like [Rhodopseudomonas palustris BisB5]
 gi|91681072|gb|ABE37374.1| beta-lactamase-like [Rhodopseudomonas palustris BisB5]
          Length = 222

 Score =  184 bits (468), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 100/209 (47%), Positives = 142/209 (67%), Gaps = 1/209 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           I+ VTPF+QNCT L+ E + +AVVVDPGGD+  I   I+     V++IW+THGH+DHVGG
Sbjct: 15  IIPVTPFQQNCTLLWCEATRKAVVVDPGGDVPEILAAIEKTGVSVEKIWLTHGHIDHVGG 74

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           AA+L++ L + I GPH+DD  ++  V    R   I    R+ + DRWL  GD++ +G   
Sbjct: 75  AAELRDALGVQIEGPHRDDLFLLENVVNSGRSFGI-GGVRDVTPDRWLDHGDSVSVGELT 133

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
           F++ HCPGHSPG V++ N    FA +GD LF  S+GRTD+  G++  LI+SI +++LPLG
Sbjct: 134 FQILHCPGHSPGSVVFFNDAMRFALVGDVLFAGSVGRTDLPGGNHATLISSITDRLLPLG 193

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           D++ F+CGHG  S+ G+ER  NPFL   +
Sbjct: 194 DDVGFICGHGAGSSFGQERLTNPFLNGAM 222


>gi|262370033|ref|ZP_06063360.1| beta-lactamase domain-containing protein [Acinetobacter johnsonii
           SH046]
 gi|262315072|gb|EEY96112.1| beta-lactamase domain-containing protein [Acinetobacter johnsonii
           SH046]
          Length = 214

 Score =  184 bits (467), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 87/209 (41%), Positives = 126/209 (60%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L   IV VT F+QNC+ ++D +S EA+++D GG+ + +K  I++    VK +W+THGH+D
Sbjct: 2   LQVKIVPVTAFQQNCSIVWDSDSKEAILIDAGGEPEKLKAEIEALGLTVKALWLTHGHLD 61

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H G    LK+   + +IGPHK+DA  +  + E ++               WL+ G+ L L
Sbjct: 62  HAGAVGALKKLWDVPVIGPHKEDAFWLDMIQEVSQRYGF-PIPEKVDVTTWLEGGEVLKL 120

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   F+V   PGH+PGHV++ N        GD LF+ SIGRTD   G++QQLI+SI  + 
Sbjct: 121 GNEAFEVRFAPGHTPGHVMFYNKNYGLLWTGDVLFKGSIGRTDFPRGNHQQLIDSIQREC 180

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
             L DE  F+ GHGP STIG E++ NPF+
Sbjct: 181 FSLPDETQFISGHGPISTIGFEKQHNPFV 209


>gi|209550332|ref|YP_002282249.1| beta-lactamase [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|209536088|gb|ACI56023.1| beta-lactamase domain protein [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 217

 Score =  184 bits (467), Expect = 7e-45,   Method: Composition-based stats.
 Identities = 115/214 (53%), Positives = 152/214 (71%), Gaps = 1/214 (0%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M  L   ++ VTPF+QNCT  FD E+ E VVVDPGGD+ +I   I      +K+IW+THG
Sbjct: 1   MGMLQAGVIPVTPFQQNCTIFFDPETKEGVVVDPGGDVPLILQAIAQNGLIIKEIWLTHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DH GGA++LKE L + ++GPH+DD  ++ +++ QA    I    RN   DRWL+DGD 
Sbjct: 61  HLDHAGGASELKEALGIDVVGPHQDDLPLLQRIETQAEKYGISG-LRNVLPDRWLKDGDK 119

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           +  G H F+V+H PGH+PGHVIY N   NFAHLGD LF  SIGRTD+  G++QQL++SI 
Sbjct: 120 ISFGDHEFEVYHAPGHAPGHVIYFNRAQNFAHLGDVLFNGSIGRTDLPGGNHQQLLDSIR 179

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           +K+LPLGD++ F+CGHGP S IG ERR NPFL+ 
Sbjct: 180 DKVLPLGDDVGFICGHGPGSRIGDERRSNPFLQE 213


>gi|254787816|ref|YP_003075245.1| Zn-dependent Hydrolase, including glyoxylase [Teredinibacter
           turnerae T7901]
 gi|237684880|gb|ACR12144.1| Zn-dependent Hydrolase, including glyoxylase [Teredinibacter
           turnerae T7901]
          Length = 215

 Score =  184 bits (467), Expect = 7e-45,   Method: Composition-based stats.
 Identities = 97/212 (45%), Positives = 138/212 (65%), Gaps = 1/212 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L + I  VTP++QNC+ ++ +++  A V+DPGGD+  I  ++   + HV++I +THGH+D
Sbjct: 2   LQYRIQPVTPYQQNCSVIWCDQTGSAAVIDPGGDIASITGLLDRLDIHVEKIILTHGHLD 61

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVGG A+LK  L + +IGPH+ D   +  + +QAR+++        + DRWL DGD + L
Sbjct: 62  HVGGTAELKAALEVPVIGPHQGDGFWLSALADQARMMNFAP-VPPFNPDRWLNDGDQIAL 120

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGHV+     +  A +GD LF  SIGRTD   GD+  LI SI  K+
Sbjct: 121 GKLTLEVLHCPGHTPGHVVLFEKHSKMAFVGDVLFAGSIGRTDFPRGDHASLIASIREKL 180

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSN 215
            PLGD+I+FV GHGP ST G ERR NPF+  +
Sbjct: 181 FPLGDDITFVPGHGPTSTFGEERRTNPFVSDS 212


>gi|121592662|ref|YP_984558.1| beta-lactamase domain-containing protein [Acidovorax sp. JS42]
 gi|120604742|gb|ABM40482.1| beta-lactamase domain protein [Acidovorax sp. JS42]
          Length = 212

 Score =  184 bits (467), Expect = 7e-45,   Method: Composition-based stats.
 Identities = 95/209 (45%), Positives = 138/209 (66%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L +H V VTPF+QNC+ ++ +++ +A V+DPGGDLD++    Q    H+K IW+TH H+D
Sbjct: 2   LQYHTVPVTPFQQNCSLVWCDQTQDAAVIDPGGDLDVLLAEAQRLGLHLKAIWLTHAHID 61

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GG  +L + L L IIGPH+ D   +  + +Q+ +      A+  +  RWL DGDT+ +
Sbjct: 62  HAGGTGELAQRLHLPIIGPHEGDQYWIDGLAQQSAMFGFAP-AQPFTPTRWLHDGDTVAI 120

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGH+PGHV++   + + A +GD LF  SIGRTD   G++QQLI+SI  ++
Sbjct: 121 GHESLSVRHCPGHTPGHVVFHAPQIDRAFVGDVLFAGSIGRTDFPGGNHQQLIDSITQRL 180

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
            P+GD+  F+ GHGP ST GRERR NP++
Sbjct: 181 WPMGDQTVFIPGHGPESTFGRERRSNPYV 209


>gi|78223870|ref|YP_385617.1| Beta-lactamase-like [Geobacter metallireducens GS-15]
 gi|78195125|gb|ABB32892.1| Beta-lactamase-like protein [Geobacter metallireducens GS-15]
          Length = 209

 Score =  184 bits (466), Expect = 8e-45,   Method: Composition-based stats.
 Identities = 80/211 (37%), Positives = 108/211 (51%), Gaps = 2/211 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + F IV V P   NC  L  EE+ E VVVDPG D   I D +++    ++ +  THGH D
Sbjct: 1   MIFEIVVVGPMGVNCFILGCEETKEGVVVDPGADAGRILDRVRALGLTIRTVINTHGHFD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+GG   + E     ++  H+DD   + +  + A    +   A +   D  L+DG T+  
Sbjct: 61  HIGGNKAVLEATGGRLM-IHRDDVHFLSRAADVAANYGLST-ANSPPPDELLEDGMTVTF 118

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    KVFH PGH+PG              GDTLF  S+GRTD     ++ LI SI  K+
Sbjct: 119 GKCAMKVFHTPGHTPGGCCLYLEGEGKVITGDTLFAESVGRTDFPGSSHEALITSIRTKL 178

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           LPL DE     GHG  S+IGRE+  NP+L  
Sbjct: 179 LPLPDETQVFPGHGEASSIGREKLYNPYLNG 209


>gi|241766992|ref|ZP_04764784.1| beta-lactamase domain protein [Acidovorax delafieldii 2AN]
 gi|241362505|gb|EER58414.1| beta-lactamase domain protein [Acidovorax delafieldii 2AN]
          Length = 212

 Score =  184 bits (466), Expect = 9e-45,   Method: Composition-based stats.
 Identities = 93/209 (44%), Positives = 136/209 (65%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L +H V VTPF+QNC+ ++ + +  A V+DPGGDLD +   ++ R   ++QIW+TH H+D
Sbjct: 2   LQYHTVPVTPFQQNCSIVWCDATRRAAVIDPGGDLDTVLAEVERRGLTLEQIWLTHAHID 61

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GGA +L +   L I+GPH  D   +  + +Q+ +      A++ S  RWL DGD + +
Sbjct: 62  HAGGAGELAQRKQLPIVGPHPGDQFWIDGLPQQSAMFGFAP-AQHFSPTRWLHDGDQVQI 120

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGH+PGHV++   + + A +GD LF  SIGRTD   G++QQLI+SI  ++
Sbjct: 121 GNETLNVRHCPGHTPGHVVFHAPQIDRAFVGDVLFAGSIGRTDFPQGNHQQLIDSITQRL 180

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
            P+GD+  F+ GHGP ST GRERR NP++
Sbjct: 181 WPMGDQTVFIPGHGPESTFGRERRSNPYV 209


>gi|317047574|ref|YP_004115222.1| hypothetical protein Pat9b_1345 [Pantoea sp. At-9b]
 gi|316949191|gb|ADU68666.1| conserved hypothetical protein [Pantoea sp. At-9b]
          Length = 209

 Score =  184 bits (466), Expect = 9e-45,   Method: Composition-based stats.
 Identities = 87/210 (41%), Positives = 132/210 (62%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++ I+ VT F QNC+ ++ +++ +A +VDPGGD   I  V+  R     QI +THGH+D
Sbjct: 1   MNYLIIPVTAFSQNCSVIWGDDTQQAALVDPGGDAATIIAVLAERGITPAQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L     + I+GP   DA  +  +  Q+R+  +   A   + DRWL++G+T+ +
Sbjct: 61  HVGAAAELAAHYQVPIVGPQLLDAFWLEALPTQSRMFGLPECA-PLTPDRWLEEGETVQV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGH+++ +        GD +F   +GRTD   G +  LI +I  K+
Sbjct: 120 GEVTLEVLHCPGHTPGHIVFFDRAGRLLISGDVIFNGGVGRTDFPQGSHSDLIAAIKTKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           LPLGD+++FV GHGP ST+GRER  NPFL+
Sbjct: 180 LPLGDDVTFVPGHGPISTLGRERISNPFLQ 209


>gi|153001267|ref|YP_001366948.1| beta-lactamase domain-containing protein [Shewanella baltica OS185]
 gi|151365885|gb|ABS08885.1| beta-lactamase domain protein [Shewanella baltica OS185]
          Length = 214

 Score =  184 bits (466), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 89/213 (41%), Positives = 133/213 (62%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + I+ VTPF+QNC+ ++ E++  A VVDPGG++D I++ +      + +I +THGH+D
Sbjct: 1   MKYQIIPVTPFQQNCSLMWCEKTKRAAVVDPGGNIDRIQNEVTKLGLVLDKIILTHGHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVGGA  L +  ++ IIGPH  D   +  + +Q++             D++LQDGD + +
Sbjct: 61  HVGGAKALAQATNVPIIGPHIADKFWIDNLPKQSQNFGFPHC-DAFEPDQYLQDGDNVQV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGH+PGH+   + ++  A +GD LFRSSIGRTD    ++Q LI+SI  K+
Sbjct: 120 GEQSLSVLHCPGHTPGHIALFSAQSKLAWVGDILFRSSIGRTDFPQSNHQDLIHSITEKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            PLG E+ F+ GHGP ST G ER  NPF+   +
Sbjct: 180 WPLGVEVEFIPGHGPISTFGEEREHNPFVADQL 212


>gi|301156056|emb|CBW15527.1| predicted metal-binding enzyme [Haemophilus parainfluenzae T3T1]
          Length = 209

 Score =  184 bits (466), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 77/210 (36%), Positives = 132/210 (62%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           ++  I+ VT F+QNC+ ++D+E   A ++DPGG+ + +   I+    ++K + +THGH+D
Sbjct: 1   MNIEIIPVTAFQQNCSLIWDDE-KNAAIIDPGGNAENLIQRIEELELNLKAVLLTHGHLD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG A  +++  ++ I G  ++D  +   + +Q++   +   +       + Q+G+ + +
Sbjct: 60  HVGAAEAIRDHFNIEIWGSQEEDRFLFESLPQQSQQFGLPYISAFTPDRWFNQEGEKIQI 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   F++ H PGH+PGH+ ++  E N A  GD LF++SIGRTD   GD+  LI+SI NK+
Sbjct: 120 GAFTFEILHLPGHTPGHIGFIEHEKNIAFTGDVLFQNSIGRTDFPRGDFDTLISSIKNKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
             L D++  + GHGP +TIG+E+R NPFLK
Sbjct: 180 FTLNDDMVVIAGHGPYTTIGQEKRSNPFLK 209


>gi|62290404|ref|YP_222197.1| metallo-beta-lactamase family protein [Brucella abortus bv. 1 str.
           9-941]
 gi|82700326|ref|YP_414900.1| beta-lactamase-like protein [Brucella melitensis biovar Abortus
           2308]
 gi|189024631|ref|YP_001935399.1| Beta-lactamase-like protein [Brucella abortus S19]
 gi|237815909|ref|ZP_04594906.1| metallo-beta-lactamase family protein [Brucella abortus str. 2308
           A]
 gi|254697846|ref|ZP_05159674.1| Beta-lactamase-like protein [Brucella abortus bv. 2 str. 86/8/59]
 gi|254730737|ref|ZP_05189315.1| Beta-lactamase-like protein [Brucella abortus bv. 4 str. 292]
 gi|260546941|ref|ZP_05822680.1| beta-lactamase domain-containing protein [Brucella abortus NCTC
           8038]
 gi|260758456|ref|ZP_05870804.1| beta-lactamase domain-containing protein [Brucella abortus bv. 4
           str. 292]
 gi|260762282|ref|ZP_05874625.1| beta-lactamase domain-containing protein [Brucella abortus bv. 2
           str. 86/8/59]
 gi|62196536|gb|AAX74836.1| metallo-beta-lactamase family protein [Brucella abortus bv. 1 str.
           9-941]
 gi|82616427|emb|CAJ11490.1| Beta-lactamase-like [Brucella melitensis biovar Abortus 2308]
 gi|189020203|gb|ACD72925.1| Beta-lactamase-like protein [Brucella abortus S19]
 gi|237789207|gb|EEP63418.1| metallo-beta-lactamase family protein [Brucella abortus str. 2308
           A]
 gi|260095991|gb|EEW79868.1| beta-lactamase domain-containing protein [Brucella abortus NCTC
           8038]
 gi|260668774|gb|EEX55714.1| beta-lactamase domain-containing protein [Brucella abortus bv. 4
           str. 292]
 gi|260672714|gb|EEX59535.1| beta-lactamase domain-containing protein [Brucella abortus bv. 2
           str. 86/8/59]
          Length = 218

 Score =  184 bits (466), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 109/214 (50%), Positives = 143/214 (66%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M +L   IV VTPF+QNCT LFD E+ + VV+DPGGDL  I++ I+S+   V+ IWITHG
Sbjct: 1   MGQLQAIIVPVTPFQQNCTILFDGETKKGVVIDPGGDLARIREAIESQGIDVEAIWITHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DH   A  LKE L + IIGPH+DD  ++  +        I    RN + D+WL++GD 
Sbjct: 61  HIDHAAAALDLKEALGVDIIGPHRDDKFLLDNLVAAGLKYGITEGVRNVTPDQWLEEGDK 120

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           + +  H+F VF+CPGH+PGHV++ N E  FA +GD LF  S+GRTD+  GD+  LI SI 
Sbjct: 121 VCVAGHVFDVFYCPGHAPGHVVFFNPEARFAIVGDVLFNGSVGRTDLPGGDHATLIRSIK 180

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
            K+LPLGD+I F+CGHGP    G ERR NPFL  
Sbjct: 181 EKLLPLGDDIGFICGHGPGGRFGEERRSNPFLTD 214


>gi|261868416|ref|YP_003256338.1| carboxy- protease [Aggregatibacter actinomycetemcomitans D11S-1]
 gi|261413748|gb|ACX83119.1| carboxy- protease [Aggregatibacter actinomycetemcomitans D11S-1]
          Length = 212

 Score =  183 bits (465), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 77/211 (36%), Positives = 127/211 (60%), Gaps = 2/211 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           ++  I+ VT F+QNC+ ++D++   A ++DPGG+ D +   I+    +++ I +THGH+D
Sbjct: 1   MNIEIIPVTAFQQNCSLIWDDK-KNAAIIDPGGEADKLIKRIEELGLNLQAILLTHGHLD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQ-DGDTLL 122
           HVG A ++K+  ++ I+G +  D      + +Q+    +         DRWL  +G+ L 
Sbjct: 60  HVGAAEKVKQQFNVPILGSNSKDDYWFKGLPQQSEKFGMLFEVATFEPDRWLDKEGEILT 119

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
           +G   F+V H PGH+PGH+ ++  +   A  GD LF+S IGRTD   G Y ++I SI  K
Sbjct: 120 IGDFTFEVLHLPGHTPGHIGFIEHQKRVAFTGDVLFKSGIGRTDFPGGSYDEIIASIREK 179

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           +  L D++  V GHGP +TIG E++ NP++K
Sbjct: 180 LYRLDDDMIIVPGHGPYTTIGIEKQTNPYVK 210


>gi|222086575|ref|YP_002545109.1| hydrolase protein [Agrobacterium radiobacter K84]
 gi|221724023|gb|ACM27179.1| hydrolase protein [Agrobacterium radiobacter K84]
          Length = 214

 Score =  183 bits (465), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 116/214 (54%), Positives = 154/214 (71%), Gaps = 1/214 (0%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M  L   I+ VTPF+QNCT LFD E+ E VVVDPGGD+D+I   ++  N  +K IW+THG
Sbjct: 1   MGMLQAGIIPVTPFEQNCTILFDPETNEGVVVDPGGDVDLILQTVRENNITLKAIWLTHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DH GGA +++E L L +IGPH+DD +++  ++ +A +  I    RN   DR+L+DGD 
Sbjct: 61  HIDHAGGADEVREALGLEVIGPHEDDLSLLQDIEGKAEMFGI-EGVRNVVPDRFLKDGDK 119

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           +  G H F+VFHCPGH+PGHVIYVN    FAHLGD LF  SIGRTD+  G++QQL++SI 
Sbjct: 120 VSFGEHEFEVFHCPGHAPGHVIYVNRTQKFAHLGDVLFHGSIGRTDLPGGNHQQLLDSIR 179

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           +K+ PLGD++ F+CGHGP   IG ERR NPFL+ 
Sbjct: 180 DKVFPLGDDVGFICGHGPGGQIGEERRTNPFLRG 213


>gi|54309516|ref|YP_130536.1| glyoxylase II family protein [Photobacterium profundum SS9]
 gi|46913952|emb|CAG20734.1| hypothetical glyoxylase II family protein [Photobacterium profundum
           SS9]
          Length = 236

 Score =  183 bits (465), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 99/216 (45%), Positives = 139/216 (64%), Gaps = 2/216 (0%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           MS L F IV VTPF+QNC+ ++ +E+ EA +VDPGGD+ ++K  +Q    +V Q+ +THG
Sbjct: 20  MS-LQFEIVPVTPFQQNCSIVWCDETKEAAIVDPGGDIHLLKAKVQQLGLNVTQLLLTHG 78

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DHVGG A L  +L + IIGPHKDDA  +  +  Q+ +          +  +WL +GD 
Sbjct: 79  HLDHVGGTAPLAAELDVPIIGPHKDDAFWLEGLPRQSEMFGF-PLTEAFAPTQWLSEGDE 137

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           + +G    +V H PGH+PGHVI  N +   A +GD LF+  +GRTD   GDYQ LI+SI 
Sbjct: 138 ITIGNQKLQVIHTPGHTPGHVILFNDDAKVAFVGDVLFKGGVGRTDFDQGDYQTLIDSIK 197

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            K+ PLG++++FV GHGP ST G ER  NPF+   +
Sbjct: 198 GKLWPLGNDVTFVPGHGPLSTFGHERVSNPFVADEM 233


>gi|90020043|ref|YP_525870.1| putative metallo-beta-lactamase family protein [Saccharophagus
           degradans 2-40]
 gi|89949643|gb|ABD79658.1| beta-lactamase-like protein [Saccharophagus degradans 2-40]
          Length = 215

 Score =  183 bits (465), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 92/209 (44%), Positives = 137/209 (65%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +   I+ VT ++QNC+ ++ E + +A  +DPGGD++ +   +Q     + +I +THGH+D
Sbjct: 1   MRHRILPVTHYQQNCSLIWCENTNQAAFIDPGGDVERLLAAVQEEGVELSKIILTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVGG A+L   L L + GPHKDD+  +  +  QA+++     A + + +RWL DGDT+ L
Sbjct: 61  HVGGTAELVAKLGLPVEGPHKDDSFWLDMLSTQAQMMGFAPVA-SFTPNRWLNDGDTVTL 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V+HCPGH+PGHV+  +     A +GD LF+ SIGRTD   GDY+QL+ +I +K+
Sbjct: 120 GDQTLAVYHCPGHTPGHVVLHHKATKKAFVGDVLFKGSIGRTDFPRGDYEQLVTAIRSKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
            PLGD+++FV GHGP ST G ER  NPF+
Sbjct: 180 WPLGDDVTFVPGHGPTSTFGEERASNPFV 208


>gi|294141599|ref|YP_003557577.1| metallo-beta-lactamase family protein [Shewanella violacea DSS12]
 gi|293328068|dbj|BAJ02799.1| metallo-beta-lactamase family protein [Shewanella violacea DSS12]
          Length = 214

 Score =  183 bits (465), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 86/213 (40%), Positives = 134/213 (62%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + I+ VTPF+QNC+ ++ +E+  A VVDPGGD+D I   +      +++I +THGH+D
Sbjct: 1   MKYQIIPVTPFQQNCSLIWCDETKAAAVVDPGGDMDRILAEVDKLGVKLEKILLTHGHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG A +L +   + IIGPHK D+  +  + EQ++      ++   +  ++L  GDT+ L
Sbjct: 61  HVGAAKELADHAGIPIIGPHKADSFWLDNLPEQSKHFGF-AHSEPFAPTQYLASGDTVTL 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G+   +V HCPGH+PGH+++ +  +    +GD LF  SIGRTD    ++Q LI+SI   +
Sbjct: 120 GSLTLEVLHCPGHTPGHIVFFSATSRTVWVGDVLFHGSIGRTDFPQSNHQDLIDSITKNL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            PLG ++ FV GHGP ST+G ER  NPF+   +
Sbjct: 180 WPLGRDVEFVPGHGPISTLGTERDQNPFVADQL 212


>gi|293392041|ref|ZP_06636375.1| carboxy- protease [Aggregatibacter actinomycetemcomitans D7S-1]
 gi|290952575|gb|EFE02694.1| carboxy- protease [Aggregatibacter actinomycetemcomitans D7S-1]
          Length = 212

 Score =  183 bits (465), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 76/210 (36%), Positives = 127/210 (60%), Gaps = 2/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           ++  I+ VT F+QNC+ ++D++   A ++DPGG+ D +   I+    +++ I +THGH+D
Sbjct: 1   MNIEIIPVTAFQQNCSLIWDDK-KNAAIIDPGGEADKLIKRIEELGLNLQAILLTHGHLD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWL-QDGDTLL 122
           HVG A ++K+  ++ I+G +  D      + +Q+    +         DRWL ++G+ L 
Sbjct: 60  HVGAAEKVKKQFNVPILGSNSKDDYWFKGLPQQSEKFGMLFEVAAFEPDRWLDKEGEILT 119

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
           +G   F+V H PGH+PGH+ ++  +   A  GD LF+S IGRTD   G Y ++I SI  K
Sbjct: 120 IGDFTFEVLHLPGHTPGHIGFIEHQKRVAFTGDVLFKSGIGRTDFPGGSYDEIIASIREK 179

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           +  L D++  V GHGP +TIG E++ NP++
Sbjct: 180 LYRLDDDMIIVPGHGPYTTIGTEKQTNPYV 209


>gi|171060721|ref|YP_001793070.1| beta-lactamase domain-containing protein [Leptothrix cholodnii
           SP-6]
 gi|170778166|gb|ACB36305.1| beta-lactamase domain protein [Leptothrix cholodnii SP-6]
          Length = 212

 Score =  183 bits (465), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 90/211 (42%), Positives = 129/211 (61%), Gaps = 1/211 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L +  V VT F+QNC+ ++ +E+L A V+DPGGDL  I+  +      ++QIW+TH H+D
Sbjct: 2   LRYLTVPVTAFQQNCSIVWCDETLAAAVIDPGGDLPRIQAEVARLGVKLEQIWLTHAHID 61

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GG   L  +L L I+GPH+ D   +  +D+Q+R+             RWL DGD++ +
Sbjct: 62  HAGGTGTLARELGLPIVGPHEGDQFWIDGLDQQSRMFGFPP-VEPFKPTRWLHDGDSVSI 120

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGH+PGHV++ + E     +GD LF  SIGRTD   GD+  LI SI  ++
Sbjct: 121 GHSTLAVRHCPGHTPGHVVFHSAEIRRCFVGDVLFAGSIGRTDFPGGDHATLIASITQRL 180

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
            P+GD+  F+ GHGP S+ GRERR NP ++ 
Sbjct: 181 WPMGDDTVFIPGHGPESSFGRERRSNPHVRG 211


>gi|307944230|ref|ZP_07659571.1| beta-lactamase domain protein [Roseibium sp. TrichSKD4]
 gi|307772576|gb|EFO31796.1| beta-lactamase domain protein [Roseibium sp. TrichSKD4]
          Length = 229

 Score =  183 bits (465), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 97/212 (45%), Positives = 139/212 (65%), Gaps = 1/212 (0%)

Query: 2   SKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGH 61
             +S  ++ VTPF+QNC+ ++  E+ +  VVDPGGD++ I  VI+     V++I +THGH
Sbjct: 19  PPVSIVVIPVTPFQQNCSLIWSPETKKGAVVDPGGDVETIVKVIKEYGVEVEKIILTHGH 78

Query: 62  VDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
           +DH+GGAA L   L + +IGPHK D  ++ +V +QA+   +  + +    D WL +GD +
Sbjct: 79  IDHIGGAADLAAQLGVKVIGPHKADEPLIERVADQAKQFGL-PDVKPVRPDEWLDEGDMV 137

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
                 F+V HCPGH+PGHV++ + +  FA  GD LF  SIGRTD+  GD+  LI SI  
Sbjct: 138 EFAGRNFEVLHCPGHAPGHVVFFDRDLRFAFSGDVLFAGSIGRTDLPLGDHDTLIRSIKE 197

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           K+LPLGD++SF+ GHG  STIG ER+ NPF K
Sbjct: 198 KMLPLGDDVSFLPGHGEASTIGHERQTNPFFK 229


>gi|319761071|ref|YP_004125008.1| beta-lactamase domain-containing protein [Alicycliphilus
           denitrificans BC]
 gi|330822929|ref|YP_004386232.1| beta-lactamase domain-containing protein [Alicycliphilus
           denitrificans K601]
 gi|317115632|gb|ADU98120.1| beta-lactamase domain-containing protein [Alicycliphilus
           denitrificans BC]
 gi|329308301|gb|AEB82716.1| beta-lactamase domain protein [Alicycliphilus denitrificans K601]
          Length = 212

 Score =  183 bits (465), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 92/209 (44%), Positives = 139/209 (66%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L +H + VT F+QNC+ ++ +++++A V+DPGGDLD++    + R  H+K IW+TH H+D
Sbjct: 2   LHYHTIPVTAFQQNCSLVWCDQTMDAAVIDPGGDLDVLLAEAKRRGLHLKAIWLTHAHID 61

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GG  +L + L+L IIGPH+ D   +  + +Q ++      A + +  RWL DGDT+ +
Sbjct: 62  HAGGTGELAQRLALPIIGPHEGDQYWIDGLPQQGQMFGFPP-ALHFTPTRWLHDGDTVTI 120

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGH+PGHV++   + +   +GD LF  SIGRTD   G++QQLI+SI  ++
Sbjct: 121 GRETLHVRHCPGHTPGHVVFHAPQVDRCFVGDVLFAGSIGRTDFPGGNHQQLIDSITQRL 180

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
            P+GD+  F+ GHGP ST GRERR NP++
Sbjct: 181 WPMGDQTVFIPGHGPESTFGRERRSNPYV 209


>gi|148559965|ref|YP_001259395.1| metallo-beta-lactamase family protein [Brucella ovis ATCC 25840]
 gi|225627959|ref|ZP_03785995.1| metallo-beta-lactamase family protein [Brucella ceti str. Cudo]
 gi|254689703|ref|ZP_05152957.1| metallo-beta-lactamase family protein [Brucella abortus bv. 6 str.
           870]
 gi|254694193|ref|ZP_05156021.1| metallo-beta-lactamase family protein [Brucella abortus bv. 3 str.
           Tulya]
 gi|254702235|ref|ZP_05164063.1| metallo-beta-lactamase family protein [Brucella suis bv. 5 str.
           513]
 gi|254708184|ref|ZP_05170012.1| metallo-beta-lactamase family protein [Brucella pinnipedialis
           M163/99/10]
 gi|254710554|ref|ZP_05172365.1| metallo-beta-lactamase family protein [Brucella pinnipedialis
           B2/94]
 gi|256032048|ref|ZP_05445662.1| metallo-beta-lactamase family protein [Brucella pinnipedialis
           M292/94/1]
 gi|256061571|ref|ZP_05451712.1| metallo-beta-lactamase family protein [Brucella neotomae 5K33]
 gi|256160244|ref|ZP_05457938.1| metallo-beta-lactamase family protein [Brucella ceti M490/95/1]
 gi|256255450|ref|ZP_05460986.1| metallo-beta-lactamase family protein [Brucella ceti B1/94]
 gi|256257954|ref|ZP_05463490.1| metallo-beta-lactamase family protein [Brucella abortus bv. 9 str.
           C68]
 gi|256369933|ref|YP_003107444.1| metallo-beta-lactamase family protein [Brucella microti CCM 4915]
 gi|260169183|ref|ZP_05755994.1| metallo-beta-lactamase family protein [Brucella sp. F5/99]
 gi|260755236|ref|ZP_05867584.1| beta-lactamase domain-containing protein [Brucella abortus bv. 6
           str. 870]
 gi|260884250|ref|ZP_05895864.1| beta-lactamase domain-containing protein [Brucella abortus bv. 9
           str. C68]
 gi|261214499|ref|ZP_05928780.1| beta-lactamase domain-containing protein [Brucella abortus bv. 3
           str. Tulya]
 gi|261222655|ref|ZP_05936936.1| beta-lactamase domain-containing protein [Brucella ceti B1/94]
 gi|261315689|ref|ZP_05954886.1| beta-lactamase domain-containing protein [Brucella pinnipedialis
           M163/99/10]
 gi|261318127|ref|ZP_05957324.1| beta-lactamase domain-containing protein [Brucella pinnipedialis
           B2/94]
 gi|261325577|ref|ZP_05964774.1| beta-lactamase domain-containing protein [Brucella neotomae 5K33]
 gi|261752807|ref|ZP_05996516.1| beta-lactamase domain-containing protein [Brucella suis bv. 5 str.
           513]
 gi|261758696|ref|ZP_06002405.1| beta-lactamase domain-containing protein [Brucella sp. F5/99]
 gi|265989157|ref|ZP_06101714.1| beta-lactamase domain-containing protein [Brucella pinnipedialis
           M292/94/1]
 gi|265998619|ref|ZP_06111176.1| beta-lactamase domain-containing protein [Brucella ceti M490/95/1]
 gi|294852836|ref|ZP_06793509.1| hydroxyacylglutathione hydrolase [Brucella sp. NVSL 07-0026]
 gi|297248790|ref|ZP_06932508.1| hydroxyacylglutathione hydrolase [Brucella abortus bv. 5 str.
           B3196]
 gi|306843136|ref|ZP_07475757.1| metallo-beta-lactamase family protein [Brucella sp. BO2]
 gi|306844518|ref|ZP_07477107.1| metallo-beta-lactamase family protein [Brucella sp. BO1]
 gi|148371222|gb|ABQ61201.1| metallo-beta-lactamase family protein [Brucella ovis ATCC 25840]
 gi|225617122|gb|EEH14168.1| metallo-beta-lactamase family protein [Brucella ceti str. Cudo]
 gi|256000096|gb|ACU48495.1| metallo-beta-lactamase family protein [Brucella microti CCM 4915]
 gi|260675344|gb|EEX62165.1| beta-lactamase domain-containing protein [Brucella abortus bv. 6
           str. 870]
 gi|260873778|gb|EEX80847.1| beta-lactamase domain-containing protein [Brucella abortus bv. 9
           str. C68]
 gi|260916106|gb|EEX82967.1| beta-lactamase domain-containing protein [Brucella abortus bv. 3
           str. Tulya]
 gi|260921239|gb|EEX87892.1| beta-lactamase domain-containing protein [Brucella ceti B1/94]
 gi|261297350|gb|EEY00847.1| beta-lactamase domain-containing protein [Brucella pinnipedialis
           B2/94]
 gi|261301557|gb|EEY05054.1| beta-lactamase domain-containing protein [Brucella neotomae 5K33]
 gi|261304715|gb|EEY08212.1| beta-lactamase domain-containing protein [Brucella pinnipedialis
           M163/99/10]
 gi|261738680|gb|EEY26676.1| beta-lactamase domain-containing protein [Brucella sp. F5/99]
 gi|261742560|gb|EEY30486.1| beta-lactamase domain-containing protein [Brucella suis bv. 5 str.
           513]
 gi|262553243|gb|EEZ09077.1| beta-lactamase domain-containing protein [Brucella ceti M490/95/1]
 gi|264661354|gb|EEZ31615.1| beta-lactamase domain-containing protein [Brucella pinnipedialis
           M292/94/1]
 gi|294821425|gb|EFG38424.1| hydroxyacylglutathione hydrolase [Brucella sp. NVSL 07-0026]
 gi|297175959|gb|EFH35306.1| hydroxyacylglutathione hydrolase [Brucella abortus bv. 5 str.
           B3196]
 gi|306275129|gb|EFM56885.1| metallo-beta-lactamase family protein [Brucella sp. BO1]
 gi|306286686|gb|EFM58242.1| metallo-beta-lactamase family protein [Brucella sp. BO2]
          Length = 218

 Score =  183 bits (464), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 110/214 (51%), Positives = 143/214 (66%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M +L   IV VTPF+QNCT LFD E+ + VV+DPGGDL  I++ I+S+   V+ IWITHG
Sbjct: 1   MGQLQAIIVPVTPFQQNCTILFDGETKKGVVIDPGGDLARIREAIESQGIDVEAIWITHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DH   A  LKE L + IIGPH+DD  ++  +        I    RN + D+WL++GD 
Sbjct: 61  HIDHAAAALDLKEALGVDIIGPHRDDKFLLDNLVAAGLKYGITEGVRNVTPDQWLEEGDK 120

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           + +  H+F VFHCPGH+PGHV++ N E  FA +GD LF  S+GRTD+  GD+  LI SI 
Sbjct: 121 VCVAGHVFDVFHCPGHAPGHVVFFNPEARFAIVGDVLFNGSVGRTDLPGGDHATLIRSIK 180

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
            K+LPLGD+I F+CGHGP    G ERR NPFL  
Sbjct: 181 EKLLPLGDDIGFICGHGPGGRFGEERRSNPFLTD 214


>gi|255292545|dbj|BAH89658.1| putative beta-lactamase [uncultured bacterium]
          Length = 212

 Score =  183 bits (464), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 93/209 (44%), Positives = 139/209 (66%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L +H + VT F+QNC+ ++ +++++A V+DPGGDLD++    + R  H+K IW+TH H+D
Sbjct: 2   LHYHTIPVTAFQQNCSLVWCDQTMDAAVIDPGGDLDVLLAEAKRRGLHLKAIWLTHAHID 61

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GG  +L + L L IIGPH+ D   +  + +Q+ +      A+  +  RWL DGDT+ +
Sbjct: 62  HAGGTGELAQRLHLPIIGPHEGDQYWIDGLAQQSAMFGFAP-AQPFTPTRWLHDGDTVAI 120

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGH+PGHV++   + + A +GD LF  SIGRTD   G++QQLI+SI  ++
Sbjct: 121 GHESLSVRHCPGHTPGHVVFHAPQIDRAFVGDVLFAGSIGRTDFPGGNHQQLIDSITQRL 180

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
            P+GD+  F+ GHGP ST GRERR NP++
Sbjct: 181 WPMGDQTVFIPGHGPESTFGRERRSNPYV 209


>gi|323702160|ref|ZP_08113827.1| beta-lactamase domain-containing protein [Desulfotomaculum
           nigrificans DSM 574]
 gi|323532847|gb|EGB22719.1| beta-lactamase domain-containing protein [Desulfotomaculum
           nigrificans DSM 574]
          Length = 207

 Score =  183 bits (464), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 73/210 (34%), Positives = 107/210 (50%), Gaps = 4/210 (1%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +    + V   + NC  +   E+ +A +VDPG +   I   +      V  I +THGH D
Sbjct: 1   MLIETLPVGNLEANCYIIGCPETDQAAIVDPGDEARRILAQVAKLGLTVSAIILTHGHYD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G  A+LK+     ++  H+ D+ M+ K                  +DR L+DGD + +
Sbjct: 61  HIGAVAELKKATGAPVM-IHRQDSEMLTKPALNLSAWLGEDIELKP-ADRLLEDGDLIKV 118

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V H PGH+PG +            GDTLF  S+GR+D   G +  LINSI  K+
Sbjct: 119 GNLTLEVLHTPGHTPGGICL--KVGGDVFTGDTLFAQSVGRSDFPGGSHTTLINSIKQKL 176

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           L L D+     GHGP STIG+E+RLNP+L+
Sbjct: 177 LVLPDDTMIYPGHGPASTIGQEKRLNPYLQ 206


>gi|197284626|ref|YP_002150498.1| metallo-beta-lactamase superfamily protein [Proteus mirabilis
           HI4320]
 gi|194682113|emb|CAR41707.1| metallo-beta-lactamase superfamily protein [Proteus mirabilis
           HI4320]
          Length = 216

 Score =  183 bits (464), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 93/214 (43%), Positives = 142/214 (66%), Gaps = 2/214 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + +HI+ VT + QNCT ++ +++ EA +VDPGGD++ +   I+ R   + ++ +THGH D
Sbjct: 1   MMYHIIPVTNYMQNCTVIWCDDTKEAAIVDPGGDVETLIAEIEQRQLKLTKVLLTHGHFD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HV G AQ+ E   + + GPHKDD  ++  +++Q R+ +     ++ + D+WL +GDT+ +
Sbjct: 61  HVAGTAQIVEHFHVPVYGPHKDDNFLIEDLEQQCRMFNFPS-GKSFTPDQWLNEGDTVTI 119

Query: 124 -GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
             T    V HCPGH+PGH+I+VN +N    +GD LFR SIGRTD   G++  LI SI NK
Sbjct: 120 GKTITLSVLHCPGHTPGHIIFVNHQNKLISMGDVLFRESIGRTDFPRGNHADLIASIKNK 179

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           +LPLGD+  F+ GHGP S +G ER+ NPFL+  +
Sbjct: 180 VLPLGDDYLFIPGHGPMSNLGHERQYNPFLQDEM 213


>gi|190892755|ref|YP_001979297.1| hydrolase [Rhizobium etli CIAT 652]
 gi|190698034|gb|ACE92119.1| putative hydrolase protein [Rhizobium etli CIAT 652]
          Length = 229

 Score =  183 bits (464), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 117/214 (54%), Positives = 151/214 (70%), Gaps = 1/214 (0%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M  L   I+ VTPF+QNCT  FD E+ E VVVDPGGD+ +I   I+     +K+IW+THG
Sbjct: 1   MGMLQAGIIPVTPFQQNCTVFFDPETQEGVVVDPGGDVPLILQAIEKSGLTIKEIWLTHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DH GGA +LKE L + I+GPH+DD  ++ +++ QA    I    RN   D WL+DGD 
Sbjct: 61  HLDHAGGAKELKEALGVDIVGPHQDDLPLLQRIEAQAANYGI-SGLRNVLPDCWLKDGDR 119

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           +  G H F+V+H PGH+PGHVIY N   NFAHLGD LF  SIGRTD+  G++QQL++SI 
Sbjct: 120 VSFGAHEFEVYHAPGHAPGHVIYFNRAQNFAHLGDVLFNGSIGRTDLPGGNHQQLLDSIR 179

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           +K+LPLGDE+ F+CGHGP S IG ERR NPFL+ 
Sbjct: 180 DKVLPLGDEVGFICGHGPGSRIGDERRSNPFLQE 213


>gi|209883297|ref|YP_002287154.1| beta-lactamase domain protein [Oligotropha carboxidovorans OM5]
 gi|209871493|gb|ACI91289.1| beta-lactamase domain protein [Oligotropha carboxidovorans OM5]
          Length = 235

 Score =  183 bits (464), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 102/207 (49%), Positives = 139/207 (67%), Gaps = 1/207 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           I+ VTPF+QNCT L+ E + +A V+DPGGD+  I + I+     V+ IW+THGHVDHVGG
Sbjct: 28  IIPVTPFQQNCTLLWCETTKKAAVIDPGGDVLDILNAIKQAGVKVEHIWLTHGHVDHVGG 87

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           AA+L++ L + I GPH  D  ++  V E AR   +    R+ + D WL +GDT+ +G   
Sbjct: 88  AAELRDHLKVPITGPHIADKFLLDNVVETARNYGL-TGLRDVTPDNWLNEGDTVSVGELT 146

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
           F + HCPGHSPG +++ +    FA +GD LF  SIGRTD+  GD+  L+ SI +K+LPLG
Sbjct: 147 FDLLHCPGHSPGSMVFFSKALKFAIMGDVLFNGSIGRTDLPGGDHATLLASIRDKVLPLG 206

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLKS 214
           D++ F+CGHG  STIG ERR NPFL  
Sbjct: 207 DDVGFICGHGAGSTIGHERRTNPFLNG 233


>gi|254714737|ref|ZP_05176548.1| metallo-beta-lactamase family protein [Brucella ceti M644/93/1]
 gi|254717797|ref|ZP_05179608.1| metallo-beta-lactamase family protein [Brucella ceti M13/05/1]
 gi|261219645|ref|ZP_05933926.1| beta-lactamase domain-containing protein [Brucella ceti M13/05/1]
 gi|261322533|ref|ZP_05961730.1| beta-lactamase domain-containing protein [Brucella ceti M644/93/1]
 gi|260924734|gb|EEX91302.1| beta-lactamase domain-containing protein [Brucella ceti M13/05/1]
 gi|261295223|gb|EEX98719.1| beta-lactamase domain-containing protein [Brucella ceti M644/93/1]
          Length = 218

 Score =  183 bits (464), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 110/214 (51%), Positives = 142/214 (66%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M +L   IV VTPF+QNCT LFD E+ + VV+DPGGDL  I++ I+S+   V+ IWITHG
Sbjct: 1   MGQLQAIIVPVTPFQQNCTILFDGETKKGVVIDPGGDLARIREAIESQGIDVEAIWITHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DH   A  LKE L + IIGPH+DD  ++  +        I    RN + D+WL++GD 
Sbjct: 61  HIDHAAAALDLKEALGVDIIGPHRDDKFLLDNLVAAGLKYGITEGVRNVTPDQWLEEGDK 120

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           + +  H+F VFHCPGH+PGHV++ N E  FA +GD LF  S+GRTD+  GD   LI SI 
Sbjct: 121 VCVAGHVFDVFHCPGHAPGHVVFFNPEARFAIVGDVLFNGSVGRTDLPGGDRATLIRSIK 180

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
            K+LPLGD+I F+CGHGP    G ERR NPFL  
Sbjct: 181 EKLLPLGDDIGFICGHGPGGRFGEERRSNPFLTD 214


>gi|75674312|ref|YP_316733.1| beta-lactamase-like [Nitrobacter winogradskyi Nb-255]
 gi|74419182|gb|ABA03381.1| beta-lactamase-like protein [Nitrobacter winogradskyi Nb-255]
          Length = 224

 Score =  183 bits (464), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 105/209 (50%), Positives = 144/209 (68%), Gaps = 1/209 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           I+ VTPF+QNCT L+ E + + VV+DPGGD+ +I+  I+     V +IW+THGH+DHVGG
Sbjct: 15  IIPVTPFRQNCTLLWCEATRDGVVIDPGGDIPLIRAAIKQAGVTVGRIWLTHGHIDHVGG 74

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           AA+L++ L + I+GPH  D  ++  V E  R   +    R+   DRWL+DGD + +G   
Sbjct: 75  AAELRDALKVPIMGPHVADKFLLDHVVESGRHYGMTGM-RDFVPDRWLEDGDQVEVGQLA 133

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
           F V HCPGHSPG V++ N + +FAH+GD LF  S+GRTD+  G    LI SI +K+LPLG
Sbjct: 134 FDVLHCPGHSPGSVVFFNADLHFAHVGDVLFNGSVGRTDLPGGSRAVLIKSITDKLLPLG 193

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           D+++F+CGHGP STIG ER  NPFL  N+
Sbjct: 194 DDVAFICGHGPGSTIGHERVSNPFLTGNV 222


>gi|134298603|ref|YP_001112099.1| beta-lactamase domain-containing protein [Desulfotomaculum reducens
           MI-1]
 gi|134051303|gb|ABO49274.1| beta-lactamase domain protein [Desulfotomaculum reducens MI-1]
          Length = 205

 Score =  182 bits (463), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 80/209 (38%), Positives = 112/209 (53%), Gaps = 4/209 (1%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +    + V  ++ NC  +  EE+ +AVVVDPG + + I++ ++  NF V+ I +THGH D
Sbjct: 1   MYIETLPVGSYEANCYIIGCEETRKAVVVDPGDEAERIQERLKKLNFKVEAIVLTHGHSD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G    L+   +  +   HKDDA M+    +            N  +DR L DGDT+ +
Sbjct: 61  HIGAVGDLQRATAAQV-LIHKDDAEMLINPAKNLSTWMGEHMVFNP-ADRLLVDGDTIQI 118

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V H PGH+PG              GDTLF  SIGR+D   G +  LI SI +K+
Sbjct: 119 GNITLEVLHTPGHTPGG--ICLKAGKDLFSGDTLFAQSIGRSDFPGGSHSTLIGSIKSKL 176

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           L L DE     GHGP STIG+E+R NPF 
Sbjct: 177 LVLSDETKVYPGHGPASTIGQEKRHNPFF 205


>gi|85058983|ref|YP_454685.1| hypothetical protein SG1005 [Sodalis glossinidius str. 'morsitans']
 gi|84779503|dbj|BAE74280.1| conserved hypothetical protein [Sodalis glossinidius str.
           'morsitans']
          Length = 209

 Score =  182 bits (463), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 91/210 (43%), Positives = 136/210 (64%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + +HI+ VT F QNC+ ++ E++  A +VDPGG+   ++  + +    VK+IW+THGH+D
Sbjct: 1   MKYHIMPVTAFSQNCSLVWCEQTGNAALVDPGGEAPRLRQEVATLGVTVKEIWLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG A+ L     + I+GPH+D+  ++  +  Q ++  +       + DRWL DG TL +
Sbjct: 61  HVGAASSLAAFYDVPIVGPHRDEEPLLASLPGQCQMFGV-ETTPPLTLDRWLADGATLSI 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   F V HCPGHSPGHV++ N    F  +GD LF   IGRTD+  GD   L+ SI++++
Sbjct: 120 GKLSFHVLHCPGHSPGHVVFWNKAAKFILMGDVLFNGGIGRTDLPGGDMPTLMRSIHHQL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           +PL D+I+F+ GHGP ST+G ERR NPFL+
Sbjct: 180 MPLADDIAFLPGHGPMSTLGHERRTNPFLQ 209


>gi|149191674|ref|ZP_01869917.1| glyoxylase II family protein [Vibrio shilonii AK1]
 gi|148834515|gb|EDL51509.1| glyoxylase II family protein [Vibrio shilonii AK1]
          Length = 218

 Score =  182 bits (463), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 94/216 (43%), Positives = 135/216 (62%), Gaps = 1/216 (0%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M  L + +V VT F QNC+ ++ +E+++ VVVDPGGD+  ++ +I+     V+Q+ +THG
Sbjct: 1   MMSLQYQVVPVTSFAQNCSIVWCDETMKGVVVDPGGDVKQLEMLIKELGVQVEQLVLTHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DHVGG   L E L   I+GPHK D   +  ++ Q+++    +  +    ++WL DGDT
Sbjct: 61  HLDHVGGTEPLAEALDANIVGPHKADNFWLQGLENQSQMFGFPL-TKAFEPNQWLDDGDT 119

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           +  G     V H PGH+PGHV+  N E+  A +GD LF   IGRTD   GDY  LINSI 
Sbjct: 120 VEFGNQTLNVIHTPGHTPGHVVLFNDESKVAFVGDVLFNGGIGRTDFPQGDYATLINSIK 179

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            K+ PLG++++FV GHGP ST G ER  NPF+   +
Sbjct: 180 TKLWPLGNDVTFVPGHGPQSTFGHERASNPFVADEM 215


>gi|90414500|ref|ZP_01222475.1| hypothetical glyoxylase II family protein [Photobacterium profundum
           3TCK]
 gi|90324408|gb|EAS40970.1| hypothetical glyoxylase II family protein [Photobacterium profundum
           3TCK]
          Length = 217

 Score =  182 bits (463), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 98/216 (45%), Positives = 139/216 (64%), Gaps = 2/216 (0%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           MS L F IV VTPF+QNC+ ++ +E+ +A +VDPGGD+ ++K  +Q    +V Q+ +THG
Sbjct: 1   MS-LQFEIVPVTPFQQNCSIVWCDETKDAAIVDPGGDIHLLKAKVQQLGLNVTQLLLTHG 59

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DHVGG A L  +L + IIGPHKDDA  +  +  Q+ +          +  +WL +GD 
Sbjct: 60  HLDHVGGTAPLAAELDVPIIGPHKDDAFWLEGLPRQSEMFGF-PLTEAFAPTQWLSEGDE 118

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           + +G    +V H PGH+PGHVI  N +   A +GD LF+  +GRTD   GDYQ LI+SI 
Sbjct: 119 ITVGNQKLQVIHTPGHTPGHVILFNDDAKVAFVGDVLFKGGVGRTDFPQGDYQTLIDSIK 178

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            K+ PLG++++FV GHGP ST G ER  NPF+   +
Sbjct: 179 GKLWPLGNDVTFVPGHGPLSTFGNERVSNPFVADEM 214


>gi|161619462|ref|YP_001593349.1| beta-lactamase domain-containing protein [Brucella canis ATCC
           23365]
 gi|163843771|ref|YP_001628175.1| beta-lactamase domain-containing protein [Brucella suis ATCC 23445]
 gi|254704770|ref|ZP_05166598.1| beta-lactamase domain-containing protein [Brucella suis bv. 3 str.
           686]
 gi|260565987|ref|ZP_05836457.1| beta-lactamase domain-containing protein [Brucella suis bv. 4 str.
           40]
 gi|261755466|ref|ZP_05999175.1| beta-lactamase domain-containing protein [Brucella suis bv. 3 str.
           686]
 gi|161336273|gb|ABX62578.1| beta-lactamase domain protein [Brucella canis ATCC 23365]
 gi|163674494|gb|ABY38605.1| beta-lactamase domain protein [Brucella suis ATCC 23445]
 gi|260155505|gb|EEW90585.1| beta-lactamase domain-containing protein [Brucella suis bv. 4 str.
           40]
 gi|261745219|gb|EEY33145.1| beta-lactamase domain-containing protein [Brucella suis bv. 3 str.
           686]
          Length = 218

 Score =  182 bits (463), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 110/214 (51%), Positives = 143/214 (66%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M +L   IV VTPF+QNCT LFD E+ + VV+DPGGDL  I++ I+S+   V+ IWITHG
Sbjct: 1   MGQLQAIIVPVTPFQQNCTILFDGETKKGVVIDPGGDLARIREAIESQGIDVEAIWITHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DH   A  LKE L + IIGPH+DD  ++  +        I    RN + D+WL++GD 
Sbjct: 61  HIDHAAAALNLKEALGVDIIGPHRDDKFLLDNLVAAGLKYGITEGVRNVTPDQWLEEGDK 120

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           + +  H+F VFHCPGH+PGHV++ N E  FA +GD LF  S+GRTD+  GD+  LI SI 
Sbjct: 121 VCVAGHVFDVFHCPGHAPGHVVFFNPEARFAIVGDVLFNGSVGRTDLPGGDHATLIRSIK 180

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
            K+LPLGD+I F+CGHGP    G ERR NPFL  
Sbjct: 181 EKLLPLGDDIGFICGHGPGGRFGEERRSNPFLTD 214


>gi|212635874|ref|YP_002312399.1| beta-lactamase-like protein [Shewanella piezotolerans WP3]
 gi|212557358|gb|ACJ29812.1| Beta-lactamase-like protein [Shewanella piezotolerans WP3]
          Length = 214

 Score =  182 bits (463), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 89/213 (41%), Positives = 135/213 (63%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + ++ VTPF+QNC+ ++ E+SL+  VVDPGG+L+ I +     +  ++Q+ +THGH+D
Sbjct: 1   MKYQLIPVTPFQQNCSLIWCEQSLKGAVVDPGGNLERILEEAAKNHVQIEQVLLTHGHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG A  L E L++ I+GPH  D+  +  + +Q++           +  R+LQ+GD + +
Sbjct: 61  HVGAAQTLAEQLNVPIVGPHLADSFWLESLPKQSQHFGFVHC-DPFTPSRFLQEGDEVTV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G  +  V HCPGH+PGHV++   E   A +GD LFR SIGRTD    ++Q LI+SI  K+
Sbjct: 120 GEQVLSVLHCPGHTPGHVVFFAKEAAIAWVGDVLFRGSIGRTDFPQSNHQDLIDSITKKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            PLG E+ F+ GHGP ST G ER  NPF+   +
Sbjct: 180 WPLGKEVQFIPGHGPLSTFGEERAQNPFVADQL 212


>gi|254449198|ref|ZP_05062647.1| beta-lactamase domain protein [gamma proteobacterium HTCC5015]
 gi|198261175|gb|EDY85471.1| beta-lactamase domain protein [gamma proteobacterium HTCC5015]
          Length = 206

 Score =  182 bits (463), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 87/201 (43%), Positives = 124/201 (61%), Gaps = 1/201 (0%)

Query: 12  TPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQL 71
           TPF+QNC+ L+ + S  A VVDPGGD+D I+  I      V++I +THGH+DHVG  A++
Sbjct: 2   TPFQQNCSLLWCDSSQRAAVVDPGGDVDKIQAAIDETGVIVEKILLTHGHLDHVGATAEM 61

Query: 72  KEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFKVF 131
                + I GP ++DA  +  +  QA++ +           RWL+ GD + +G    +V 
Sbjct: 62  ARRFDVPIEGPQREDAFWIQGLPMQAQMFNFPA-VEIFEPQRWLEQGDKVTVGEIELEVR 120

Query: 132 HCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEIS 191
           HCPGH+PGHV++ + ++     GD LF+ SIGRTD   GD+  LI SI+ ++  L DE  
Sbjct: 121 HCPGHTPGHVVFYSAQDGLLWAGDVLFQGSIGRTDFPKGDHATLIESIHRELFSLPDETR 180

Query: 192 FVCGHGPNSTIGRERRLNPFL 212
           F+ GHGP STIG ERR NPF+
Sbjct: 181 FIPGHGPMSTIGAERRSNPFV 201


>gi|15966085|ref|NP_386438.1| hypothetical protein SMc01587 [Sinorhizobium meliloti 1021]
 gi|307305639|ref|ZP_07585386.1| beta-lactamase domain protein [Sinorhizobium meliloti BL225C]
 gi|307317642|ref|ZP_07597081.1| beta-lactamase domain protein [Sinorhizobium meliloti AK83]
 gi|15075355|emb|CAC46911.1| Conserved hypothetical protein [Sinorhizobium meliloti 1021]
 gi|306896800|gb|EFN27547.1| beta-lactamase domain protein [Sinorhizobium meliloti AK83]
 gi|306902342|gb|EFN32938.1| beta-lactamase domain protein [Sinorhizobium meliloti BL225C]
          Length = 213

 Score =  182 bits (462), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 117/207 (56%), Positives = 152/207 (73%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           I+ VT F+QNCT LFD E+ E VVVDPGGD+DII   I+     +K IW+THGH+DH GG
Sbjct: 6   IIPVTHFEQNCTVLFDSETKEGVVVDPGGDVDIILQTIRENGIALKAIWLTHGHIDHAGG 65

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           A +LKE L L I+GPHKDD  ++ ++++QA    + M  +N   DRWL++GDT+  G H+
Sbjct: 66  AKELKEALGLDIVGPHKDDLPLLERLEDQAERFGLAMKVQNVVPDRWLEEGDTVSFGDHV 125

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
           F+V HCPGH+PGHV+Y N   NFAH+GD LF  SIGRTD+  G++QQL++SI +KILPLG
Sbjct: 126 FEVLHCPGHAPGHVVYFNRAQNFAHVGDVLFHGSIGRTDLPGGNHQQLLDSIRDKILPLG 185

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLKS 214
           D + F+CGHGP   IG ERR NPFL+ 
Sbjct: 186 DNVGFICGHGPGGQIGEERRTNPFLRG 212


>gi|309780474|ref|ZP_07675222.1| metallo-beta-lactamase family protein [Ralstonia sp. 5_7_47FAA]
 gi|308920748|gb|EFP66397.1| metallo-beta-lactamase family protein [Ralstonia sp. 5_7_47FAA]
          Length = 218

 Score =  182 bits (462), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 93/211 (44%), Positives = 130/211 (61%), Gaps = 2/211 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +   +V VTPF+QNCT L  ++   A V DPGGD+D I    Q     +++I +THGHVD
Sbjct: 1   MKVVVVPVTPFEQNCTLLIGDD-GAAAVTDPGGDIDRILAAAQQHGARIEKILLTHGHVD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H   A  L+  L + I GP KD+A  + ++  Q++       A+    DRWL+DGDT+  
Sbjct: 60  HCAAADALRTQLGVPIEGPQKDEAFWIDQLPMQSQRFGFPP-AKAFVPDRWLEDGDTVEA 118

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
                +VFHCPGH+PGHV++ + E+  A +GD LF  SIGRTD   G++  LIN+I  K+
Sbjct: 119 AGRTLQVFHCPGHTPGHVVFFSAEDRVAIVGDVLFAGSIGRTDFPRGNHADLINAIRTKL 178

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
            PLGD+++FV GHGP ST G ER  NP++  
Sbjct: 179 WPLGDDVTFVPGHGPVSTFGDERASNPYVAD 209


>gi|288961941|ref|YP_003452251.1| beta-lactamase-like protein [Azospirillum sp. B510]
 gi|288914221|dbj|BAI75707.1| beta-lactamase-like protein [Azospirillum sp. B510]
          Length = 210

 Score =  182 bits (462), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 91/211 (43%), Positives = 138/211 (65%), Gaps = 1/211 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + IV VTPF+QNCT L+  E+++   +DPGG+LD I    +++   +++I +THGH+D
Sbjct: 1   MQYAIVPVTPFQQNCTVLWCPETMKGAAIDPGGELDRILAAAKAKGVTLEKILVTHGHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GG A L + LSL I GPH++D   +  +  Q+++       R+ + DRWL++GDT+ +
Sbjct: 61  HAGGVADLADKLSLPIEGPHREDQFWIDGMPHQSQMFGF-PPVRSFTPDRWLEEGDTVTV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGHV++V+  +  A +GD LF+ SIGRTD   G++  LI SI  ++
Sbjct: 120 GNQSLEVRHCPGHTPGHVVFVHRPSKLAIVGDVLFQGSIGRTDFPKGNHGDLIASIRERL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
            P GD+ +F+ GHGP S+ G ER  NPFL  
Sbjct: 180 FPYGDDFAFIPGHGPMSSFGEERLYNPFLND 210


>gi|325578154|ref|ZP_08148289.1| metallo-beta-lactamase [Haemophilus parainfluenzae ATCC 33392]
 gi|325159890|gb|EGC72019.1| metallo-beta-lactamase [Haemophilus parainfluenzae ATCC 33392]
          Length = 209

 Score =  182 bits (462), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 78/210 (37%), Positives = 133/210 (63%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           ++  I+ VT F+QNC+ ++D+E   A ++DPGG+ + +   I+    ++K + +THGH+D
Sbjct: 1   MNIEIIPVTAFQQNCSLIWDDE-KNAAIIDPGGNAEKLIQRIEELELNLKAVLLTHGHLD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG A  +++  ++ I G  ++D  +   + +Q++   +   +       + Q+G+ + +
Sbjct: 60  HVGAAEVIRDHFNIEIWGSQEEDRFLFESLPQQSQQFGLPYISAFTPDRWFNQEGEKIQI 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           GT  F++ H PGH+PGHV ++  E N A  GD LF++SIGRTD   G++  LI+SI NK+
Sbjct: 120 GTFTFEILHLPGHTPGHVGFIEHEKNIAFTGDVLFQNSIGRTDFPRGNFDTLISSIKNKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
             L D++  + GHGP +TIG+E+R NPFLK
Sbjct: 180 FILNDDMVVIAGHGPYTTIGQEKRSNPFLK 209


>gi|329894659|ref|ZP_08270464.1| Hypothetical metal-binding enzyme, YcbL like protein [gamma
           proteobacterium IMCC3088]
 gi|328922915|gb|EGG30244.1| Hypothetical metal-binding enzyme, YcbL like protein [gamma
           proteobacterium IMCC3088]
          Length = 216

 Score =  182 bits (462), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 91/215 (42%), Positives = 138/215 (64%), Gaps = 2/215 (0%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           MS +   +  VTP++QNC+ +  + + +A VVDPGGD+D I    +     +++I +THG
Sbjct: 1   MS-IKVSVGPVTPYQQNCSIIQCQATGKAAVVDPGGDIDRILSAAEQMGATIEKIILTHG 59

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DH G +A+L++ L + I GP   D   + ++ +  +L      A   + DRWL DGDT
Sbjct: 60  HLDHCGVSAELRDKLEVPIEGPEAADKFWIDQLPDYCKLAGFPH-ADAFTPDRWLHDGDT 118

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           + +G    +V HCPGH+PGHV++V+ EN  A +GD +F+ SIGRTD     +  LI+SI 
Sbjct: 119 VNVGEVELQVIHCPGHTPGHVVFVSDENRIAWVGDVIFQGSIGRTDFPMSKHDDLIHSIR 178

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLKSN 215
           +K+ PLGD+I+FV GHGP ST G+ER+ NPF+  +
Sbjct: 179 DKLFPLGDDITFVPGHGPTSTFGQERQTNPFVADS 213


>gi|23502385|ref|NP_698512.1| metallo-beta-lactamase family protein [Brucella suis 1330]
 gi|23348369|gb|AAN30427.1| metallo-beta-lactamase family protein [Brucella suis 1330]
          Length = 218

 Score =  182 bits (462), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 110/214 (51%), Positives = 142/214 (66%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M +L   IV VTPF+QNCT LFD E+ + VV+DPGGDL  I++ I+S+   V+ IWITHG
Sbjct: 1   MGQLQAIIVPVTPFQQNCTILFDGETKKGVVIDPGGDLARIREAIESQGIDVEAIWITHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DH   A  LKE L + IIGPH+DD  ++  +        I    RN + D+WL++GD 
Sbjct: 61  HIDHAAAALNLKEALGVDIIGPHRDDKFLLDNLVAAGLKYGITEGVRNVTPDQWLEEGDK 120

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           + +  H+F VFHCPGH PGHV++ N E  FA +GD LF  S+GRTD+  GD+  LI SI 
Sbjct: 121 VCVAGHVFDVFHCPGHVPGHVVFFNPEARFAIVGDVLFNGSVGRTDLPGGDHATLIRSIK 180

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
            K+LPLGD+I F+CGHGP    G ERR NPFL  
Sbjct: 181 EKLLPLGDDIGFICGHGPGGRFGEERRSNPFLTD 214


>gi|153008978|ref|YP_001370193.1| beta-lactamase domain-containing protein [Ochrobactrum anthropi
           ATCC 49188]
 gi|151560866|gb|ABS14364.1| beta-lactamase domain protein [Ochrobactrum anthropi ATCC 49188]
          Length = 218

 Score =  182 bits (462), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 111/214 (51%), Positives = 142/214 (66%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M +L   IV VTPF+QNCT LFD E+ + VV+DPGGDLD I++ I S+   V+ IWITHG
Sbjct: 1   MGQLQAIIVPVTPFQQNCTILFDGETKKGVVIDPGGDLDRIREAIDSQGIDVEAIWITHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DH   A  LKE L++ IIGPH+DD  ++  ++       I    RN + DRWL +GD 
Sbjct: 61  HIDHAAAALDLKEALNVDIIGPHRDDKFLLDNLEATGLKYGITEGVRNVTPDRWLDEGDK 120

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           + +  H F VFH PGH+PGHV++ N E  FA +GD LF  S+GRTD+  GD+  LI SI 
Sbjct: 121 VSVAGHEFDVFHTPGHAPGHVVFFNPEARFAIVGDVLFNGSVGRTDLPAGDHAALIRSIK 180

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
            K+LPLGD+I F+CGHGP    G ERR NPFL  
Sbjct: 181 EKLLPLGDDIGFICGHGPGGRFGDERRSNPFLND 214


>gi|260776043|ref|ZP_05884938.1| hydroxyacylglutathione hydrolase [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260607266|gb|EEX33531.1| hydroxyacylglutathione hydrolase [Vibrio coralliilyticus ATCC
           BAA-450]
          Length = 218

 Score =  182 bits (462), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 95/217 (43%), Positives = 134/217 (61%), Gaps = 3/217 (1%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           MS L + +V VT F QNC+ ++ +E++E VVVDPGGD+  +  +I+     V  + +THG
Sbjct: 1   MS-LKYQVVPVTSFSQNCSIVWCDETMEGVVVDPGGDVKQLAALIKELGVKVVNLVLTHG 59

Query: 61  HVDHVGGAAQLKEDLS-LTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGD 119
           H+DHVGG   L  +L  + I+GPHKDD   +  +  Q+++    +        +WL DGD
Sbjct: 60  HLDHVGGTESLSAELGGIEIVGPHKDDNFWLQGLAGQSQMFGFPL-TEAFEPQKWLNDGD 118

Query: 120 TLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSI 179
           T+  G  I  V+H PGH+PGHV+  + E   A +GD LF  S+GRTD   GD+  LINSI
Sbjct: 119 TVAFGNQILNVYHTPGHTPGHVVLFSEEAKLAFVGDVLFNGSVGRTDFPKGDFDTLINSI 178

Query: 180 NNKILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
             K+ PLG+++ FV GHGP ST GRER  NPF+   +
Sbjct: 179 KTKLWPLGNDVRFVPGHGPESTFGRERASNPFVADEM 215


>gi|241664717|ref|YP_002983077.1| beta-lactamase domain-containing protein [Ralstonia pickettii 12D]
 gi|240866744|gb|ACS64405.1| beta-lactamase domain protein [Ralstonia pickettii 12D]
          Length = 218

 Score =  182 bits (461), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 92/211 (43%), Positives = 129/211 (61%), Gaps = 2/211 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +   +V VTPF+QNCT L  ++   A V DPGGD+D I    Q     +++I +THGHVD
Sbjct: 1   MKVVVVPVTPFEQNCTLLIGDD-GAAAVTDPGGDIDRILAAAQQHGARIEKILLTHGHVD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H   A  L+  L + I GP KD+A  + ++  Q++       A+    DRWL+DGDT+  
Sbjct: 60  HCAAADALRTQLGVPIEGPQKDEAFWIDQLPMQSQRFGFPP-AKAFVPDRWLEDGDTVEA 118

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
                +VFHCPGH+PGHV++ + E+  A +GD LF  SIGRTD   G++  LI +I  K+
Sbjct: 119 AGRTLQVFHCPGHTPGHVVFFSAEDRVAIVGDVLFAGSIGRTDFPRGNHADLIKAIRTKL 178

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
            PLGD+++FV GHGP ST G ER  NP++  
Sbjct: 179 WPLGDDVTFVPGHGPVSTFGDERASNPYVAD 209


>gi|197118053|ref|YP_002138480.1| zinc-dependent hydrolase YcbL, metallo-beta-lactamase superfamily
           [Geobacter bemidjiensis Bem]
 gi|197087413|gb|ACH38684.1| zinc-dependent hydrolase YcbL, metallo-beta-lactamase superfamily
           [Geobacter bemidjiensis Bem]
          Length = 209

 Score =  182 bits (461), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 80/211 (37%), Positives = 113/211 (53%), Gaps = 2/211 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + F  + V     NC  L D++S E VVVDPG D ++I D I      VK I  THGH D
Sbjct: 1   MLFETIVVGALGVNCFILGDKQSNEGVVVDPGADFELIADAIARFGIKVKYIINTHGHFD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG    ++E     +   H+ D  ++    + A+   ++  A  A   R+L+DG  L  
Sbjct: 61  HVGCNRSVQEKTGAEL-LIHQGDQTLLELAAKSAQKYGLKAEASPA-PTRFLEDGMKLEF 118

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V H PGH+ G    +         GDTLF  S+GRTD+  G ++QL+ SI  K+
Sbjct: 119 GKRTIEVLHTPGHTQGGCCLLLAHEKLVITGDTLFADSVGRTDLPGGSHEQLMASIKAKL 178

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           +PL D+ +   GHGP+STIGRERR NP++  
Sbjct: 179 MPLPDDTTVWPGHGPSSTIGRERRSNPYINE 209


>gi|262275622|ref|ZP_06053431.1| hydroxyacylglutathione hydrolase [Grimontia hollisae CIP 101886]
 gi|262219430|gb|EEY70746.1| hydroxyacylglutathione hydrolase [Grimontia hollisae CIP 101886]
          Length = 217

 Score =  182 bits (461), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 86/213 (40%), Positives = 133/213 (62%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L + IV VT F+QNC+ ++ +++ EA +VDPGGD+  +   +      V ++ +THGH+D
Sbjct: 3   LKYEIVPVTGFQQNCSIIWCDKTHEAALVDPGGDVSKLVAKVNDLGVKVTKVLLTHGHLD 62

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVGG  +++   ++ +IGP K DA  +  +  Q+ +            D+WL+DGD + +
Sbjct: 63  HVGGTEEVRLAYNVPVIGPEKQDAFWLQALPAQSEMFGF-ARTEAFDPDQWLEDGDEVTI 121

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V H PGH+PGH++  + E+  A +GD LF  SIGRTD   GD+  LI+SI +K+
Sbjct: 122 GESTLTVIHTPGHTPGHIVLFSEEDRIAWVGDVLFNGSIGRTDFPKGDHATLISSIKDKL 181

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            PLG++I+FV GHGP ST G ER+ NP++  N+
Sbjct: 182 FPLGNDITFVPGHGPTSTFGIERQQNPYVADNM 214


>gi|167645553|ref|YP_001683216.1| beta-lactamase domain-containing protein [Caulobacter sp. K31]
 gi|167347983|gb|ABZ70718.1| beta-lactamase domain protein [Caulobacter sp. K31]
          Length = 237

 Score =  182 bits (461), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 100/214 (46%), Positives = 140/214 (65%), Gaps = 3/214 (1%)

Query: 1   MSKLSFH--IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWIT 58
           M+ +     I  VTP +QNCT ++  ++L+A V+DPGG++  +   ++ +   +++IWIT
Sbjct: 1   MADMPIRAVIAPVTPLQQNCTIVWCAKTLKAAVIDPGGEVPRLMKALEDQGLTLEKIWIT 60

Query: 59  HGHVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDG 118
           HGH+DH GGAA+LK    + I GPHKDD   + ++        I   AR   +DRWL DG
Sbjct: 61  HGHMDHAGGAAELKRLTGVPIEGPHKDDQFWIDQIQSTGERYGIPE-ARIFVTDRWLDDG 119

Query: 119 DTLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINS 178
           D + LG   F+V HCPGH+PGHVI+ N E  FA +GD LF+ SIGRTD   G++Q L+++
Sbjct: 120 DVVTLGETQFEVLHCPGHTPGHVIFFNREARFAQVGDVLFKGSIGRTDFPRGNHQDLLDA 179

Query: 179 INNKILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           I  K+ PLGD++ FV GHGP ST G ERR NPF+
Sbjct: 180 ITGKLWPLGDDVQFVPGHGPMSTFGAERRSNPFV 213


>gi|115522261|ref|YP_779172.1| beta-lactamase domain-containing protein [Rhodopseudomonas
           palustris BisA53]
 gi|115516208|gb|ABJ04192.1| beta-lactamase domain protein [Rhodopseudomonas palustris BisA53]
          Length = 242

 Score =  182 bits (461), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 109/209 (52%), Positives = 141/209 (67%), Gaps = 1/209 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           I+ VT F+QNCT L+ E + +AVV+DPGGD+D I   I      V++IW+THGHVDHVGG
Sbjct: 35  IIPVTLFQQNCTLLWCETTKKAVVIDPGGDVDQITAAIAQAGVTVEKIWLTHGHVDHVGG 94

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           A +L+E L + I GPH  D  +M  V E AR   +    RN + DRWL+DG+ L +G   
Sbjct: 95  ADELREQLKVPIEGPHIGDQFLMDHVVESARAFGL-SGVRNVTPDRWLEDGERLRIGELS 153

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
           F+V HCPGHSPG V+Y N    FA +GD LF  SIGRTD+  G++  LINSI  K++PLG
Sbjct: 154 FEVLHCPGHSPGSVVYFNDAMRFAIVGDVLFAGSIGRTDLPGGNHATLINSIQTKLMPLG 213

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           D++ F+ GHGP STIG+ER  NPFL   +
Sbjct: 214 DDVGFISGHGPGSTIGQERMTNPFLTGEM 242


>gi|187922409|ref|YP_001894051.1| beta-lactamase [Burkholderia phytofirmans PsJN]
 gi|187713603|gb|ACD14827.1| beta-lactamase domain protein [Burkholderia phytofirmans PsJN]
          Length = 214

 Score =  182 bits (461), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 92/213 (43%), Positives = 133/213 (62%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +   ++ VTPF+QN + L  E +  A VV PGGDLDII+  I  +N  V+++++THGH+D
Sbjct: 1   MKVTLIPVTPFQQNSSLLVCEATGRAAVVHPGGDLDIIQGEIARQNVTVEKVFLTHGHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H  GA  L     + I GPH D+   + K+ +Q+        A     DRWLQ+G+++  
Sbjct: 61  HCAGAKTLATHYGVPIEGPHSDERFWLDKLPDQSTRFGFPA-AEAFEPDRWLQNGESVRF 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V+HCPGH+PGHV++ +  +  A +GDTLF  SIGRTD   G++  L+ SI  K+
Sbjct: 120 GDETLEVYHCPGHTPGHVVFFSRAHRLALVGDTLFAGSIGRTDFPRGNHADLVRSIREKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            PLGD+I+FV GHGP ST G ERR NP++   +
Sbjct: 180 WPLGDDITFVPGHGPTSTFGAERRTNPYVADGV 212


>gi|52424879|ref|YP_088016.1| GloB protein [Mannheimia succiniciproducens MBEL55E]
 gi|52306931|gb|AAU37431.1| GloB protein [Mannheimia succiniciproducens MBEL55E]
          Length = 209

 Score =  182 bits (461), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 81/210 (38%), Positives = 123/210 (58%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           ++  I+ VT F+QNC+ ++D+    A ++DPGG+   + + I+     +K I +THGH+D
Sbjct: 1   MNIDIIPVTSFQQNCSLIWDDR-KNAAIIDPGGEPKKLIEKIEENGLDLKMILLTHGHLD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G A  LK    + IIGPH+DD      + +Q+    +             ++ + L +
Sbjct: 60  HIGAAPALKAHFGVDIIGPHEDDVFWFENLPQQSAQFGLFEANAFLPDMWLNRENEVLEV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G+   +V H PGH+PGHV +   +N  A  GD LFR+SIGRTD   G Y  LI+SI  K+
Sbjct: 120 GSLKLEVLHLPGHTPGHVGFFEHQNIVAFTGDVLFRNSIGRTDFPGGSYDDLISSIKEKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
            PLGD+   + GHGP +TIG E++ NP+LK
Sbjct: 180 FPLGDDWIIIPGHGPYTTIGAEKKTNPYLK 209


>gi|225852994|ref|YP_002733227.1| beta-lactamase domain-containing protein [Brucella melitensis ATCC
           23457]
 gi|256114075|ref|ZP_05454845.1| beta-lactamase domain protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|256263524|ref|ZP_05466056.1| beta-lactamase domain-containing protein [Brucella melitensis bv. 2
           str. 63/9]
 gi|265995408|ref|ZP_06107965.1| beta-lactamase domain-containing protein [Brucella melitensis bv. 3
           str. Ether]
 gi|225641359|gb|ACO01273.1| beta-lactamase domain protein [Brucella melitensis ATCC 23457]
 gi|262766521|gb|EEZ12310.1| beta-lactamase domain-containing protein [Brucella melitensis bv. 3
           str. Ether]
 gi|263093554|gb|EEZ17579.1| beta-lactamase domain-containing protein [Brucella melitensis bv. 2
           str. 63/9]
 gi|326409534|gb|ADZ66599.1| beta-lactamase domain-containing protein [Brucella melitensis M28]
 gi|326539242|gb|ADZ87457.1| beta-lactamase domain protein [Brucella melitensis M5-90]
          Length = 218

 Score =  182 bits (461), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 110/214 (51%), Positives = 143/214 (66%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M +L   IV VTPF+QNCT LFD E+ + VV+DPGGDL  I++ I+S+   V+ IWITHG
Sbjct: 1   MRQLQAIIVPVTPFQQNCTILFDGETKKGVVIDPGGDLARIREAIESQGIDVEAIWITHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DH   A  LKE L + IIGPH+DD  ++  +        I    RN + D+WL++GD 
Sbjct: 61  HIDHAAAALDLKEALGVDIIGPHRDDKFLLDNLVAAGLKYGITEGVRNVTPDQWLEEGDK 120

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           + +  H+F VFHCPGH+PGHV++ N E  FA +GD LF  S+GRTD+  GD+  LI SI 
Sbjct: 121 VCVAGHVFDVFHCPGHAPGHVVFFNPEARFAIVGDVLFNGSVGRTDLPGGDHATLIRSIK 180

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
            K+LPLGD+I F+CGHGP    G ERR NPFL  
Sbjct: 181 EKLLPLGDDIGFICGHGPGGRFGEERRSNPFLTD 214


>gi|262375096|ref|ZP_06068330.1| metallo-beta-lactamase superfamily protein [Acinetobacter lwoffii
           SH145]
 gi|262310109|gb|EEY91238.1| metallo-beta-lactamase superfamily protein [Acinetobacter lwoffii
           SH145]
          Length = 214

 Score =  182 bits (461), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 84/209 (40%), Positives = 126/209 (60%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L   IV VT F+QNC+ ++D E+ EA+++D GG+ + +K  +++    VK +W+THGH+D
Sbjct: 2   LQVKIVPVTAFQQNCSIVWDTETKEAILIDAGGEPEKLKTEVEALGLTVKALWLTHGHLD 61

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H G    LK+   + +IGPHK+DA  +  + E +               +WL+ G+ L L
Sbjct: 62  HAGAVGALKKAWDVPVIGPHKEDAFWLDMIQEVSARYGF-PIPEKVEVTQWLEGGEVLKL 120

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   F+V   PGH+PGHV++ N   +    GD LF+ SIGRTD   G++QQL++SI  + 
Sbjct: 121 GNEEFEVRFAPGHTPGHVMFYNKNYDLLWTGDVLFKGSIGRTDFPRGNHQQLLDSIQREC 180

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
             L DE  F+ GHG  STIG E++ NPF+
Sbjct: 181 FSLPDETQFISGHGSISTIGFEKQHNPFV 209


>gi|320540485|ref|ZP_08040135.1| putative predicted metal-binding enzyme [Serratia symbiotica str.
           Tucson]
 gi|320029416|gb|EFW11445.1| putative predicted metal-binding enzyme [Serratia symbiotica str.
           Tucson]
          Length = 215

 Score =  182 bits (461), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 90/211 (42%), Positives = 136/211 (64%), Gaps = 1/211 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + +HI+ VT F QNC+ ++ E + +A +VDPGGD + IK  +  R   + QI +THGH+D
Sbjct: 1   MKYHIIPVTAFSQNCSLIWCEHTQQAALVDPGGDAEKIKAEVARRGVTLSQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L E   + I+GP K+DA  +G +  Q+++  +   A      +WL +GD + +
Sbjct: 61  HVGAAAELAEHYQVPILGPDKEDAFWLGGLPAQSQMFGLEECA-PLIPTQWLAEGDEVKV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    KV HCPGH+PGH++++N +   A +GD LF   +GR+D   GD+Q LIN+I  K+
Sbjct: 120 GEMTLKVLHCPGHTPGHIVFINQQARLALVGDVLFNGGVGRSDFPRGDHQALINAIRTKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           LP GD++ F+ GHG  S+ G ER+ NPFL+ 
Sbjct: 180 LPQGDDMGFIPGHGSMSSFGHERQTNPFLRE 210


>gi|157961461|ref|YP_001501495.1| beta-lactamase domain-containing protein [Shewanella pealeana ATCC
           700345]
 gi|157846461|gb|ABV86960.1| beta-lactamase domain protein [Shewanella pealeana ATCC 700345]
          Length = 214

 Score =  181 bits (460), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 85/213 (39%), Positives = 134/213 (62%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + ++ VTPF+QNC+ ++ +++++A VVDPGG+++ I +        V+++ +THGH+D
Sbjct: 1   MKYQLIPVTPFQQNCSLIWCDQTMKAAVVDPGGNIERILEEAAKNKVVVEKVLLTHGHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG A  L E L++ IIGPHK D   +  + +Q++           +  ++L+DGD + +
Sbjct: 61  HVGAAKSLAEQLNVPIIGPHKADEYWLDSLPKQSQHFGFVHC-DAFAPTQYLEDGDDVTV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G  + KV HCPGH+PGHV++       A +GD LFR SIGRTD    ++Q LI+SI  K+
Sbjct: 120 GNQVLKVLHCPGHTPGHVVFFAQSAKLAWVGDVLFRGSIGRTDFPLSNHQDLIDSITQKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
             LG ++ F+ GHGP ST G ER  NPF+   +
Sbjct: 180 WSLGSDVQFIPGHGPLSTFGDERVQNPFVADQL 212


>gi|148264967|ref|YP_001231673.1| beta-lactamase domain-containing protein [Geobacter uraniireducens
           Rf4]
 gi|146398467|gb|ABQ27100.1| beta-lactamase domain protein [Geobacter uraniireducens Rf4]
          Length = 251

 Score =  181 bits (460), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 71/213 (33%), Positives = 102/213 (47%), Gaps = 2/213 (0%)

Query: 2   SKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGH 61
           S + F  V V     NC  L  EE+ E +VVDPG D D +   ++     +K +  THGH
Sbjct: 40  SPMIFETVVVGQLGVNCFILGCEETKEGIVVDPGADADRVLAAVKKSGLAIKYVLNTHGH 99

Query: 62  VDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
            DHVGG  +L E     +   H+ D   + +  E A    ++    +   D  L+DG  +
Sbjct: 100 FDHVGGNRRLLEATGAKL-LIHEADVYFLSRAAEVAAAYGLKT-ENSPKPDGLLEDGMVV 157

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
           + G+   KV H PGH+PG              GDTLF   +GRTD     ++ LI  I N
Sbjct: 158 IFGSQQLKVLHTPGHTPGGCCLYLESEGKVITGDTLFADGVGRTDFPGSSHEALIEGIRN 217

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           K+  L +      GHGP+S IG E+  NP+++ 
Sbjct: 218 KLFTLPEPTLVYPGHGPSSNIGHEKSNNPYVRG 250


>gi|148827091|ref|YP_001291844.1| hypothetical protein CGSHiGG_02040 [Haemophilus influenzae PittGG]
 gi|148718333|gb|ABQ99460.1| hypothetical protein CGSHiGG_02040 [Haemophilus influenzae PittGG]
          Length = 212

 Score =  181 bits (460), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 85/211 (40%), Positives = 130/211 (61%), Gaps = 1/211 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           ++  I+ VT F+QNC+ ++D+E   A ++DPGG+ + +   I+  + ++K I ITHGH+D
Sbjct: 1   MNIEIIPVTAFQQNCSLIWDDE-KNAAIIDPGGEAERLIQRIEELDLNLKVILITHGHLD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG A QLK+   + I G ++ D  +   + EQA+   +           + Q+G+ L L
Sbjct: 60  HVGAAMQLKQHFGVEIWGSNEKDKFLFESLPEQAQRFGLPNIDAFLPDRWFNQEGEILKL 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
               F++ H PGH+PGH+ ++  E   A  GD LF+  IGRTD   GDY+ LI+SI  K+
Sbjct: 120 DGFNFEILHLPGHTPGHIGFIEHEKKVAFTGDVLFQGGIGRTDFPRGDYETLISSIRTKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           LPL D++  + GHGP +TIGRE++ NPFL S
Sbjct: 180 LPLNDDLIIIAGHGPYTTIGREKQTNPFLNS 210


>gi|294338482|emb|CAZ86808.1| putative Hydroxyacylglutathione hydrolase [Thiomonas sp. 3As]
          Length = 212

 Score =  181 bits (460), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 89/211 (42%), Positives = 131/211 (62%), Gaps = 1/211 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L + I+ VT F QN   ++D+ + EAV  DPGG++D +   +      ++ +W+TH H+D
Sbjct: 2   LRYRILPVTAFAQNTCLVWDDATQEAVFTDPGGEVDRLLQAVVEAGVTLRAVWLTHAHID 61

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H G AA++ +   + IIGPH  D   +  + +QA+       A+  + DRWL DGDTL L
Sbjct: 62  HAGAAAEVAQRAGVPIIGPHPGDQFWIDALPQQAQRFGFPP-AKTFTPDRWLADGDTLQL 120

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G+  F V HCPGH+PGHV++   E     +GD LF  SIGRTD   G++QQL++SI  K+
Sbjct: 121 GSLPFTVRHCPGHTPGHVVFHQPEARRCWVGDVLFAGSIGRTDFPGGNHQQLLDSITGKL 180

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
            P+GD+  F+ GHGP ST G +RR NP+++ 
Sbjct: 181 WPMGDDTVFIPGHGPESTFGEQRRSNPYVRG 211


>gi|84393107|ref|ZP_00991872.1| Glyoxylase II family protein [Vibrio splendidus 12B01]
 gi|84376264|gb|EAP93147.1| Glyoxylase II family protein [Vibrio splendidus 12B01]
          Length = 217

 Score =  181 bits (460), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 89/216 (41%), Positives = 134/216 (62%), Gaps = 2/216 (0%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           MS L + +V VT F QNC+ ++ +E++E +VVDPGGD+  +  +I+     V  + +THG
Sbjct: 1   MS-LKYQVVPVTSFSQNCSIVWCDETMEGIVVDPGGDVQQLAAIIEELGVKVVNLVLTHG 59

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DHVGG   L E L++ I+GPHK D   +  ++ Q+++    +  +    + WL++GD 
Sbjct: 60  HLDHVGGTVPLAEILNVNIVGPHKADNFWLQGLENQSQMFGFPLC-KAFEPNTWLEEGDK 118

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           +  G  +  V H PGH+PGHV+  + +   A +GD LF  +IGRTD   GD+  LI SI 
Sbjct: 119 VTFGNQVIDVIHTPGHTPGHVVLFSEQARMAFVGDVLFNGAIGRTDFPQGDFNTLIASIK 178

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            K+ PLG +++FV GHGP ST GRER  NPF+   +
Sbjct: 179 TKLWPLGSDVTFVPGHGPESTFGRERASNPFVADEM 214


>gi|71279331|ref|YP_270254.1| metallo-beta-lactamase family protein [Colwellia psychrerythraea
           34H]
 gi|71145071|gb|AAZ25544.1| metallo-beta-lactamase family protein [Colwellia psychrerythraea
           34H]
          Length = 219

 Score =  181 bits (460), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 88/210 (41%), Positives = 128/210 (60%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L   I+ VTPF+QNCT  +  ++ +A VVDPGGD++ IK  I      +++I ITH H+D
Sbjct: 2   LKHEIIPVTPFEQNCTLFWCSDTKKAAVVDPGGDIEKIKAGITKHGLTLEKILITHAHID 61

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLL-SIRMNARNASSDRWLQDGDTLL 122
           H G    L     + I GPHK+D   +  +++Q +        A+  + +R+L  GDT+ 
Sbjct: 62  HAGATDDLANHYDVLIEGPHKEDQFWIDGIEDQKQRFGGAFSYAKKFTPNRFLDQGDTVS 121

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
            G  + +V+ CPGH+PGHV++ + E+  A +GD LF  SIGRTD   GD+  LINSI   
Sbjct: 122 FGNIVMEVYFCPGHTPGHVVFFHRESKLAQVGDVLFSGSIGRTDFPRGDHATLINSIRKN 181

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           +  LGD++ F+ GHGP ST G+ERR NP +
Sbjct: 182 LFLLGDDVRFIPGHGPMSTFGQERRSNPHV 211


>gi|158422364|ref|YP_001523656.1| putative Zn-dependent hydrolase [Azorhizobium caulinodans ORS 571]
 gi|158329253|dbj|BAF86738.1| putative Zn-dependent hydrolase [Azorhizobium caulinodans ORS 571]
          Length = 215

 Score =  181 bits (460), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 94/214 (43%), Positives = 136/214 (63%), Gaps = 1/214 (0%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M  +   +V VTPF QNC+ L+   + +  V+DPGGDL  I+  ++     V++I +THG
Sbjct: 1   MQPIQIAVVPVTPFDQNCSILWCTATKKGAVIDPGGDLPRIEAALKETGITVEKILLTHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           HVDH  GAA+L E L + I GP++ D  +M  + + A        ARN +  R+L++GDT
Sbjct: 61  HVDHAAGAAELSETLGVPIEGPNEKDQFLMDGLVDSAARF-GMEGARNVTPTRYLKEGDT 119

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           + +G    +V   PGH+PGHV++V+   N A +GDTLFR S+GRTD  +GD + LI+ I 
Sbjct: 120 VTIGEVTLEVLDVPGHTPGHVVFVHKGTNVAIVGDTLFRGSVGRTDFPYGDPELLISGIV 179

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           +K+LPLGD +  + GHGP ++IG ERR NPFL  
Sbjct: 180 SKLLPLGDAVVCLPGHGPVTSIGDERRSNPFLNG 213


>gi|218709904|ref|YP_002417525.1| glyoxylase II family protein [Vibrio splendidus LGP32]
 gi|218322923|emb|CAV19100.1| glyoxylase II family protein [Vibrio splendidus LGP32]
          Length = 219

 Score =  181 bits (460), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 89/216 (41%), Positives = 133/216 (61%), Gaps = 2/216 (0%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           MS L + +V VT F QNC+ ++ +E++E +VVDPGGD+  +  +I+     V  + +THG
Sbjct: 3   MS-LKYQVVPVTSFSQNCSIVWCDETMEGIVVDPGGDVQQLAAIIEELGVKVVNLVLTHG 61

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DHVGG   L E L++ I+GPHK D   +  ++ Q+++    +  +    + WL++GD 
Sbjct: 62  HLDHVGGTVPLAEILNVNIVGPHKADNFWLQGLENQSQMFGFPLC-KAFEPNTWLEEGDK 120

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           +  G  +  V H PGH+PGHV+  + +   A +GD LF  +IGRTD   GD+  LI SI 
Sbjct: 121 VTFGNQVIDVIHTPGHTPGHVVLFSEQARMAFVGDVLFNGAIGRTDFPQGDFNTLIASIK 180

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            K+ PLG ++ FV GHGP ST GRER  NPF+   +
Sbjct: 181 TKLWPLGSDVRFVPGHGPESTFGRERASNPFVADEM 216


>gi|296134547|ref|YP_003641789.1| beta-lactamase domain-containing protein [Thiomonas intermedia K12]
 gi|295794669|gb|ADG29459.1| beta-lactamase domain-containing protein [Thiomonas intermedia K12]
          Length = 212

 Score =  181 bits (460), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 90/211 (42%), Positives = 131/211 (62%), Gaps = 1/211 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L + I+ VT F QN   ++D+ + EAV  DPGG++D +   +      ++ +W+TH H+D
Sbjct: 2   LRYRILPVTAFAQNTCLVWDDAAQEAVFTDPGGEVDRLLQAVVEAGVTLRAVWLTHAHID 61

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H G AA++ +   + IIGPH  D   +  + +QA+       A+  + DRWL DGDTL L
Sbjct: 62  HAGAAAEVAQRAGVPIIGPHPGDQFWIDALPQQAQRFGFPP-AKTFTPDRWLADGDTLQL 120

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G+  F V HCPGH+PGHV++   E     +GD LF  SIGRTD   G++QQL++SI  K+
Sbjct: 121 GSLPFTVRHCPGHTPGHVVFHQPEARRCWVGDVLFAGSIGRTDFPGGNHQQLLDSITGKL 180

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
            P+GD+  F+ GHGP ST G ERR NP+++ 
Sbjct: 181 WPMGDDTVFIPGHGPESTFGEERRSNPYVRG 211


>gi|27376011|ref|NP_767540.1| hydrolase [Bradyrhizobium japonicum USDA 110]
 gi|27349150|dbj|BAC46165.1| bll0900 [Bradyrhizobium japonicum USDA 110]
          Length = 230

 Score =  181 bits (460), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 101/209 (48%), Positives = 141/209 (67%), Gaps = 1/209 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           IV VT F+QNCT ++DE   +AVV+DPGGD+  I + I+     V++IW+THGH+DHVGG
Sbjct: 23  IVPVTLFEQNCTIIWDEPGKKAVVIDPGGDVPKILEAIKQTGVTVEKIWLTHGHIDHVGG 82

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           AA+L++ L + I GPH+ D  ++  V E           RN + +RWL++GDT+ +G   
Sbjct: 83  AAELRDALKVPIEGPHQADKFLLDNVVESGARF-GMTGVRNFAPNRWLEEGDTVSIGGLQ 141

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
           F + HCPGHSPG V + N E  FAH+GD LF  S+GRTD+  G +  LI+SI  K+LPLG
Sbjct: 142 FDILHCPGHSPGSVAFFNKELRFAHVGDVLFAGSVGRTDLPGGSHATLISSIKTKLLPLG 201

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           D++ F+CGHG  S+IG+ER  NPF+   +
Sbjct: 202 DDVGFICGHGAGSSIGQERMTNPFITGEM 230


>gi|150397440|ref|YP_001327907.1| beta-lactamase domain-containing protein [Sinorhizobium medicae
           WSM419]
 gi|150028955|gb|ABR61072.1| beta-lactamase domain protein [Sinorhizobium medicae WSM419]
          Length = 213

 Score =  181 bits (459), Expect = 6e-44,   Method: Composition-based stats.
 Identities = 116/207 (56%), Positives = 151/207 (72%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           I+ VT F+QNCT LFD ES E VVVDPGGD+DII   ++     +K IW+THGH+DH GG
Sbjct: 6   IIPVTHFEQNCTVLFDSESKEGVVVDPGGDVDIILQTVRENGILLKAIWLTHGHIDHAGG 65

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           A +LKE L L I+GPHK D  ++ ++++QA    + M  +N   DRWL+DGDT+  G H+
Sbjct: 66  AKELKEALGLEIVGPHKADLPLLERLEDQAERFGLAMKVQNVVPDRWLEDGDTVSFGDHL 125

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
           F+V HCPGH+PGHV+Y N    FAH+GD LF  SIGRTD+  G++QQL++SI +KILPLG
Sbjct: 126 FEVLHCPGHAPGHVVYFNRAQKFAHVGDVLFHGSIGRTDLPGGNHQQLLDSIRDKILPLG 185

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLKS 214
           DE+ F+CGHGP   +G ERR NPFL+ 
Sbjct: 186 DEVGFICGHGPGGQVGEERRSNPFLRG 212


>gi|114562588|ref|YP_750101.1| beta-lactamase domain-containing protein [Shewanella frigidimarina
           NCIMB 400]
 gi|114333881|gb|ABI71263.1| beta-lactamase domain protein [Shewanella frigidimarina NCIMB 400]
          Length = 214

 Score =  181 bits (459), Expect = 6e-44,   Method: Composition-based stats.
 Identities = 88/213 (41%), Positives = 137/213 (64%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + I+ VTPF+QNC+ ++ E++L+A VVDPGG++D I   +     +V++I +THGH+D
Sbjct: 1   MKYQIIPVTPFQQNCSVIWCEKTLKAAVVDPGGNIDRILAEVAKLGVNVEKILLTHGHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVGGAA+L + L++ IIGPH  D   +  + +Q++              ++L +GD + +
Sbjct: 61  HVGGAAELAKKLAVPIIGPHIADKFWLENLVKQSQNFGF-PRTEAFEPTQYLNEGDEVSV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGH+++ +   N A +GD LFR SIGRTD    ++Q L++SI  K+
Sbjct: 120 GEQHLQVLHCPGHTPGHIVFYDKIANLAWVGDVLFRGSIGRTDFPQSNHQDLLHSITTKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            PLG  +SF+ GHGP ST   ER+ NPF+   +
Sbjct: 180 WPLGLNVSFIPGHGPMSTFADERQHNPFVADQL 212


>gi|149186067|ref|ZP_01864381.1| glyoxalase II family protein [Erythrobacter sp. SD-21]
 gi|148830098|gb|EDL48535.1| glyoxalase II family protein [Erythrobacter sp. SD-21]
          Length = 213

 Score =  181 bits (459), Expect = 6e-44,   Method: Composition-based stats.
 Identities = 89/209 (42%), Positives = 134/209 (64%), Gaps = 2/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +   IV VTP +QNC+ ++   + +  ++DPGGDLD +K  +      +++I ITHGH+D
Sbjct: 1   MKAGIVPVTPLQQNCSLVWCTATNKGALIDPGGDLDKLKAAVAQTGVELEKILITHGHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H G A  L ++L L I GPH+ D   + ++DE      +         DRWL+DGDT+ +
Sbjct: 61  HCGEAGILAKELGLKIEGPHEADRFWISRLDEDGARYGVNGQV--FEPDRWLEDGDTVTV 118

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGHV++ +  + FA +GD LF+ SIGRTD   G++Q LI++I  K+
Sbjct: 119 GELTLEVIHCPGHTPGHVVFFHRPSKFAVVGDVLFQGSIGRTDFPMGNHQDLIDAITQKL 178

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
            PLGD+++F+ GHGP ST G+ER+ N F+
Sbjct: 179 WPLGDDVTFIPGHGPTSTFGQERKTNAFV 207


>gi|110835247|ref|YP_694106.1| metallo-beta-lactamase family protein [Alcanivorax borkumensis SK2]
 gi|110648358|emb|CAL17834.1| metallo-beta-lactamase family protein [Alcanivorax borkumensis SK2]
          Length = 213

 Score =  181 bits (459), Expect = 7e-44,   Method: Composition-based stats.
 Identities = 93/209 (44%), Positives = 135/209 (64%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + IV VTPF+QNC+ L  E + +  +VDPGGDL+ I   ++      ++I +TH H+D
Sbjct: 1   MKYAIVPVTPFQQNCSILKCEATNKVAIVDPGGDLENILTALEQIGGTPEKILVTHAHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G  A L E LSL I GPH+DD   +  + +QA+++     +R  + DRWL+ GD++ +
Sbjct: 61  HIGAVADLAERLSLPIEGPHRDDQFWIDMLPQQAQMMGFAP-SRPFTPDRWLEGGDSVTV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   F+V HCPGH+PGHV++   E     +GD LF  SIGRTD   GD+  LI +I +++
Sbjct: 120 GETRFEVRHCPGHTPGHVVFYQPEAKLVVVGDVLFNGSIGRTDFPKGDHDTLIQAIKDQL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           L L D++SF+ GHGP STIG ER  NPF+
Sbjct: 180 LTLDDDVSFIPGHGPMSTIGHERSHNPFV 208


>gi|167624548|ref|YP_001674842.1| beta-lactamase domain-containing protein [Shewanella halifaxensis
           HAW-EB4]
 gi|167354570|gb|ABZ77183.1| beta-lactamase domain protein [Shewanella halifaxensis HAW-EB4]
          Length = 214

 Score =  181 bits (458), Expect = 7e-44,   Method: Composition-based stats.
 Identities = 85/213 (39%), Positives = 139/213 (65%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + ++ VTPF+QNC+ ++ E++++A VVDPGG+++ I +     N  ++++ +THGH+D
Sbjct: 1   MKYQLIPVTPFQQNCSLIWCEQTMKAAVVDPGGNVERILEQASKNNLVIEKVLLTHGHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVGGA  L + L++ IIGPHK D   +  + +Q++           +  ++L++GD + +
Sbjct: 61  HVGGAKLLADQLNVPIIGPHKADDYWLESLPKQSQHFGFVHC-DAFTPTQYLEEGDEVTV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G  + KV H PGH+PGH+++   E+  A +GD LFR SIGRTD    ++Q LI+SI  K+
Sbjct: 120 GQQVLKVIHTPGHTPGHIVFFAKESKVAWVGDVLFRGSIGRTDFPLSNHQDLIDSITQKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            PLG+++ F+ GHGP ST G ER  NPF+   +
Sbjct: 180 WPLGNDVQFIPGHGPLSTFGDERVQNPFVADQL 212


>gi|85713982|ref|ZP_01044971.1| beta-lactamase-like [Nitrobacter sp. Nb-311A]
 gi|85699108|gb|EAQ36976.1| beta-lactamase-like [Nitrobacter sp. Nb-311A]
          Length = 222

 Score =  181 bits (458), Expect = 7e-44,   Method: Composition-based stats.
 Identities = 106/209 (50%), Positives = 144/209 (68%), Gaps = 1/209 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           ++ VTPF+QNCT L+ E +   VV+DPGGD+ ++   I+  +  V +IW+THGH+DHVGG
Sbjct: 15  VIPVTPFRQNCTLLWCEATKNGVVIDPGGDIPLVMAAIKKADVSVGRIWLTHGHIDHVGG 74

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           AA+L++ L + I GPH  D  ++  V E  R   +    RN + DRWL++GD + LG   
Sbjct: 75  AAELRDTLKVPIEGPHIADKFLLDHVVESGRHYGMTGM-RNFTPDRWLEEGDRIELGQLT 133

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
           F V HCPGHSPG V++ N E  FAH+GD LF  S+GRTD+  G +  LI SI +K+LPLG
Sbjct: 134 FDVLHCPGHSPGSVVFFNPEMRFAHVGDVLFNGSVGRTDLPGGSHAMLIKSITDKLLPLG 193

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           D+++F+CGHGP STIGRER  NPFL  N+
Sbjct: 194 DDVAFICGHGPGSTIGRERVSNPFLTGNV 222


>gi|222056608|ref|YP_002538970.1| beta-lactamase domain protein [Geobacter sp. FRC-32]
 gi|221565897|gb|ACM21869.1| beta-lactamase domain protein [Geobacter sp. FRC-32]
          Length = 207

 Score =  181 bits (458), Expect = 7e-44,   Method: Composition-based stats.
 Identities = 73/209 (34%), Positives = 104/209 (49%), Gaps = 2/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + F  + V     NC  L  EE+ E +VVDPG D + +  V+Q     ++ +  THGH D
Sbjct: 1   MIFETIVVGQLGVNCFILGCEETREGIVVDPGADAERVLAVVQKLGLKIRYVINTHGHFD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+GG   + E     +   H+ D   + +  + A    ++    ++  D  LQDG  +  
Sbjct: 61  HMGGNRSIIEKTGAKL-LIHESDVYFLSRAADSAASYGLKA-ENSSKPDDLLQDGMVVNF 118

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G H  KV H PGH+PG         +    GDTLF  S+GRTD        LI+ I  K+
Sbjct: 119 GKHQLKVLHTPGHTPGGCCLYLESEDKIITGDTLFAESVGRTDFPGSSQADLIDGIRTKL 178

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           L L DE     GHGP++TIG E+R NP+L
Sbjct: 179 LVLPDETQAFPGHGPSTTIGHEKRHNPYL 207


>gi|85374555|ref|YP_458617.1| glyoxalase II family protein [Erythrobacter litoralis HTCC2594]
 gi|84787638|gb|ABC63820.1| glyoxalase II family protein [Erythrobacter litoralis HTCC2594]
          Length = 221

 Score =  181 bits (458), Expect = 8e-44,   Method: Composition-based stats.
 Identities = 89/211 (42%), Positives = 135/211 (63%), Gaps = 2/211 (0%)

Query: 2   SKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGH 61
           S +   I+ VTP +QNC+ ++   + +  ++DPGGDLD +K  ++     +++I ITHGH
Sbjct: 7   SPMKAGIIPVTPLQQNCSLIWCTATNKGALIDPGGDLDKLKAGVKKTGVELEKILITHGH 66

Query: 62  VDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
           +DH G A  L ++L L I GPH+ D   + ++DE  +   I         DRWL DGDT+
Sbjct: 67  IDHCGEAGVLAKELGLPIEGPHEADRFWISRLDEDGKKYGI--AGEVFEPDRWLDDGDTV 124

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
            +G     V HCPGH+PGHV++ +  + FA +GD LF+ SIGRTD   G++Q LI++I  
Sbjct: 125 TVGELELDVIHCPGHTPGHVVFYHAPSKFAVVGDVLFQGSIGRTDFPMGNHQDLIDAITQ 184

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           K+ PLG++++F+ GHGP ST G+ER+ N F+
Sbjct: 185 KLWPLGNDVTFIPGHGPTSTFGQERKTNAFV 215


>gi|15889480|ref|NP_355161.1| hydrolase [Agrobacterium tumefaciens str. C58]
 gi|15157350|gb|AAK87946.1| hydrolase [Agrobacterium tumefaciens str. C58]
          Length = 214

 Score =  181 bits (458), Expect = 8e-44,   Method: Composition-based stats.
 Identities = 112/214 (52%), Positives = 156/214 (72%), Gaps = 1/214 (0%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M KL   I+ VTPF+QNCT LFD+++ E VVVDPGGD+D+I  V+      +K IW+THG
Sbjct: 1   MGKLQAGIIPVTPFEQNCTILFDQDTKEGVVVDPGGDVDVILQVVAENGITLKAIWLTHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DH GGA +L+E LSL++IGPH+ D  ++ +++ QA+   I    +N   D WL+DGD 
Sbjct: 61  HLDHAGGADELREKLSLSVIGPHEHDRPLLERIEVQAQKYGI-SGLKNVEPDSWLKDGDK 119

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           +  G H+F+V+HCPGH+PGHVIY N + NFAH+GD LF  S+GRTD+  G+++QL+ SI 
Sbjct: 120 VSFGDHVFEVYHCPGHAPGHVIYYNRDQNFAHVGDVLFSGSVGRTDLPGGNHEQLMASIR 179

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           +K+LPLGD++ F+CGHGP   +G ER  NP+LK 
Sbjct: 180 DKLLPLGDDVGFICGHGPGGRLGEERLNNPYLKG 213


>gi|90421898|ref|YP_530268.1| beta-lactamase-like [Rhodopseudomonas palustris BisB18]
 gi|90103912|gb|ABD85949.1| beta-lactamase-like [Rhodopseudomonas palustris BisB18]
          Length = 222

 Score =  181 bits (458), Expect = 8e-44,   Method: Composition-based stats.
 Identities = 101/209 (48%), Positives = 142/209 (67%), Gaps = 1/209 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           I+ VT F+QNCT L+ E + +AVVVDPGG++  I   I+     V++IW+THGH+DHVGG
Sbjct: 15  IIPVTLFQQNCTLLWCETTRKAVVVDPGGEVPQILAAIKQAEVTVEKIWLTHGHIDHVGG 74

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           AA L++DL + I GPH+ D  ++  V     +  +    R+   DRWL++G+T+ +G   
Sbjct: 75  AADLRDDLKVPIEGPHRADKYLLNNVVTSGEMFGMTGM-RDVLPDRWLEEGETVSVGELS 133

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
           F + HCPGHSPG V+Y N +  FA +GD LF+ SIGRTD+  G +  L+ SI  K+LPLG
Sbjct: 134 FSILHCPGHSPGSVVYFNDQMRFALVGDVLFKGSIGRTDLSGGCHATLMESITRKLLPLG 193

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           D++SF+CGHGP ST+G ER  NPFL  ++
Sbjct: 194 DDVSFICGHGPGSTLGHERLSNPFLTGDL 222


>gi|192358886|ref|YP_001983591.1| metallo-beta-lactamase superfamily protein [Cellvibrio japonicus
           Ueda107]
 gi|190685051|gb|ACE82729.1| metallo-beta-lactamase superfamily protein [Cellvibrio japonicus
           Ueda107]
          Length = 215

 Score =  180 bits (457), Expect = 9e-44,   Method: Composition-based stats.
 Identities = 95/211 (45%), Positives = 142/211 (67%), Gaps = 1/211 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L + I+ VT ++QNCT L+ +++ EA VVDPGGD+  I   ++     + QI +THGH+D
Sbjct: 2   LQYQIIPVTHYQQNCTLLWCDQTREAAVVDPGGDVARILAEVERLQLKLTQILLTHGHLD 61

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVGG A L +   L +IGPH+DD   +G + +QA+++     A N + DR+L +GD +++
Sbjct: 62  HVGGTAALVQLRQLPVIGPHQDDMFWIGMLSQQAQMMGFAPVA-NFTPDRFLHEGDKVMV 120

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +VFHCPGH+PGHV++   E   A +GD LF+ S+GR+D   G++QQL++SI  K+
Sbjct: 121 GQAELEVFHCPGHTPGHVVFFCREAGLAQVGDVLFQGSVGRSDFPRGNHQQLVDSIRTKL 180

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
            PLGD + F+ GHGP S+ G+ERR NPF+  
Sbjct: 181 FPLGDAVKFIPGHGPMSSFGQERRTNPFVAD 211


>gi|316932038|ref|YP_004107020.1| metallo-hydrolase/oxidoreductase domain-containing protein
           [Rhodopseudomonas palustris DX-1]
 gi|315599752|gb|ADU42287.1| metallo-hydrolase/oxidoreductase domain-containing protein
           [Rhodopseudomonas palustris DX-1]
          Length = 222

 Score =  180 bits (457), Expect = 9e-44,   Method: Composition-based stats.
 Identities = 103/205 (50%), Positives = 141/205 (68%), Gaps = 1/205 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           I+ VTPF+QNCT L+ + + +AVVVDPGGD+  I   I++    V+ IW+THGH+DHVGG
Sbjct: 15  IIPVTPFQQNCTLLWCDTARKAVVVDPGGDVPEILAAIENTKVAVEAIWLTHGHIDHVGG 74

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           AA L++ L + IIGPH+DD  ++  V    R   I    R+ + DRWL DGD++ +G   
Sbjct: 75  AADLRDALKVEIIGPHRDDQFLLDNVVNSGRSFGI-GGVRDVTPDRWLDDGDSVRVGELT 133

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
           F++ HCPGHSPG V++ +    FA +GD LF  S+GRTD+  G +  LI+SI  K+LPLG
Sbjct: 134 FQILHCPGHSPGSVVFFSEAMRFALVGDVLFAGSVGRTDLPGGSHATLIDSITRKLLPLG 193

Query: 188 DEISFVCGHGPNSTIGRERRLNPFL 212
           D+I F+CGHGP S+ G+ER  NPFL
Sbjct: 194 DDIGFICGHGPGSSFGQERLTNPFL 218


>gi|326315156|ref|YP_004232828.1| beta-lactamase domain-containing protein [Acidovorax avenae subsp.
           avenae ATCC 19860]
 gi|323371992|gb|ADX44261.1| beta-lactamase domain protein [Acidovorax avenae subsp. avenae ATCC
           19860]
          Length = 212

 Score =  180 bits (457), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 93/209 (44%), Positives = 131/209 (62%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L +H   VT F+QNC+ ++ + +  A V+DPGGDLD +   ++ R   ++QIW+TH H+D
Sbjct: 2   LHYHTHPVTAFQQNCSLVWCDGAQAAAVIDPGGDLDQVLAEVERRGLRLEQIWLTHAHID 61

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GGA +L E LSL I GPH  D   +  + +Q+ +      AR  +   WL DGDT+ +
Sbjct: 62  HAGGAGELSERLSLPITGPHPGDQFWIDGLPQQSAMFGFPP-ARPFTPTHWLHDGDTVQI 120

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGH+PGHV++   +     +GD LF  SIGRTD   G++Q LI+SI  ++
Sbjct: 121 GNETLHVRHCPGHTPGHVVFHAPQIQRCFVGDVLFAGSIGRTDFPQGNHQDLIDSIVQRL 180

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
            P+GDE  F+ GHGP ST GRERR NP++
Sbjct: 181 WPMGDETVFIPGHGPESTFGRERRSNPYV 209


>gi|17986779|ref|NP_539413.1| hydroxyacylglutathione hydrolase [Brucella melitensis bv. 1 str.
           16M]
 gi|256045139|ref|ZP_05448039.1| hydroxyacylglutathione hydrolase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|260565263|ref|ZP_05835747.1| beta-lactamase domain-containing protein [Brucella melitensis bv. 1
           str. 16M]
 gi|265991572|ref|ZP_06104129.1| beta-lactamase domain-containing protein [Brucella melitensis bv. 1
           str. Rev.1]
 gi|17982409|gb|AAL51677.1| hydroxyacylglutathione hydrolase [Brucella melitensis bv. 1 str.
           16M]
 gi|260151331|gb|EEW86425.1| beta-lactamase domain-containing protein [Brucella melitensis bv. 1
           str. 16M]
 gi|263002356|gb|EEZ14931.1| beta-lactamase domain-containing protein [Brucella melitensis bv. 1
           str. Rev.1]
          Length = 218

 Score =  180 bits (457), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 110/214 (51%), Positives = 143/214 (66%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M +L   IV VTPF+QNCT LFD E+ + VV+DPGGDL  I++ I+S+   V+ IWITHG
Sbjct: 1   MRQLQAIIVPVTPFQQNCTILFDGETKKGVVIDPGGDLARIREAIESQGIDVEAIWITHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DH   A  LKE L + IIGPH+DD  ++  +        I    RN + D+WL++GD 
Sbjct: 61  HIDHAAAALDLKEALGVDIIGPHRDDKFLLDNLVAAGLKYGITEGVRNVTPDQWLEEGDK 120

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           + +  H+F VFHCPGH+PGHV++ N E  FA +GD LF  S+GRTD+  GD+  LI SI 
Sbjct: 121 VCVAGHVFDVFHCPGHAPGHVVFFNPEARFAIVGDVLFNGSVGRTDLPGGDHATLIRSIT 180

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
            K+LPLGD+I F+CGHGP    G ERR NPFL  
Sbjct: 181 EKLLPLGDDIGFICGHGPGGRFGEERRSNPFLTD 214


>gi|298292277|ref|YP_003694216.1| Zn-dependent hydrolase [Starkeya novella DSM 506]
 gi|296928788|gb|ADH89597.1| putative Zn-dependent hydrolase [Starkeya novella DSM 506]
          Length = 211

 Score =  180 bits (457), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 92/213 (43%), Positives = 133/213 (62%), Gaps = 2/213 (0%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M +L   +V VTPF+QNC+ ++DE S    V+DPGGD+  I   ++      ++I +THG
Sbjct: 1   MPELKVAVVPVTPFQQNCSIVWDETSKRGAVIDPGGDIPRILAALKELEVIPEKIVLTHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DH  GAA+L E L++ + GPH+ D  ++  +      +   +  R  + DRWL++GDT
Sbjct: 61  HIDHAAGAAELAETLNIPVEGPHEGDKFLLDNLPA--DGVRTGIPGRAVTPDRWLKEGDT 118

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           L +G   F V H PGH+PGH++ VN +N  A +GDTLF+ S+GRTD  +GD   LI  I 
Sbjct: 119 LDIGGVTFDVLHVPGHTPGHIVLVNRDNRLAIVGDTLFQRSVGRTDFPYGDGPLLIRGIK 178

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
            KILPLGD  + + GHG  + I  E+R NPFL+
Sbjct: 179 EKILPLGDAFTVLPGHGNATNIALEKRTNPFLR 211


>gi|148825796|ref|YP_001290549.1| carboxy-terminal protease [Haemophilus influenzae PittEE]
 gi|148715956|gb|ABQ98166.1| carboxy-terminal protease [Haemophilus influenzae PittEE]
          Length = 212

 Score =  180 bits (457), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 85/210 (40%), Positives = 129/210 (61%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           ++  I+ VT F+QNC+ ++D+E   A ++DPGG+ + +   I+  + ++K I ITHGH+D
Sbjct: 1   MNIEIIPVTAFQQNCSLIWDDE-KNAAIIDPGGEAERLIQRIEELDLNLKVILITHGHLD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG A QLK+   + I G H++D  +   + EQA+   +           + Q+G+ L L
Sbjct: 60  HVGAAMQLKQHFGVEIWGSHEEDKFLFESLPEQAQRFGLPNIDAFLPDRWFNQEGEILKL 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
               F++ H PGH+PGH+ ++  E   A  GD LF+  IGRTD   GDY+ LI+SI  K+
Sbjct: 120 DGFNFEILHLPGHTPGHIGFIEHEKKVAFTGDVLFQGGIGRTDFPRGDYETLISSIRTKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           LPL D+I  + GHG  +TIG+E+R NPFL 
Sbjct: 180 LPLNDDIIIIAGHGSYTTIGQEKRSNPFLN 209


>gi|299132887|ref|ZP_07026082.1| beta-lactamase domain protein [Afipia sp. 1NLS2]
 gi|298593024|gb|EFI53224.1| beta-lactamase domain protein [Afipia sp. 1NLS2]
          Length = 221

 Score =  180 bits (457), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 103/205 (50%), Positives = 141/205 (68%), Gaps = 1/205 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           I+ VTPF+QNC  L+ E++ +AVVVDPGGD+  I + I+     V+ IW+THGHVDHVGG
Sbjct: 14  IIPVTPFQQNCMLLWCEQTKKAVVVDPGGDVLDILNAIKQAGVKVEHIWLTHGHVDHVGG 73

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           A +L+E L + I GPH  D  ++  V + AR   +    R+ + D WL +GD + +G   
Sbjct: 74  ADELREHLKVPITGPHIADKFLLDHVVDSARRYGL-TGLRDVTPDTWLSEGDKVSVGELT 132

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
           F++ HCPGHSPG +++ N    FA +GD LF  SIGRTD+  GD++ L+ SI +K+LPLG
Sbjct: 133 FELLHCPGHSPGSMVFFNPAMKFAIMGDVLFNGSIGRTDLPGGDHETLLASIRDKVLPLG 192

Query: 188 DEISFVCGHGPNSTIGRERRLNPFL 212
           DE+ F+CGHGP STIG+ER  NPFL
Sbjct: 193 DEVGFICGHGPGSTIGQERLTNPFL 217


>gi|127513197|ref|YP_001094394.1| beta-lactamase domain-containing protein [Shewanella loihica PV-4]
 gi|126638492|gb|ABO24135.1| beta-lactamase domain protein [Shewanella loihica PV-4]
          Length = 214

 Score =  180 bits (456), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 89/213 (41%), Positives = 134/213 (62%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + IV VTPF+QNC+ ++ E++ +A VVDPGGD++ I+  +      +++I +THGH+D
Sbjct: 1   MKYQIVPVTPFQQNCSIIWCEKTKQAAVVDPGGDIERIQQQLAHHGLTLEKILLTHGHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVGGA  L +   + IIGPHKDDA  +  + +Q++       A      ++L  GD + +
Sbjct: 61  HVGGAKALADAAGVPIIGPHKDDAFWLETLPQQSKHFGFLPVA-AFEPAQYLISGDRVTV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGH+++ +  +  A +GD LF+ SIGRTD     +  LINSI   +
Sbjct: 120 GEQTLEVLHCPGHTPGHIVFYSEADKLAWVGDVLFKGSIGRTDFPQSSHTDLINSITQVL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            PLG E+SF+ GHGP ST G ER+ NPF+   +
Sbjct: 180 WPLGREVSFIPGHGPISTFGAERQQNPFVADQL 212


>gi|308049064|ref|YP_003912630.1| beta-lactamase domain protein [Ferrimonas balearica DSM 9799]
 gi|307631254|gb|ADN75556.1| beta-lactamase domain protein [Ferrimonas balearica DSM 9799]
          Length = 215

 Score =  180 bits (456), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 88/213 (41%), Positives = 134/213 (62%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + I+ VTPF+QNC+ ++ E++L+  V+DPGGD++ I+ VIQ R   V+++ +THGH+D
Sbjct: 1   MKYQIIPVTPFQQNCSLVWCEKTLKGAVIDPGGDVERIQAVIQERGITVEKVLLTHGHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GGA  L + L + I GPHK D   +  +  Q+++    + A   +  R+L+DGD +  
Sbjct: 61  HAGGADVLAQALEVGIEGPHKADQFWIDGLAHQSQMFGFPVIA-TFTPGRYLEDGDVIEF 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V H PGH+PGHV++ +     A +GD LF  SIGRTD    D+  L++SI  K+
Sbjct: 120 GEERLEVLHTPGHTPGHVVFFHRGEKLAFVGDVLFHGSIGRTDFPQSDHPSLLSSITQKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            PLG ++ FV GHGP +T   ERR NPF+   +
Sbjct: 180 WPLGSDVYFVPGHGPGATFADERRSNPFVADQV 212


>gi|90418268|ref|ZP_01226180.1| putative hydrolase [Aurantimonas manganoxydans SI85-9A1]
 gi|90337940|gb|EAS51591.1| putative hydrolase [Aurantimonas manganoxydans SI85-9A1]
          Length = 213

 Score =  180 bits (456), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 110/212 (51%), Positives = 144/212 (67%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M+ L+  IV VTPF+QNC  LFD E    VVVDPGGD+D I + I+     ++ IW+THG
Sbjct: 1   MTTLNAQIVPVTPFQQNCCILFDVEDKIGVVVDPGGDVDRILEAIEKAGIAIEAIWLTHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DH GGA +LKE L + I+GPHK D  ++  + EQAR+  I    R+ + DRWL++G+T
Sbjct: 61  HIDHAGGAMELKEHLGVDIVGPHKADDFLLAGLSEQARMFGIPGAVRDCTPDRWLEEGET 120

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           L    H F+V H PGH+PGHV++ N    F H GD LF  SIGRTD+  GD+  LI SI 
Sbjct: 121 LAFADHRFEVLHTPGHAPGHVVFYNRAAKFLHAGDVLFSGSIGRTDLPGGDHATLIASIK 180

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           +K+LPLGD++ F+CGHGP   +G ERR NPFL
Sbjct: 181 DKVLPLGDDVGFICGHGPGGRLGDERRGNPFL 212


>gi|39996225|ref|NP_952176.1| metallo-beta-lactamase family protein [Geobacter sulfurreducens
           PCA]
 gi|39982990|gb|AAR34449.1| metallo-beta-lactamase family protein [Geobacter sulfurreducens
           PCA]
 gi|298505237|gb|ADI83960.1| zinc-dependent hydrolase YcbL [Geobacter sulfurreducens KN400]
          Length = 209

 Score =  180 bits (456), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 78/211 (36%), Positives = 108/211 (51%), Gaps = 2/211 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + F  V V P   NC  L  E+S E V+VDPG +   I + +      V  +  THGH D
Sbjct: 1   MIFETVVVGPLGVNCFILGCEQSREGVIVDPGAESGRILERVGELGLKVGMVINTHGHFD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVGG  ++ E     +   H+DD   + +  + A +  +     + + D  L+DG TL +
Sbjct: 61  HVGGNRKVLEATGAKL-LVHRDDVHFLDRAADVAAMYGLDT-ENSPAPDSLLEDGMTLSV 118

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           GT   +V H PGH+PG    +         GDTLF  S+GRTD     ++ LI SI  K+
Sbjct: 119 GTLSLRVLHTPGHTPGGCCLLLEGEGKVLTGDTLFEESVGRTDFPGSSHEALITSIREKL 178

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           L L DE     GHGP ++IGRERR NP+L  
Sbjct: 179 LTLPDETEVYPGHGPATSIGRERRYNPYLTD 209


>gi|227356809|ref|ZP_03841194.1| zinc (Zn2+)-dependent hydrolase [Proteus mirabilis ATCC 29906]
 gi|227163099|gb|EEI48034.1| zinc (Zn2+)-dependent hydrolase [Proteus mirabilis ATCC 29906]
          Length = 215

 Score =  180 bits (456), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 94/212 (44%), Positives = 141/212 (66%), Gaps = 2/212 (0%)

Query: 6   FHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHV 65
           +HI+ VT + QNCT ++ ++S EA +VDPGGD++ +   I+ R   + ++ +THGH DHV
Sbjct: 2   YHIIPVTNYMQNCTLIWCDDSKEAAIVDPGGDVETLIAEIEQRQLKLTKVLLTHGHFDHV 61

Query: 66  GGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL-G 124
            G AQ+ E   + + GPHKDD  ++  +++Q R+ +     ++ + D+WL +GDT+ +  
Sbjct: 62  AGTAQIVEHFHVPVYGPHKDDNFLIEDLEQQCRMFNFPS-GKSFTPDQWLNEGDTVTIGK 120

Query: 125 THIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKIL 184
           T    V HCPGH+PGH+I+VN +N    +GD LFR SIGRTD   G++  LI SI NK+L
Sbjct: 121 TINLSVLHCPGHTPGHIIFVNHQNKLISMGDVLFRESIGRTDFPRGNHADLIASIKNKVL 180

Query: 185 PLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           PLGD+  F+ GHGP S +G ER+ NPFL+  +
Sbjct: 181 PLGDDYLFIPGHGPMSNLGHERQYNPFLQDEM 212


>gi|302382851|ref|YP_003818674.1| beta-lactamase [Brevundimonas subvibrioides ATCC 15264]
 gi|302193479|gb|ADL01051.1| beta-lactamase domain protein [Brevundimonas subvibrioides ATCC
           15264]
          Length = 242

 Score =  179 bits (455), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 94/205 (45%), Positives = 131/205 (63%), Gaps = 1/205 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           +  VTP +QNCT ++   +++A V+DPGG +DI+   I  R   + QIWITHGH+DH GG
Sbjct: 21  VTPVTPLQQNCTTVWCTATMKAAVIDPGGSVDIVMGEIARRGLTLDQIWITHGHLDHAGG 80

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           AA++ E     I+GPH  D   +  +  Q ++  +   AR     RWL +GDT+ LG   
Sbjct: 81  AAEMAEKSGAPIVGPHPADQFWIDGIPAQGQMYGLPE-ARTFVPTRWLDEGDTVELGETT 139

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
           + V HCPGH+PGHVI+ N +  FA +GD LF+ S+GRTD    D   L+ S+  K+ PLG
Sbjct: 140 WDVRHCPGHTPGHVIFYNAKARFAQVGDVLFKGSVGRTDFPQSDPDALVRSVVEKLWPLG 199

Query: 188 DEISFVCGHGPNSTIGRERRLNPFL 212
           D+++FV GHGP ST+G ERR NPF+
Sbjct: 200 DDVTFVPGHGPISTLGEERRTNPFV 224


>gi|157374801|ref|YP_001473401.1| beta-lactamase domain-containing protein [Shewanella sediminis
           HAW-EB3]
 gi|157317175|gb|ABV36273.1| beta-lactamase domain protein [Shewanella sediminis HAW-EB3]
          Length = 223

 Score =  179 bits (455), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 83/214 (38%), Positives = 133/214 (62%), Gaps = 1/214 (0%)

Query: 3   KLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHV 62
            + + I+ VTP++QNC+ ++  ++++A V+DPGGDL+ I   +      V+++ +THGH+
Sbjct: 9   SMKYQIIPVTPYQQNCSLIWCNKTMKAAVIDPGGDLERILAEVNKLGVTVEKVLLTHGHI 68

Query: 63  DHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLL 122
           DHVG A +L + L +T++GPH+DD  ++  + +Q+                +L+DG ++ 
Sbjct: 69  DHVGAAKRLADHLGITVLGPHRDDTFLLETLPDQSSDFGFPAC-EVLIPGEYLEDGASVT 127

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
           +G    +V HCPGH+PGHV++ +  +  A +GD LF  S+GRTD     +Q LI+SI  K
Sbjct: 128 VGEQTLQVIHCPGHTPGHVVFYSEADKRAWVGDVLFHGSVGRTDFPRSSHQDLIDSITKK 187

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           + PLG E+ FV GHGP ST G ER  NPF+   +
Sbjct: 188 LWPLGREVEFVPGHGPISTFGNERDQNPFVADQL 221


>gi|209695259|ref|YP_002263188.1| Metallo-beta-lactamase [Aliivibrio salmonicida LFI1238]
 gi|208009211|emb|CAQ79467.1| Metallo-beta-lactamase [Aliivibrio salmonicida LFI1238]
          Length = 217

 Score =  179 bits (455), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 93/216 (43%), Positives = 134/216 (62%), Gaps = 2/216 (0%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           MS L + I+ VT ++QNC+ ++ +E+++ VVVDPGGD+D++K  I + N  V  + +THG
Sbjct: 1   MS-LQYQIIPVTAYEQNCSIVWCDETMKGVVVDPGGDVDLLKQAIDALNIDVVSLVLTHG 59

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DHVGG   L       IIGPHK+D   +  +  Q++      +      ++WL++GD 
Sbjct: 60  HLDHVGGTEPLAALTGAPIIGPHKEDEFWLQGLPSQSQRFGF-PHTDAFEPNQWLEEGDI 118

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           +  G     V H PGH+PGHVI  N E   A +GD LF+ +IGR+D   GDY+ LI SI 
Sbjct: 119 VEFGNQALHVLHTPGHTPGHVILFNQEAKMAFVGDVLFKGAIGRSDFPKGDYETLIASIK 178

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            K+ PLG+E+ FV GHGP ST G ER+ NPF+   +
Sbjct: 179 TKLWPLGNEMKFVPGHGPESTFGYERKTNPFVADEL 214


>gi|238021583|ref|ZP_04602009.1| hypothetical protein GCWU000324_01483 [Kingella oralis ATCC 51147]
 gi|237866197|gb|EEP67239.1| hypothetical protein GCWU000324_01483 [Kingella oralis ATCC 51147]
          Length = 214

 Score =  179 bits (455), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 81/209 (38%), Positives = 123/209 (58%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L   I+ VT F+QNC+ L+D+E+ +AV+VD GGD + +   +  R+  +  IW+THGH+D
Sbjct: 3   LQIQIMPVTAFRQNCSLLWDDETRDAVLVDVGGDAEHLLAEVNKRSLKLNAIWLTHGHLD 62

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GG   L E  ++ +IGPH DD  ++  + E        +     +  RWL DGDTL +
Sbjct: 63  HAGGVPMLLERQNVPVIGPHPDDQFLLDALPETTASYGFPVCPV-FAPTRWLHDGDTLSV 121

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   F+V H PGH+PG V++          GD LF  SIGRTD   G++Q L+++I NK+
Sbjct: 122 GQFTFQVLHIPGHTPGQVVFYCAAAKLLLAGDVLFYESIGRTDFPRGNHQDLLDNIRNKL 181

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
             L ++   + GH   +TIG E++ NP++
Sbjct: 182 FRLPNDTLVIPGHARTTTIGHEKQFNPYV 210


>gi|145639179|ref|ZP_01794786.1| predicted Zn-dependent hydrolase-like protein, including glyoxylase
           [Haemophilus influenzae PittII]
 gi|145271741|gb|EDK11651.1| predicted Zn-dependent hydrolase-like protein, including glyoxylase
           [Haemophilus influenzae PittII]
          Length = 212

 Score =  179 bits (455), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 82/210 (39%), Positives = 128/210 (60%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           ++  I+ VT F+QNC+ ++D++   A ++DPGG+ + +   I+  N ++K I ITHGH+D
Sbjct: 1   MNIEIIPVTAFQQNCSLIWDDD-KNAAIIDPGGEAERLIQRIEELNLNLKVILITHGHLD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG A QLK+   + I G  ++D  +   + EQA+   +           + Q+G+ L L
Sbjct: 60  HVGAAMQLKQHFGVEIWGSQEEDKFLFESLPEQAQRFGLPNIEAFLPDRWFNQEGEILKL 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
               F++ H PGH+PGH+ ++  E   A  GD LF+  IGRTD   GDY+ LI+SI  K+
Sbjct: 120 DGFNFEILHLPGHTPGHIGFIEHEKKVAFTGDVLFQGGIGRTDFPRGDYETLISSIRTKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           LPL D++  + GHG  +TIG+E++ NPFL 
Sbjct: 180 LPLNDDLIIIAGHGSYTTIGQEKQTNPFLN 209


>gi|254719552|ref|ZP_05181363.1| metallo-beta-lactamase family protein [Brucella sp. 83/13]
 gi|265984560|ref|ZP_06097295.1| beta-lactamase domain-containing protein [Brucella sp. 83/13]
 gi|306837818|ref|ZP_07470681.1| metallo-beta-lactamase family protein [Brucella sp. NF 2653]
 gi|264663152|gb|EEZ33413.1| beta-lactamase domain-containing protein [Brucella sp. 83/13]
 gi|306407114|gb|EFM63330.1| metallo-beta-lactamase family protein [Brucella sp. NF 2653]
          Length = 218

 Score =  179 bits (454), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 108/214 (50%), Positives = 142/214 (66%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M +L   IV VTPF+QNCT LFD E+ +  V+DPGGDL  I++ I+S+   V+ IWITHG
Sbjct: 1   MGQLQAIIVPVTPFQQNCTILFDGETKKGGVIDPGGDLARIREAIESQGIDVEAIWITHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DH   A  LKE L + IIGPH+DD  ++  +        I    RN + D+WL++GD 
Sbjct: 61  HIDHAAAALDLKEALGVDIIGPHRDDKFLLDNLVAAGLKYGITEGVRNVTPDQWLEEGDK 120

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           + +  H+F VFHCPGH+PGHV++ N E  FA +GD LF  ++GRTD+  GD+  LI SI 
Sbjct: 121 VCVAGHVFDVFHCPGHAPGHVVFFNPEARFAIVGDVLFNGAVGRTDLPGGDHATLIRSIK 180

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
            K+LPLGD+I F+CGHGP    G ERR NPFL  
Sbjct: 181 EKLLPLGDDIGFICGHGPGGRFGEERRSNPFLTD 214


>gi|145637693|ref|ZP_01793346.1| predicted Zn-dependent hydrolase-like protein, including glyoxylase
           [Haemophilus influenzae PittHH]
 gi|145269095|gb|EDK09045.1| predicted Zn-dependent hydrolase-like protein, including glyoxylase
           [Haemophilus influenzae PittHH]
          Length = 210

 Score =  179 bits (454), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 81/210 (38%), Positives = 127/210 (60%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           ++  I+ VT F+QNC+ ++D++   A ++DPGG+ + +   I+  + ++K I ITHGH+D
Sbjct: 1   MNIEIIPVTAFQQNCSLIWDDD-KNAAIIDPGGEAERLIQRIEELHLNLKVILITHGHLD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG A QLK+   + I G  ++D  +   + EQA+   +           + Q+G+ L L
Sbjct: 60  HVGAAMQLKQHFGVEIWGSQEEDKFLFESLPEQAQRFGLPNIDAFLPDRWFNQEGEILKL 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
               F++ H PGH+PGH+ ++  E   A  GD LF+  IGRTD   GDY  LI+SI  K+
Sbjct: 120 DGFNFEILHLPGHTPGHIGFIEHEKKVAFTGDVLFQGGIGRTDFPRGDYDALISSIRTKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           L L D++  + GHGP +TIG+E++ NPFL 
Sbjct: 180 LSLNDDLIIIAGHGPYTTIGQEKQTNPFLN 209


>gi|145633340|ref|ZP_01789071.1| hypothetical protein CGSHi3655_03886 [Haemophilus influenzae 3655]
 gi|145634468|ref|ZP_01790178.1| hypothetical protein CGSHiAA_06744 [Haemophilus influenzae PittAA]
 gi|229846895|ref|ZP_04467002.1| carboxy-terminal protease [Haemophilus influenzae 7P49H1]
 gi|144986186|gb|EDJ92776.1| hypothetical protein CGSHi3655_03886 [Haemophilus influenzae 3655]
 gi|145268448|gb|EDK08442.1| hypothetical protein CGSHiAA_06744 [Haemophilus influenzae PittAA]
 gi|229810384|gb|EEP46103.1| carboxy-terminal protease [Haemophilus influenzae 7P49H1]
          Length = 212

 Score =  179 bits (454), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 83/210 (39%), Positives = 128/210 (60%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           ++  I+ VT F+QNC+ ++D+E   A ++DPGG+ + +   I+  + ++K I ITHGH+D
Sbjct: 1   MNIEIIPVTAFQQNCSLIWDDE-KNAAIIDPGGEAERLIQRIEELDLNLKVILITHGHLD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG A QLK+   + I G H++D  +   +  QA+   +           + Q+G+ L L
Sbjct: 60  HVGAAMQLKQHFGVEIWGSHEEDKFLFESLPVQAQRFGLPNIDAFLPDRWFNQEGEILKL 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
               F++ H PGH+PGH+ ++  E   A  GD LF+  IGRTD   GDY+ LI+SI  K+
Sbjct: 120 DGFNFEILHLPGHTPGHIGFIEHEKKVAFTGDVLFQGGIGRTDFPRGDYETLISSIRTKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           LPL D++  + GHG  +TIG+E+R NPFL 
Sbjct: 180 LPLNDDLIIIAGHGSYTTIGQEKRSNPFLN 209


>gi|260582631|ref|ZP_05850420.1| carboxy-terminal protease [Haemophilus influenzae NT127]
 gi|260094303|gb|EEW78202.1| carboxy-terminal protease [Haemophilus influenzae NT127]
          Length = 212

 Score =  179 bits (454), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 83/210 (39%), Positives = 128/210 (60%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           ++  I+ VT F+QNC+ ++D+E   A ++DPGG+ + +   I+  + ++K I ITHGH+D
Sbjct: 1   MNIEIIPVTAFQQNCSLIWDDE-KNAAIIDPGGEAERLIQRIEELDLNLKVILITHGHLD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG A QLK+   + I G  ++D  +   + EQA+   +           + Q+G+ L L
Sbjct: 60  HVGAAMQLKQHFGVEIWGSQEEDKFLFESLPEQAQRFGLPNIDAFLPDRWFNQEGEILKL 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
               F++ H PGH+PGH+ ++  E   A  GD LF+  IGRTD   GDY+ LI+SI  K+
Sbjct: 120 DGFNFEILHLPGHTPGHIGFIEHEKKVAFTGDVLFQGGIGRTDFPRGDYETLISSIRTKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           LPL D++  + GHG  +TIG+E+R NPFL 
Sbjct: 180 LPLNDDLIIIAGHGSYTTIGQEKRSNPFLN 209


>gi|260892288|ref|YP_003238385.1| Hydroxyacylglutathione hydrolase [Ammonifex degensii KC4]
 gi|260864429|gb|ACX51535.1| Hydroxyacylglutathione hydrolase [Ammonifex degensii KC4]
          Length = 211

 Score =  179 bits (454), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 68/209 (32%), Positives = 106/209 (50%), Gaps = 4/209 (1%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +   ++ V   + N   +    + EA+++DPG +   I             I +THGH D
Sbjct: 1   MRIIVLVVGELQTNTYLVGCPSTGEALIIDPGAEGGRILAAASRAGLRPTLICLTHGHAD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G  A+++  L+L +   H +DA M+        +  +         DR+L DG+ +  
Sbjct: 61  HIGAVAEIRRTLNLPV-LIHAEDAHMLTDPQANLSV-WLGRGFVVGEPDRYLHDGEEVTC 118

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   F+V H PGH+PG +        F   GDTLF  S+GRTD   GD+++L++S+  K+
Sbjct: 119 GKLKFQVLHVPGHTPGSICLYAPGVLF--SGDTLFAGSVGRTDFPGGDWKKLLHSVRTKL 176

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           L L DE     GHG ++TIG E+  NPFL
Sbjct: 177 LVLPDETVVYPGHGASTTIGEEKEQNPFL 205


>gi|254417839|ref|ZP_05031563.1| metallo-beta-lactamase superfamily, putative [Brevundimonas sp.
           BAL3]
 gi|196184016|gb|EDX78992.1| metallo-beta-lactamase superfamily, putative [Brevundimonas sp.
           BAL3]
          Length = 233

 Score =  179 bits (453), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 96/211 (45%), Positives = 136/211 (64%), Gaps = 1/211 (0%)

Query: 2   SKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGH 61
           S +   +  VTP +QNCT ++   + +A V+DPGG +D +   ++ R   + QIWITHGH
Sbjct: 6   SPIGVFVTPVTPLQQNCTTVWCTATNKAAVIDPGGAVDAVLGEVERRGLTIDQIWITHGH 65

Query: 62  VDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
           +DH GGAA+++E   + I GP K D   + ++ E  R+  +   AR  + DRWL+DGDT+
Sbjct: 66  LDHAGGAAEMQEKTGVQITGPQKADQFWIDRIVESGRMYGLPD-ARPFTPDRWLEDGDTV 124

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
            LG   ++V HCPGH+PGHVI+ N    FA +GD LF+ S+GRTD    D   LI ++  
Sbjct: 125 SLGETTWEVRHCPGHTPGHVIFFNRAARFAQVGDVLFKGSVGRTDFPMSDPPALIRAVVE 184

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           K+ PLGD+++FV GHGP ST G ERR NPF+
Sbjct: 185 KLWPLGDDVTFVPGHGPISTFGEERRTNPFV 215


>gi|332529944|ref|ZP_08405895.1| beta-lactamase domain-containing protein [Hylemonella gracilis ATCC
           19624]
 gi|332040641|gb|EGI77016.1| beta-lactamase domain-containing protein [Hylemonella gracilis ATCC
           19624]
          Length = 212

 Score =  179 bits (453), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 97/209 (46%), Positives = 127/209 (60%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L +  V VT F+QNCT ++ +E+++A V+DPGGDL  I          +K IWITH H+D
Sbjct: 2   LQYLTVPVTAFQQNCTIVWCDETMDAAVIDPGGDLPRITAAASGAGVTLKAIWITHAHLD 61

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H G AA+L   LSL IIGPH DD   +  + EQ R              RWL DGDT+ +
Sbjct: 62  HAGAAAELARALSLPIIGPHPDDQFWIDGLAEQGRRF-GMPAGEPFVPTRWLHDGDTVQI 120

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGH+PGHV++ + E + A +GD LF  SIGRTD   G++  LI SI  ++
Sbjct: 121 GHCTLNVRHCPGHTPGHVVFHSPEAHRAFVGDVLFAGSIGRTDFPRGNHGDLIRSITERL 180

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
            PLGD+  F+ GHGP ST G+ER  NPF+
Sbjct: 181 WPLGDDTVFIPGHGPESTFGQERETNPFV 209


>gi|118579159|ref|YP_900409.1| beta-lactamase domain-containing protein [Pelobacter propionicus
           DSM 2379]
 gi|118501869|gb|ABK98351.1| beta-lactamase domain protein [Pelobacter propionicus DSM 2379]
          Length = 210

 Score =  179 bits (453), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 70/212 (33%), Positives = 99/212 (46%), Gaps = 2/212 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +    + V P + N   L  E S E VV+D GGD+D +   I      ++ +  THGH D
Sbjct: 1   MIIETIPVGPLQVNGYILGCERSREGVVIDAGGDVDRLLARITKLELSIRYLLDTHGHFD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVGG     +         H+ DA ++    +  R   +     +   D++L DG T+  
Sbjct: 61  HVGGNRAFLKATGAK-FLIHERDAFLLSMAADAGRSFGVLT-ENSPQPDQYLTDGMTISF 118

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    KV H PGHSPG   + +        GDTLF  S+GRTD+  G  + L  SI  ++
Sbjct: 119 GDQRLKVIHTPGHSPGGCCFYSMSTGVLFTGDTLFNGSVGRTDLPGGSMEVLTRSIRERL 178

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSN 215
             L +      GHGP+STI  E   NPFL+  
Sbjct: 179 AVLPESTKLYPGHGPSSTIAIELFSNPFLRRG 210


>gi|50086246|ref|YP_047756.1| hypothetical protein ACIAD3254 [Acinetobacter sp. ADP1]
 gi|49532222|emb|CAG69934.1| putative enzyme [Acinetobacter sp. ADP1]
          Length = 215

 Score =  179 bits (453), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 88/209 (42%), Positives = 128/209 (61%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L   IV VT F QNC+ L+D ES EAV++D GG+   +K  +++    VK +W+THGH+D
Sbjct: 3   LQVKIVPVTAFAQNCSILWDSESKEAVLIDAGGEAVKLKQEVEAMGLKVKALWLTHGHLD 62

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H G   +L +   + +IGPHKDD   +  + + ++     +  +    D WL+ G+ L L
Sbjct: 63  HAGAVGELAKLWQVPVIGPHKDDQFWLDMIQDVSKRYGFPI-PQPVQVDTWLEGGEILEL 121

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   F+V   PGH+PGHV++ + E +    GD LF+ SIGRTD   G++QQLI+SI  + 
Sbjct: 122 GQTKFEVRFAPGHTPGHVMFYSPEYHLLWTGDVLFKGSIGRTDFPRGNHQQLIDSIQREC 181

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
             L DE  F+ GHGP STIG E++ NPF+
Sbjct: 182 FSLPDETQFISGHGPMSTIGHEKKFNPFV 210


>gi|68250265|ref|YP_249377.1| Zn-dependent hydrolase [Haemophilus influenzae 86-028NP]
 gi|68058464|gb|AAX88717.1| predicted Zn-dependent hydrolase-like protein, including
           glyoxylases [Haemophilus influenzae 86-028NP]
          Length = 212

 Score =  179 bits (453), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 83/211 (39%), Positives = 129/211 (61%), Gaps = 1/211 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           ++  I+ VT F+QNC+ ++D++   A ++DPGG+ + +   I+  + ++K I ITHGH+D
Sbjct: 1   MNIEIIPVTAFQQNCSLIWDDD-KNAAIIDPGGEAERLIQRIEELDLNLKVILITHGHLD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG A QLK+   + I G ++ D  +   + EQA+   +           + Q+G+ L L
Sbjct: 60  HVGAAMQLKQHFGVEIWGSNEKDKFLFESLPEQAQRFGLPNIEAFLPDRWFNQEGEILKL 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
               F++ H PGH+PGH+ ++  E   A  GD LF+  IGRTD   GDY+ LI+SI  K+
Sbjct: 120 DGFNFEILHLPGHTPGHIGFIEHEKKVAFTGDVLFQGGIGRTDFPRGDYETLISSIRTKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           LPL D++  + GHG  +TIG+E+R NPFL S
Sbjct: 180 LPLNDDLIIIAGHGSYTTIGQEKRSNPFLNS 210


>gi|323492994|ref|ZP_08098131.1| hypothetical protein VIBR0546_16226 [Vibrio brasiliensis LMG 20546]
 gi|323312773|gb|EGA65900.1| hypothetical protein VIBR0546_16226 [Vibrio brasiliensis LMG 20546]
          Length = 218

 Score =  179 bits (453), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 92/217 (42%), Positives = 133/217 (61%), Gaps = 3/217 (1%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           MS L + +V VT F QNC+ ++ ++++E +VVDPGGD+  +  +I+     V  + +THG
Sbjct: 1   MS-LKYQVVPVTSFSQNCSIVWCDQTMEGIVVDPGGDVKQLAMLIKELGVKVVNLVLTHG 59

Query: 61  HVDHVGGAAQLKEDLS-LTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGD 119
           H+DHVGG   L  +L  + IIGPHKDD   +  ++ Q+++    +       ++WL DGD
Sbjct: 60  HLDHVGGTEPLSRELGDIEIIGPHKDDNFWLQGLEGQSQMFGFPL-TEAFEPNQWLNDGD 118

Query: 120 TLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSI 179
            +  G     V H PGH+PGHV+  + E   A +GD LF  S+GRTD   GD+  LINSI
Sbjct: 119 KITFGQQTMDVIHTPGHTPGHVVLFSQEAKLAFVGDVLFNGSVGRTDFPKGDFDTLINSI 178

Query: 180 NNKILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
             K+ PLG+++ FV GHGP ST GRER  NPF+   +
Sbjct: 179 KTKLWPLGNDVRFVPGHGPESTFGRERASNPFVADEM 215


>gi|327188372|gb|EGE55589.1| putative hydrolase protein [Rhizobium etli CNPAF512]
          Length = 227

 Score =  179 bits (453), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 114/207 (55%), Positives = 148/207 (71%), Gaps = 1/207 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           I+ VTPF+QNCT  FD E+ E VVVDPGGD+ +I   I+     +K+IW+THGH+DH GG
Sbjct: 6   IIPVTPFQQNCTVFFDPETQEGVVVDPGGDVPLILQAIEKSGLTIKEIWLTHGHLDHAGG 65

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           A +LKE L + I+GPH+DD  ++ +++ QA    I    RN   D WL+DGD +  G H 
Sbjct: 66  AKELKEALGVDIVGPHQDDLPLLQRIETQAANYGI-SGLRNVLPDSWLKDGDRVSFGAHE 124

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
           F+V+H PGH+PGHVIY N   NFAHLGD LF  SIGRTD+  G++QQL++SI +K+LPLG
Sbjct: 125 FEVYHAPGHAPGHVIYFNRAQNFAHLGDVLFNGSIGRTDLPGGNHQQLLDSIRDKVLPLG 184

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLKS 214
           DE+ F+CGHGP   IG ERR NPFL+ 
Sbjct: 185 DEVGFICGHGPGGRIGDERRSNPFLQE 211


>gi|85709157|ref|ZP_01040223.1| glyoxalase II family protein [Erythrobacter sp. NAP1]
 gi|85690691|gb|EAQ30694.1| glyoxalase II family protein [Erythrobacter sp. NAP1]
          Length = 221

 Score =  179 bits (453), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 93/211 (44%), Positives = 138/211 (65%), Gaps = 2/211 (0%)

Query: 2   SKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGH 61
             +   I+ VTP +QNC+ ++  ++ +A ++DPGGDLD +KD I      +++I ITHGH
Sbjct: 7   PPMKAAIIPVTPLQQNCSLIWCTKTNKAALIDPGGDLDKLKDGIAKAGVEMEKILITHGH 66

Query: 62  VDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
           +DH G A  L E+L L I GPHKDD   + ++D         M A++ + DRWL++ DT+
Sbjct: 67  LDHCGQAGMLAEELGLPIEGPHKDDLFWIEQLDSDGARY--GMTAQSFTPDRWLENNDTV 124

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
            +G     V HCPGH+PGHV++ +  + FA +GD LF+ SIGRTD   G++Q LI+SI  
Sbjct: 125 TVGELTLDVIHCPGHTPGHVVFFHAPSRFAIVGDVLFQGSIGRTDFPRGNHQDLIDSITQ 184

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           ++ PLG+++ F+ GHGP ST GRER+ N F+
Sbjct: 185 RLWPLGEDVMFIPGHGPTSTFGRERKTNAFV 215


>gi|163750204|ref|ZP_02157446.1| metallo-beta-lactamase family protein [Shewanella benthica KT99]
 gi|161330060|gb|EDQ01044.1| metallo-beta-lactamase family protein [Shewanella benthica KT99]
          Length = 214

 Score =  178 bits (452), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 85/213 (39%), Positives = 133/213 (62%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + I+ VTPF+QNC+ ++ +++  A VVDPGGD+D I   +      ++++ +THGH+D
Sbjct: 1   MKYQIIPVTPFQQNCSLIWCDKTKAAAVVDPGGDMDRILVEVDKLGVKLEKVLLTHGHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG A +L E + + IIGPHK D+  +  + EQ++           +  ++L+ GDT+ L
Sbjct: 61  HVGAAKKLSEHVGIPIIGPHKADSFWLENLAEQSKHFGFVHC-EPFAPTQYLESGDTVTL 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G+   +V HCPGH+PGH+++ +  +  A +GD LF  SIGRTD    ++Q LI+SI   +
Sbjct: 120 GSLTLEVLHCPGHTPGHIVFFSASSCTAWVGDVLFHGSIGRTDFPQSNHQDLIHSITKTL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            PLG  + F+ GHGP ST G ER  NPF+   +
Sbjct: 180 WPLGRNVEFIPGHGPISTFGTERDQNPFVADQL 212


>gi|251792221|ref|YP_003006942.1| carboxy- protease [Aggregatibacter aphrophilus NJ8700]
 gi|247533609|gb|ACS96855.1| carboxy- protease [Aggregatibacter aphrophilus NJ8700]
          Length = 212

 Score =  178 bits (452), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 81/212 (38%), Positives = 130/212 (61%), Gaps = 2/212 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           ++  I+ VT F+QNC+ ++DE +  A ++DPGG+ D +   I+    +++ I +THGH+D
Sbjct: 1   MNIEIIPVTAFQQNCSLIWDENNN-AAIIDPGGEADKLIKRIEELGLNLQVILLTHGHLD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQ-DGDTLL 122
           HVG A +LK+  ++ I+G +  D      + +Q+              DRWL  +G+ L 
Sbjct: 60  HVGAAEKLKQHFNVQILGSNSKDDYWFKSLPQQSEKFGTLFEVAAFEPDRWLDQEGEVLT 119

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
           +G   F+V H PGH+PGH+ ++  +   A  GD LF+S IGRTD   G Y+++I SI  K
Sbjct: 120 IGDFTFEVLHLPGHTPGHIGFIEHQKRIAFTGDVLFKSGIGRTDFPGGSYEEIIASIREK 179

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           + PLGD++  V GHGP +TIG E++ NP++K+
Sbjct: 180 LYPLGDDMIIVAGHGPYTTIGTEKQTNPYVKA 211


>gi|78045201|ref|YP_361034.1| metallo-beta-lactamase family protein [Carboxydothermus
           hydrogenoformans Z-2901]
 gi|77997316|gb|ABB16215.1| metallo-beta-lactamase family protein [Carboxydothermus
           hydrogenoformans Z-2901]
          Length = 207

 Score =  178 bits (451), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 67/211 (31%), Positives = 103/211 (48%), Gaps = 4/211 (1%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +    + V     NC   + E++ EAV +DPGGD D I   I      +K I +THGH D
Sbjct: 1   MQIKTLTVGVIAANCHIAWCEKTGEAVAIDPGGDGDKILRFIDQNGLKLKYIVLTHGHGD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+    +++      +   H  DA M+    +      +    + A +D+ + DGD ++ 
Sbjct: 61  HIAAVDEVRNKTGAKV-LIHPKDAPMLLDPSKNLSGF-LGGAVKLAPADQEVVDGDEIIF 118

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    KV H PGH+        +  +    GDTLF  S+GR D   G +++L+ SI  KI
Sbjct: 119 GGEKLKVLHTPGHT--LGSICLYSCDVLFSGDTLFFGSVGRVDFPGGSWEKLLKSIREKI 176

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
             L ++   + GHGP +T+G E+  NPFLK 
Sbjct: 177 FTLPEDTRVLPGHGPETTVGYEKEHNPFLKD 207


>gi|229521383|ref|ZP_04410802.1| hydroxyacylglutathione hydrolase [Vibrio cholerae TM 11079-80]
 gi|229341481|gb|EEO06484.1| hydroxyacylglutathione hydrolase [Vibrio cholerae TM 11079-80]
          Length = 218

 Score =  178 bits (451), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 92/217 (42%), Positives = 131/217 (60%), Gaps = 3/217 (1%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           MS L + +V VT F QNC+ ++ +E++E +VVDPGGD+  +  +I      V Q+ +THG
Sbjct: 1   MS-LQYQVVPVTAFAQNCSIVWCDETMEGIVVDPGGDVKQLAMLIAELGVKVTQLVLTHG 59

Query: 61  HVDHVGGAAQLKEDLSLT-IIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGD 119
           H+DHVGG   L + L  T ++GPHK D   +  ++ Q+++    +       D WL DGD
Sbjct: 60  HLDHVGGTQSLSQALGGTRVVGPHKADNFWLQGLEGQSKMFGFPL-TEAFEPDEWLDDGD 118

Query: 120 TLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSI 179
            +  G    +V H PGH+PGHV+  +     A +GD LF  SIGRTD   GD+  LI SI
Sbjct: 119 VIHFGQQTLQVIHTPGHTPGHVVLFSEAARLAFVGDVLFNGSIGRTDFPQGDFNTLIASI 178

Query: 180 NNKILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            NK+ PLG +++F+ GHGP ST GRER  NPF+   +
Sbjct: 179 KNKLWPLGSDVTFIPGHGPQSTFGRERASNPFVADEM 215


>gi|222109441|ref|YP_002551705.1| beta-lactamase domain-containing protein [Acidovorax ebreus TPSY]
 gi|221728885|gb|ACM31705.1| beta-lactamase domain protein [Acidovorax ebreus TPSY]
          Length = 212

 Score =  178 bits (451), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 94/209 (44%), Positives = 133/209 (63%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L +  + VT F+QN + ++ +E+++A V+DPGGDLD +   +Q     +K IW+TH H+D
Sbjct: 2   LHYRTLPVTAFQQNSSIVWCDETMDAAVIDPGGDLDALVAEVQRLGLQLKAIWLTHAHID 61

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GG  +L E LSL IIGPH  D   +  + +Q+ +      AR  +  RWL DGDT+ +
Sbjct: 62  HAGGTGELAERLSLPIIGPHTGDQYWIDALPQQSAMFGFPP-ARQFAPTRWLHDGDTVTI 120

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGH+PGHV++   +   A +GD LF  SIGRTD   G++QQLI SI  ++
Sbjct: 121 GHETLNVRHCPGHTPGHVVFHAPQIGRAFVGDVLFAGSIGRTDFPQGNHQQLIASITQRL 180

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
            P+GD+  F+ GHGP ST GRERR NP++
Sbjct: 181 WPMGDQTVFIPGHGPESTFGRERRSNPYV 209


>gi|153827568|ref|ZP_01980235.1| glyoxylase II family protein [Vibrio cholerae MZO-2]
 gi|149738467|gb|EDM52863.1| glyoxylase II family protein [Vibrio cholerae MZO-2]
          Length = 218

 Score =  178 bits (451), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 93/217 (42%), Positives = 131/217 (60%), Gaps = 3/217 (1%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           MS L + +V VT F QNC+ ++ +E++E +VVDPGGD+  +  +I      V Q+ +THG
Sbjct: 1   MS-LQYQVVPVTAFAQNCSIVWCDETMEGIVVDPGGDVKQLAMLIAELGVKVTQLVLTHG 59

Query: 61  HVDHVGGAAQLKEDLSLT-IIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGD 119
           H+DHVGG   L + L  T ++GPHK D   +  ++ Q+++    +       D WL DGD
Sbjct: 60  HLDHVGGTQSLSQALGGTRVVGPHKADNFWLQGLEGQSKMFGFPL-TEAFEPDEWLDDGD 118

Query: 120 TLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSI 179
            L  G    +V H PGH+PGHV+  +     A +GD LF  SIGRTD   GD+  LI SI
Sbjct: 119 VLHFGQQTLQVIHTPGHTPGHVVLFSEAARLAFVGDVLFNGSIGRTDFPQGDFNTLIASI 178

Query: 180 NNKILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            NK+ PLG +++F+ GHGP ST GRER  NPF+   +
Sbjct: 179 KNKLWPLGSDVTFIPGHGPQSTFGRERASNPFVADEM 215


>gi|262171696|ref|ZP_06039374.1| hydroxyacylglutathione hydrolase [Vibrio mimicus MB-451]
 gi|261892772|gb|EEY38758.1| hydroxyacylglutathione hydrolase [Vibrio mimicus MB-451]
          Length = 218

 Score =  178 bits (451), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 93/217 (42%), Positives = 133/217 (61%), Gaps = 3/217 (1%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           MS L + +V VT F QNC+ ++ +E++E VVVDPGGD+  +  +I      V Q+ +THG
Sbjct: 1   MS-LQYQVVPVTAFSQNCSIVWCDETMEGVVVDPGGDVKQLAMLIAELGVKVTQLVLTHG 59

Query: 61  HVDHVGGAAQLKEDLS-LTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGD 119
           H+DHVGG   L E L    I+GPHK D   +  ++ Q+++    +       D+WL DGD
Sbjct: 60  HLDHVGGTEPLAEALGGARIVGPHKADNFWLQGLEGQSKMFGFPL-TEAFEPDQWLNDGD 118

Query: 120 TLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSI 179
            +  G    +V H PGH+PGHV+  +  +  A +GD LF  SIGRTD   GD+  LI SI
Sbjct: 119 VVTFGKQTLQVLHTPGHTPGHVVLFSDSDRLAFVGDVLFNGSIGRTDFPQGDFNTLIASI 178

Query: 180 NNKILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            NK+ PLG++++F+ GHGP ST GRER  NP++   +
Sbjct: 179 KNKLWPLGNDVTFIPGHGPKSTFGRERANNPYVADEM 215


>gi|15641283|ref|NP_230915.1| glyoxylase II family protein [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|121591907|ref|ZP_01679055.1| glyoxylase II family protein [Vibrio cholerae 2740-80]
 gi|153212253|ref|ZP_01948041.1| glyoxylase II family protein [Vibrio cholerae 1587]
 gi|153801335|ref|ZP_01955921.1| glyoxylase II family protein [Vibrio cholerae MZO-3]
 gi|227081442|ref|YP_002809993.1| glyoxylase II family protein [Vibrio cholerae M66-2]
 gi|229505143|ref|ZP_04394653.1| hydroxyacylglutathione hydrolase [Vibrio cholerae BX 330286]
 gi|229511185|ref|ZP_04400664.1| hydroxyacylglutathione hydrolase [Vibrio cholerae B33]
 gi|229515645|ref|ZP_04405104.1| hydroxyacylglutathione hydrolase [Vibrio cholerae TMA 21]
 gi|229518304|ref|ZP_04407748.1| hydroxyacylglutathione hydrolase [Vibrio cholerae RC9]
 gi|229608163|ref|YP_002878811.1| hydroxyacylglutathione hydrolase [Vibrio cholerae MJ-1236]
 gi|254226412|ref|ZP_04919999.1| glyoxylase II family protein [Vibrio cholerae V51]
 gi|254291721|ref|ZP_04962508.1| glyoxylase II family protein [Vibrio cholerae AM-19226]
 gi|254848394|ref|ZP_05237744.1| glyoxylase II family protein [Vibrio cholerae MO10]
 gi|255745666|ref|ZP_05419614.1| hydroxyacylglutathione hydrolase [Vibrio cholera CIRS 101]
 gi|262159057|ref|ZP_06030169.1| hydroxyacylglutathione hydrolase [Vibrio cholerae INDRE 91/1]
 gi|297578862|ref|ZP_06940790.1| glyoxylase II family protein [Vibrio cholerae RC385]
 gi|298498638|ref|ZP_07008445.1| glyoxylase II family protein [Vibrio cholerae MAK 757]
 gi|9655755|gb|AAF94429.1| glyoxylase II family protein [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|121546234|gb|EAX56546.1| glyoxylase II family protein [Vibrio cholerae 2740-80]
 gi|124116631|gb|EAY35451.1| glyoxylase II family protein [Vibrio cholerae 1587]
 gi|124123160|gb|EAY41903.1| glyoxylase II family protein [Vibrio cholerae MZO-3]
 gi|125621034|gb|EAZ49381.1| glyoxylase II family protein [Vibrio cholerae V51]
 gi|150422405|gb|EDN14365.1| glyoxylase II family protein [Vibrio cholerae AM-19226]
 gi|227009330|gb|ACP05542.1| glyoxylase II family protein [Vibrio cholerae M66-2]
 gi|229345019|gb|EEO09993.1| hydroxyacylglutathione hydrolase [Vibrio cholerae RC9]
 gi|229347414|gb|EEO12374.1| hydroxyacylglutathione hydrolase [Vibrio cholerae TMA 21]
 gi|229351150|gb|EEO16091.1| hydroxyacylglutathione hydrolase [Vibrio cholerae B33]
 gi|229357366|gb|EEO22283.1| hydroxyacylglutathione hydrolase [Vibrio cholerae BX 330286]
 gi|229370818|gb|ACQ61241.1| hydroxyacylglutathione hydrolase [Vibrio cholerae MJ-1236]
 gi|254844099|gb|EET22513.1| glyoxylase II family protein [Vibrio cholerae MO10]
 gi|255736741|gb|EET92138.1| hydroxyacylglutathione hydrolase [Vibrio cholera CIRS 101]
 gi|262029242|gb|EEY47894.1| hydroxyacylglutathione hydrolase [Vibrio cholerae INDRE 91/1]
 gi|297536456|gb|EFH75289.1| glyoxylase II family protein [Vibrio cholerae RC385]
 gi|297542971|gb|EFH79021.1| glyoxylase II family protein [Vibrio cholerae MAK 757]
          Length = 218

 Score =  177 bits (450), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 92/217 (42%), Positives = 131/217 (60%), Gaps = 3/217 (1%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           MS L + +V VT F QNC+ ++ +E++E +VVDPGGD+  +  +I      V Q+ +THG
Sbjct: 1   MS-LQYQVVPVTAFAQNCSIVWCDETMEGIVVDPGGDVKQLAMLIAELGVKVTQLVLTHG 59

Query: 61  HVDHVGGAAQLKEDLSLT-IIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGD 119
           H+DHVGG   L + L  T ++GPHK D   +  ++ Q+++    +       D WL DGD
Sbjct: 60  HLDHVGGTQSLAQALGGTRVVGPHKADNFWLQGLEGQSKMFGFPL-TEAFEPDEWLDDGD 118

Query: 120 TLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSI 179
            +  G    +V H PGH+PGHV+  +     A +GD LF  SIGRTD   GD+  LI SI
Sbjct: 119 VIHFGQQTLQVIHTPGHTPGHVVLFSEAARLAFVGDVLFNGSIGRTDFPQGDFNTLIASI 178

Query: 180 NNKILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            NK+ PLG +++F+ GHGP ST GRER  NPF+   +
Sbjct: 179 KNKLWPLGSDVTFIPGHGPQSTFGRERASNPFVADEM 215


>gi|121602782|ref|YP_989266.1| metallo-beta-lactamase family protein [Bartonella bacilliformis
           KC583]
 gi|120614959|gb|ABM45560.1| metallo-beta-lactamase family protein [Bartonella bacilliformis
           KC583]
          Length = 214

 Score =  177 bits (450), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 117/214 (54%), Positives = 150/214 (70%), Gaps = 1/214 (0%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M  LS HIV VT F+QNCT LFD ES   V+VDPGGD   I++ IQ     V+ IWITHG
Sbjct: 1   MGDLSLHIVPVTSFQQNCTLLFDNESKRGVLVDPGGDWFRIEEAIQETGVIVEAIWITHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           HVDHVG A Q KE L++ I+G H DD  +M  V E+A+      + R    D+WL+DGD+
Sbjct: 61  HVDHVGAAMQAKETLNVKIMGSHLDDKPVMDDVVERAKSYR-MADVRLCVPDQWLKDGDS 119

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           +    H+F VFH PGH+PGHVIY N +  FA LGD LFR S+GRTD++ G ++QL++SI 
Sbjct: 120 IDCAGHVFHVFHTPGHAPGHVIYFNEKERFALLGDVLFRGSVGRTDLMLGSHEQLMHSIR 179

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
            K+LPLG++++F+CGHGP STIG ER+ NPFLK 
Sbjct: 180 EKVLPLGNDVNFICGHGPGSTIGYERQHNPFLKG 213


>gi|145629247|ref|ZP_01785046.1| hypothetical protein CGSHi22121_10605 [Haemophilus influenzae
           22.1-21]
 gi|319776089|ref|YP_004138577.1| Zn-dependent hydrolase-like protein, including glyoxylases
           [Haemophilus influenzae F3047]
 gi|329123253|ref|ZP_08251821.1| metallo-beta-lactamase [Haemophilus aegyptius ATCC 11116]
 gi|144978750|gb|EDJ88473.1| hypothetical protein CGSHi22121_10605 [Haemophilus influenzae
           22.1-21]
 gi|309750759|gb|ADO80743.1| Conserved hypothetical protein [Haemophilus influenzae R2866]
 gi|317450680|emb|CBY86900.1| predicted Zn-dependent hydrolase-like protein, including
           glyoxylases [Haemophilus influenzae F3047]
 gi|327471462|gb|EGF16910.1| metallo-beta-lactamase [Haemophilus aegyptius ATCC 11116]
          Length = 212

 Score =  177 bits (450), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 83/210 (39%), Positives = 128/210 (60%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           ++  I+ VT F+QNC+ ++D+E   A ++DPGG+ + +   I+  + ++K I ITHGH+D
Sbjct: 1   MNIEIIPVTAFQQNCSLIWDDE-KNAAIIDPGGEAERLIQRIEELDLNLKVILITHGHLD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG A QLK+   + I G ++ D  +   + EQA+   +           + Q+G+ L L
Sbjct: 60  HVGAAMQLKQHFGVEIWGSNEKDKFLFESLPEQAQRFGLPNIDAFLPDRWFNQEGEILKL 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
               F++ H PGH+PGH+ ++  E   A  GD LF+  IGRTD   GDY+ LI+SI  K+
Sbjct: 120 DGFNFEILHLPGHTPGHIGFIEHEKKVAFTGDVLFQGGIGRTDFPRGDYETLISSIRTKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           LPL D++  + GHG  +TIG+E+R NPFL 
Sbjct: 180 LPLNDDLIIIAGHGSYTTIGQEKRSNPFLN 209


>gi|153829600|ref|ZP_01982267.1| glyoxylase II family protein [Vibrio cholerae 623-39]
 gi|148874934|gb|EDL73069.1| glyoxylase II family protein [Vibrio cholerae 623-39]
          Length = 218

 Score =  177 bits (450), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 91/217 (41%), Positives = 131/217 (60%), Gaps = 3/217 (1%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           MS L + +V VT F QNC+ ++ ++++E +VVDPGGD+  +  +I      V Q+ +THG
Sbjct: 1   MS-LQYQVVPVTAFAQNCSIVWCDDTMEGIVVDPGGDVKQLAMLIAELGVKVTQLVLTHG 59

Query: 61  HVDHVGGAAQLKEDLSLT-IIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGD 119
           H+DHVGG   L + L  T ++GPHK D   +  ++ Q+++    +       D WL DGD
Sbjct: 60  HLDHVGGTQSLAQALGGTRVVGPHKADNFWLQGLEGQSKMFGFPL-TEAFEPDEWLDDGD 118

Query: 120 TLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSI 179
            +  G    +V H PGH+PGHV+  +     A +GD LF  SIGRTD   GD+  LI SI
Sbjct: 119 VIHFGQQTLQVIHTPGHTPGHVVLFSEAARLAFVGDVLFNGSIGRTDFPQGDFNTLIASI 178

Query: 180 NNKILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            NK+ PLG +++F+ GHGP ST GRER  NPF+   +
Sbjct: 179 KNKLWPLGSDVTFIPGHGPQSTFGRERASNPFVADEM 215


>gi|253701157|ref|YP_003022346.1| beta-lactamase [Geobacter sp. M21]
 gi|251776007|gb|ACT18588.1| beta-lactamase domain protein [Geobacter sp. M21]
          Length = 209

 Score =  177 bits (450), Expect = 7e-43,   Method: Composition-based stats.
 Identities = 78/211 (36%), Positives = 114/211 (54%), Gaps = 2/211 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + F  + V     NC  L D++S E VVVDPG D ++I D +      +K I  THGH D
Sbjct: 1   MLFETIVVGALGVNCFILGDKQSNEGVVVDPGADCELILDAVTRFGIKLKYIINTHGHFD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG    LKE     +   H+ D  ++    + A+   ++    + +  R+L+DG  L  
Sbjct: 61  HVGCNRSLKEKSGAEL-LIHQGDRTLLELAAKSAQKYGLKA-EDSPAPTRFLEDGMRLEF 118

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G  + +V H PGH+ G    +         GDTLF  S+GRTD+  G ++QL+ SI  K+
Sbjct: 119 GKRVIEVLHTPGHTQGGCCLLLAHEKLVITGDTLFADSVGRTDLPGGSHEQLMASIKAKL 178

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           +PL D+ +   GHGP+STIGRERR NP++  
Sbjct: 179 MPLPDDTTVWPGHGPSSTIGRERRSNPYINE 209


>gi|304321211|ref|YP_003854854.1| glyoxalase II family protein [Parvularcula bermudensis HTCC2503]
 gi|303300113|gb|ADM09712.1| glyoxalase II family protein [Parvularcula bermudensis HTCC2503]
          Length = 232

 Score =  177 bits (450), Expect = 7e-43,   Method: Composition-based stats.
 Identities = 87/217 (40%), Positives = 125/217 (57%), Gaps = 3/217 (1%)

Query: 2   SKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGH 61
           +     IV VTPF+QNC+ +  ++     V+DPGG++D +   +++    V++IW+THGH
Sbjct: 5   APFDVKIVPVTPFQQNCSLVKAKD-GACAVIDPGGEIDRLLQEVEAWGGRVEKIWLTHGH 63

Query: 62  VDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARN--ASSDRWLQDGD 119
           +DH  GA ++K      I G H ++A  + ++  QA++L             DRWL DGD
Sbjct: 64  LDHAAGAMEMKTKTGAPIEGAHPEEAFWLDQMAAQAQMLGGGGGFGTDRVVPDRWLDDGD 123

Query: 120 TLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSI 179
            + L    F V   PGH+PGHV++ +     A +GD LF  SIGRTD   GD+  LI SI
Sbjct: 124 QVTLSNLAFDVLFTPGHTPGHVVFYHSGAKLAFVGDVLFHGSIGRTDFPRGDHATLIASI 183

Query: 180 NNKILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
             K+ PLG ++ FV GHGP ST G ERR NPF+   +
Sbjct: 184 TEKLWPLGPDVRFVPGHGPMSTFGEERRSNPFVADKV 220


>gi|240850156|ref|YP_002971549.1| metallo-beta-lactamase family protein [Bartonella grahamii as4aup]
 gi|240267279|gb|ACS50867.1| metallo-beta-lactamase family protein [Bartonella grahamii as4aup]
          Length = 216

 Score =  177 bits (450), Expect = 7e-43,   Method: Composition-based stats.
 Identities = 113/214 (52%), Positives = 145/214 (67%), Gaps = 1/214 (0%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M  L+ HI+ VT F+QNCT LFD E    V+VDPGGD   I+DVI+     V+ IWITHG
Sbjct: 1   MGSLNIHIIPVTTFQQNCTLLFDSECKTGVLVDPGGDWPRIQDVIEKNGVIVEAIWITHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H DHVG A Q KE L++ IIG H+DD  +M  V E A+   I  +A     D+WL+DG+ 
Sbjct: 61  HFDHVGAAMQAKEALNVKIIGSHRDDKPVMDAVSESAKNYDI-TDACICIPDQWLEDGEC 119

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           +    H+FKVFH PGHSPGHVIY N +   A LGD LFR SIGRTD     +++L++S+ 
Sbjct: 120 VHFAGHVFKVFHTPGHSPGHVIYFNEKERLALLGDVLFRGSIGRTDFPFCSHEKLMHSLR 179

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
            K+LPLGD++ F+CGHGP S+IG ER+ NPFL+ 
Sbjct: 180 EKVLPLGDDVCFICGHGPKSSIGYERQNNPFLQD 213


>gi|254427186|ref|ZP_05040893.1| metallo-beta-lactamase superfamily, putative [Alcanivorax sp.
           DG881]
 gi|196193355|gb|EDX88314.1| metallo-beta-lactamase superfamily, putative [Alcanivorax sp.
           DG881]
          Length = 213

 Score =  177 bits (450), Expect = 7e-43,   Method: Composition-based stats.
 Identities = 91/209 (43%), Positives = 135/209 (64%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + I+ VT F+QNC+FL  E + +  +VDPGGDL+ I   ++      ++I +TH H+D
Sbjct: 1   MKYAILPVTQFQQNCSFLKCEATDKVAIVDPGGDLNQILATLKQVGGTPEKILVTHAHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG  A+L E L L I GPH+DD   +  + +QA+++     +   + +RWL+ GDT+ +
Sbjct: 61  HVGAVAELAETLGLPIEGPHRDDQFWIDMLPQQAQMMGFAP-SPPFTPNRWLEGGDTVTV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G+   +V HCPGH+PGHV++   E+  A +GD LF  SIGRTD   GD+  LI +I  ++
Sbjct: 120 GSTQLEVRHCPGHTPGHVVFYQRESKLAVVGDVLFNGSIGRTDFPKGDFDTLITAIKEQL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           L L D++SF+ GHGP STIG ER  NPF+
Sbjct: 180 LTLDDDVSFIPGHGPMSTIGHERTHNPFV 208


>gi|114799929|ref|YP_759378.1| metallo-beta-lactamase superfamily protein [Hyphomonas neptunium
           ATCC 15444]
 gi|114740103|gb|ABI78228.1| metallo-beta-lactamase superfamily [Hyphomonas neptunium ATCC
           15444]
          Length = 244

 Score =  177 bits (450), Expect = 7e-43,   Method: Composition-based stats.
 Identities = 96/215 (44%), Positives = 136/215 (63%), Gaps = 1/215 (0%)

Query: 2   SKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGH 61
            KL   I+ VTP +QN + ++  +++E V VDPGG++D +          +  +W+THGH
Sbjct: 8   PKLEIRIIPVTPLQQNTSMIWSTQTMEGVFVDPGGEIDKLMQAADHFGVKIVAVWLTHGH 67

Query: 62  VDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
           +DHVG A  +K+     IIGPHKDD  ++ +V+       IR   +N + DR+L DGD L
Sbjct: 68  LDHVGAAMAVKDRTGCPIIGPHKDDQWLLDEVEASGARYGIRD-GKNVTPDRYLDDGDVL 126

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
            L  + F V HCPGH+PGHV+  + E   A +GD LFR S+GRTD   G++QQLI+SI  
Sbjct: 127 ELAGNKFGVAHCPGHTPGHVVIYHPEGALAFVGDVLFRGSVGRTDFPRGNHQQLIDSITQ 186

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           K+ PLGD++ FV GHGP ST G+ER+ NPF+   +
Sbjct: 187 KLWPLGDDMRFVPGHGPLSTFGQERQDNPFVADAV 221


>gi|153823870|ref|ZP_01976537.1| glyoxylase II family protein [Vibrio cholerae B33]
 gi|126518612|gb|EAZ75835.1| glyoxylase II family protein [Vibrio cholerae B33]
          Length = 212

 Score =  177 bits (450), Expect = 7e-43,   Method: Composition-based stats.
 Identities = 92/213 (43%), Positives = 130/213 (61%), Gaps = 3/213 (1%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           MS L + +V VT F QNC+ ++ +E++E +VVDPGGD+  +  +I      V Q+ +THG
Sbjct: 1   MS-LQYQVVPVTAFAQNCSIVWCDETMEGIVVDPGGDVKQLAMLIAELGVKVTQLVLTHG 59

Query: 61  HVDHVGGAAQLKEDLSLT-IIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGD 119
           H+DHVGG   L + L  T ++GPHK D   +  ++ Q+++    +       D WL DGD
Sbjct: 60  HLDHVGGTQSLAQALGGTRVVGPHKADNFWLQGLEGQSKMFGFPL-TEAFEPDEWLDDGD 118

Query: 120 TLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSI 179
            +  G    +V H PGH+PGHV+  +     A +GD LF  SIGRTD   GD+  LI SI
Sbjct: 119 VIHFGQQTLQVIHTPGHTPGHVVLFSEAARLAFVGDVLFNGSIGRTDFPQGDFNTLIASI 178

Query: 180 NNKILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
            NK+ PLG +++F+ GHGP ST GRER  NPF+
Sbjct: 179 KNKLWPLGSDVTFIPGHGPQSTFGRERASNPFV 211


>gi|37680297|ref|NP_934906.1| glyoxylase II family protein [Vibrio vulnificus YJ016]
 gi|37199044|dbj|BAC94877.1| glyoxylase II family protein [Vibrio vulnificus YJ016]
          Length = 238

 Score =  177 bits (450), Expect = 7e-43,   Method: Composition-based stats.
 Identities = 89/214 (41%), Positives = 134/214 (62%), Gaps = 2/214 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L + IV VTPF QNC+ ++ +++++ +V+DPGGD   +  +I+     V  + +THGH+D
Sbjct: 23  LKYQIVPVTPFAQNCSIVWCDDTMKGIVIDPGGDEKQLAVIIKELGVEVVNLVLTHGHLD 82

Query: 64  HVGGAAQLKEDL-SLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLL 122
           HVGG  +L E L  + I+GPHK D   +  ++ Q+++    +       ++WL DGD + 
Sbjct: 83  HVGGTERLAEMLDGIEIVGPHKADNFWLQGLEGQSQMFGFPL-TEAFEPNQWLNDGDEVR 141

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
            G  + +V H PGH+PGHV+  + E   A +GD LF  SIGRTD   GD+  LI SI NK
Sbjct: 142 FGNQVLQVLHTPGHTPGHVVLYSEEARRAFVGDVLFNGSIGRTDFPQGDFNTLIASIKNK 201

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           + PLG++++F+ GHGP ST G ERR NPF+   +
Sbjct: 202 LWPLGNDVTFIPGHGPESTFGHERRTNPFVADEM 235


>gi|160895783|ref|YP_001561365.1| beta-lactamase domain-containing protein [Delftia acidovorans
           SPH-1]
 gi|160361367|gb|ABX32980.1| beta-lactamase domain protein [Delftia acidovorans SPH-1]
          Length = 212

 Score =  177 bits (450), Expect = 8e-43,   Method: Composition-based stats.
 Identities = 89/209 (42%), Positives = 134/209 (64%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L +H + VT F+QNC+ ++ ++++EA V+DPGGDL+ I   I+     +K IW+TH H+D
Sbjct: 2   LQYHTIPVTAFQQNCSLVWCDQTMEAAVIDPGGDLEQIGWEIERLGLALKAIWLTHAHID 61

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GG  +L +   L IIGPH  D   +  + +Q  +      +   +  RWL DGDT+ +
Sbjct: 62  HAGGTRELADAQQLPIIGPHPGDQFWIDALPQQGAMFGFPH-SDPFTPTRWLHDGDTVSI 120

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGHV++   + + A +GD LF  SIGRTD   G++QQLI+SI  ++
Sbjct: 121 GQETLQVRHCPGHTPGHVVFHAPQIDRAFVGDVLFAGSIGRTDFPQGNHQQLIDSIVQRL 180

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
            P+GD+  F+ GHGP S+ GRER+ NP++
Sbjct: 181 WPMGDQTVFIPGHGPESSFGRERKSNPYV 209


>gi|309972942|gb|ADO96143.1| Conserved hypothetical protein [Haemophilus influenzae R2846]
          Length = 212

 Score =  177 bits (449), Expect = 8e-43,   Method: Composition-based stats.
 Identities = 84/210 (40%), Positives = 128/210 (60%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           ++  I+ VT F+QNC+ ++D+E   A ++DPGG+ + +   I+  + ++K I ITHGH+D
Sbjct: 1   MNIEIIPVTAFQQNCSLIWDDE-KNAAIIDPGGEAERLIQRIEELDLNLKVILITHGHLD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG A QLK+   + I G ++ D  +   + EQA+   +           + Q+G+ L L
Sbjct: 60  HVGAAMQLKQHFGVEIWGSNEKDKFLFESLPEQAQRFGLPNIDAFLPDRWFNQEGEILKL 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
               F++ H PGH+PGH+ ++  E   A  GD LF+  IGRTD   GDY+ LI+SI  K+
Sbjct: 120 DGFNFEILHLPGHTPGHIGFIEHEKKVAFTGDVLFQGGIGRTDFPRGDYETLISSIRTKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           LPL D+I  + GHG  +TIG+E+R NPFL 
Sbjct: 180 LPLNDDIIIIAGHGSYTTIGQEKRSNPFLN 209


>gi|254507064|ref|ZP_05119202.1| glyoxylase II family protein [Vibrio parahaemolyticus 16]
 gi|219550059|gb|EED27046.1| glyoxylase II family protein [Vibrio parahaemolyticus 16]
          Length = 218

 Score =  177 bits (449), Expect = 8e-43,   Method: Composition-based stats.
 Identities = 93/217 (42%), Positives = 136/217 (62%), Gaps = 3/217 (1%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           MS L + +V VT F QNC+ ++ +E++E VVVDPGGD+  +  +I+     V ++ +THG
Sbjct: 1   MS-LKYQVVPVTSFSQNCSIVWCDETMEGVVVDPGGDVKQLAMLIKELGVKVVKLVLTHG 59

Query: 61  HVDHVGGAAQLKEDLS-LTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGD 119
           H+DHVGG   L  +L  + I+GPHKDD   +  ++ Q+++    +        +WL++GD
Sbjct: 60  HLDHVGGTEPLAAELGGIEIVGPHKDDNFWLQGLENQSQMFGFPL-TEAFEPHQWLEEGD 118

Query: 120 TLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSI 179
            ++ G  +  V H PGH+PGHV+  + E   A +GD LF  SIGRTD   GD+  LI+SI
Sbjct: 119 KVVFGNQVMDVIHTPGHTPGHVVLFSNEAKLAFVGDVLFNGSIGRTDFPKGDFNTLISSI 178

Query: 180 NNKILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
             K+ PLG+E+ FV GHGP ST GRER  NPF+   +
Sbjct: 179 KTKLWPLGNEVRFVPGHGPESTFGRERASNPFVADEM 215


>gi|229525869|ref|ZP_04415274.1| hydroxyacylglutathione hydrolase [Vibrio cholerae bv. albensis
           VL426]
 gi|229339450|gb|EEO04467.1| hydroxyacylglutathione hydrolase [Vibrio cholerae bv. albensis
           VL426]
          Length = 218

 Score =  177 bits (449), Expect = 8e-43,   Method: Composition-based stats.
 Identities = 91/217 (41%), Positives = 131/217 (60%), Gaps = 3/217 (1%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           MS L + +V VT F QNC+ ++ +E++E +VVDPGGD+  +  +I      V Q+ +THG
Sbjct: 1   MS-LQYQVVPVTAFAQNCSIVWCDETMEGIVVDPGGDVKQLAMLIAELGVKVTQLVLTHG 59

Query: 61  HVDHVGGAAQLKEDLSLT-IIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGD 119
           H+DHVGG   L + L  T ++GPHK D   +  ++ Q+++    +       D WL DGD
Sbjct: 60  HLDHVGGTQSLSQALGGTRVVGPHKADNFWLQGLEGQSKMFGFPL-TEAFEPDEWLDDGD 118

Query: 120 TLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSI 179
            +  G    +V H PGH+PGHV+  +     A +GD LF  SIGRTD   GD+  L+ SI
Sbjct: 119 VIHFGQQTLQVIHTPGHTPGHVVLFSEAARLAFVGDVLFNGSIGRTDFPQGDFNTLMASI 178

Query: 180 NNKILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            NK+ PLG +++F+ GHGP ST GRER  NPF+   +
Sbjct: 179 KNKLWPLGSDVTFIPGHGPQSTFGRERASNPFVADEM 215


>gi|148258837|ref|YP_001243422.1| metallo-hydrolase/oxidoreductase domain-containing protein
           [Bradyrhizobium sp. BTAi1]
 gi|146411010|gb|ABQ39516.1| putative enzyme with metallo-hydrolase/oxidoreductase domain
           [Bradyrhizobium sp. BTAi1]
          Length = 222

 Score =  177 bits (449), Expect = 9e-43,   Method: Composition-based stats.
 Identities = 100/205 (48%), Positives = 139/205 (67%), Gaps = 1/205 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           IV VTPF+QNCT L+ E + +A+V+DPGGD+  I+  I      V++IW+THGH+DHVGG
Sbjct: 15  IVPVTPFEQNCTILWCEATKKAIVIDPGGDVPNIQAAIAQAKVTVEKIWLTHGHIDHVGG 74

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           AA L++ L + I GPH  D  ++  V        I    R+ + DRWL++GDT+ +G  +
Sbjct: 75  AADLRDALKVPIEGPHIADKFLLDNVVASGARFGI-TGVRDVTPDRWLEEGDTVEIGELV 133

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
           F + HCPGHSPG V++ N    FAH+GD LF  S+GRTD+  G ++ LI SI +K+LPLG
Sbjct: 134 FDILHCPGHSPGSVVFFNKAMRFAHVGDVLFNGSVGRTDLPGGSHETLIRSIKDKLLPLG 193

Query: 188 DEISFVCGHGPNSTIGRERRLNPFL 212
           D++ F+CGHG  S+ G+ER  NPFL
Sbjct: 194 DDVGFICGHGAGSSFGQERMTNPFL 218


>gi|301170421|emb|CBW30027.1| predicted metal-binding enzyme [Haemophilus influenzae 10810]
          Length = 212

 Score =  177 bits (449), Expect = 9e-43,   Method: Composition-based stats.
 Identities = 82/210 (39%), Positives = 127/210 (60%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           ++  I+ VT F+QNC+ ++D++   A ++DPGG+ + +   I+  + ++K I ITHGH+D
Sbjct: 1   MNIEIIPVTAFQQNCSLIWDDD-KNAAIIDPGGEAERLIQRIEELDLNLKVILITHGHLD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG A QLK+   + I G ++ D  +   + EQ +   +           + Q+G+ L L
Sbjct: 60  HVGAAMQLKQHFGVEIWGSNEKDKFLFESLPEQTQRFGLPNIDAFLPDRWFNQEGEILKL 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
               F++ H PGH+PGH+ ++  E   A  GD LF+  IGRTD   GDY+ LI+SI  K+
Sbjct: 120 DGFNFEILHLPGHTPGHIGFIEHEKKVAFTGDVLFQGGIGRTDFPRGDYETLISSIRTKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           LPL D+I  + GHG  +TIG+E+R NPFL 
Sbjct: 180 LPLNDDIIIIAGHGSYTTIGQEKRSNPFLN 209


>gi|295690071|ref|YP_003593764.1| glyoxalase II family Zn-dependent hydrolase [Caulobacter segnis
           ATCC 21756]
 gi|295431974|gb|ADG11146.1| Zn-dependent hydrolase, glyoxalase II family [Caulobacter segnis
           ATCC 21756]
          Length = 236

 Score =  177 bits (449), Expect = 9e-43,   Method: Composition-based stats.
 Identities = 93/203 (45%), Positives = 138/203 (67%), Gaps = 1/203 (0%)

Query: 10  QVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAA 69
            VTP +QNCT ++  ++++A ++DPGG++D +   +  +   +++IWITHGH+DH GGAA
Sbjct: 11  PVTPLQQNCTIVWCTKTMKAAIIDPGGEVDRLLKALADKGLTLEKIWITHGHMDHAGGAA 70

Query: 70  QLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFK 129
           +LK    + I GPH+ D   + ++ +Q+  +     AR   +DRWL DGD + LG   F+
Sbjct: 71  ELKVRTGVPIEGPHEADQFWIDRI-QQSGEMYGMPEARIFVTDRWLHDGDKVTLGETEFE 129

Query: 130 VFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDE 189
           V HCPGH+PGHV++ + E  FA +GD LF+ SIGRTD   G++Q LI++I  K+ PLGD+
Sbjct: 130 VLHCPGHTPGHVVFFHRETKFAQVGDVLFQGSIGRTDFPMGNHQDLIDAITQKLWPLGDD 189

Query: 190 ISFVCGHGPNSTIGRERRLNPFL 212
           + FV GHGP S+ G ERR NPF+
Sbjct: 190 VRFVPGHGPMSSFGAERRGNPFV 212


>gi|145631486|ref|ZP_01787255.1| predicted Zn-dependent hydrolase-like protein, including glyoxylase
           [Haemophilus influenzae R3021]
 gi|144982916|gb|EDJ90429.1| predicted Zn-dependent hydrolase-like protein, including glyoxylase
           [Haemophilus influenzae R3021]
          Length = 212

 Score =  177 bits (449), Expect = 9e-43,   Method: Composition-based stats.
 Identities = 82/210 (39%), Positives = 128/210 (60%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           ++  I+ VT F+QNC+ ++D+E   A ++DPGG+ + +   I+  + ++K I ITHGH+D
Sbjct: 1   MNIEIIPVTAFQQNCSLIWDDE-KNATIIDPGGEAERLIQRIEELDLNLKVILITHGHLD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG A QLK+   + I G H++D  +   +  QA+   +           + Q+G+ L L
Sbjct: 60  HVGAAMQLKQHFGVEIWGSHEEDKFLFESLPVQAQRFGLPNIEAFLPDRWFNQEGEILKL 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
               F++ H PGH+PGH+ ++  E   A  GD LF+  IGRTD   GDY+ LI+SI  K+
Sbjct: 120 DGFNFEILHLPGHTPGHIGFIEHEKKVAFTGDVLFQGGIGRTDFPRGDYETLISSIRTKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           LPL D++  + GHG  +TIG+E++ NPFL 
Sbjct: 180 LPLNDDLIIIAGHGSYTTIGQEKQTNPFLN 209


>gi|221069500|ref|ZP_03545605.1| beta-lactamase domain protein [Comamonas testosteroni KF-1]
 gi|220714523|gb|EED69891.1| beta-lactamase domain protein [Comamonas testosteroni KF-1]
          Length = 232

 Score =  177 bits (449), Expect = 9e-43,   Method: Composition-based stats.
 Identities = 89/211 (42%), Positives = 137/211 (64%), Gaps = 1/211 (0%)

Query: 2   SKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGH 61
             L +H V VT F+QNC+ ++ +++++A V+DPGGD++ I+   +    ++K IWITH H
Sbjct: 20  PMLQYHTVPVTAFQQNCSLVWCDQTMDAAVIDPGGDIEQIEWEAERLGLNLKAIWITHAH 79

Query: 62  VDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
           +DH GG ++L    +L IIGPH+ D   +  + +Q  +     +       RWL DGDT+
Sbjct: 80  IDHAGGTSELAAKHALPIIGPHEGDQFWIDGLPQQGAMFGFPHSG-PFVPTRWLHDGDTV 138

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
            +G     V HCPGH+PGHV++ + + + A +GD LF  SIGRTD   G++QQLI+SI  
Sbjct: 139 TIGQETLNVRHCPGHTPGHVVFHSPQIDRAFVGDVLFAGSIGRTDFPQGNHQQLIDSIVQ 198

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           ++ P+GD+  F+ GHGP S+ GRER+LNP++
Sbjct: 199 RLWPMGDQTIFIPGHGPESSFGRERKLNPYV 229


>gi|262402378|ref|ZP_06078939.1| hydroxyacylglutathione hydrolase [Vibrio sp. RC586]
 gi|262351160|gb|EEZ00293.1| hydroxyacylglutathione hydrolase [Vibrio sp. RC586]
          Length = 218

 Score =  177 bits (448), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 93/217 (42%), Positives = 133/217 (61%), Gaps = 3/217 (1%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           MS L + +V VT F QNC+ ++ +E++E VVVDPGGD+  +  +I      V Q+ +THG
Sbjct: 1   MS-LQYQVVPVTAFSQNCSIVWCDETMEGVVVDPGGDVKQLAMLIAELGVKVTQLVLTHG 59

Query: 61  HVDHVGGAAQLKEDLSLT-IIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGD 119
           H+DHVGG   L E L  T I+GPHK D   +  ++ Q+++    +       D+WL DGD
Sbjct: 60  HLDHVGGTEPLAEALGGTRIVGPHKADNFWLQGLEGQSKMFGFPL-TEAFEPDQWLNDGD 118

Query: 120 TLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSI 179
            +  G    +V H PGH+PGH++  +     A +GD LF  SIGRTD   GD+  LI SI
Sbjct: 119 VVTFGKQTLQVLHTPGHTPGHIVLFSESARLAFVGDVLFNGSIGRTDFPQGDFNTLIASI 178

Query: 180 NNKILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            NK+ PLG++++F+ GHGP ST GRER  NP++   +
Sbjct: 179 KNKLWPLGNDVTFIPGHGPQSTFGRERANNPYVADEM 215


>gi|121729965|ref|ZP_01682384.1| glyoxylase II family protein [Vibrio cholerae V52]
 gi|147675111|ref|YP_001216835.1| glyoxylase II family protein [Vibrio cholerae O395]
 gi|262169416|ref|ZP_06037108.1| hydroxyacylglutathione hydrolase [Vibrio cholerae RC27]
 gi|121628286|gb|EAX60797.1| glyoxylase II family protein [Vibrio cholerae V52]
 gi|146316994|gb|ABQ21533.1| glyoxylase II family protein [Vibrio cholerae O395]
 gi|227013187|gb|ACP09397.1| glyoxylase II family protein [Vibrio cholerae O395]
 gi|262022229|gb|EEY40938.1| hydroxyacylglutathione hydrolase [Vibrio cholerae RC27]
          Length = 218

 Score =  177 bits (448), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 92/217 (42%), Positives = 131/217 (60%), Gaps = 3/217 (1%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           MS L + +V VT F QNC+ ++ +E++E +VVDPGGD+  +  +I      V Q+ +THG
Sbjct: 1   MS-LQYQVVPVTAFAQNCSIVWCDETMEGIVVDPGGDVKQLAILIAELGVKVTQLVLTHG 59

Query: 61  HVDHVGGAAQLKEDLSLT-IIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGD 119
           H+DHVGG   L + L  T ++GPHK D   +  ++ Q+++    +       D WL DGD
Sbjct: 60  HLDHVGGTQSLAQALGGTRVVGPHKADNFWLQGLEGQSKMFGFPL-TEAFEPDEWLDDGD 118

Query: 120 TLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSI 179
            +  G    +V H PGH+PGHV+  +     A +GD LF  SIGRTD   GD+  LI SI
Sbjct: 119 VIHFGQQTLQVIHTPGHTPGHVVLFSEAARLAFVGDVLFNGSIGRTDFPQGDFNTLIASI 178

Query: 180 NNKILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            NK+ PLG +++F+ GHGP ST GRER  NPF+   +
Sbjct: 179 KNKLWPLGSDVTFIPGHGPQSTFGRERASNPFVADEM 215


>gi|154253559|ref|YP_001414383.1| beta-lactamase domain-containing protein [Parvibaculum
           lavamentivorans DS-1]
 gi|154157509|gb|ABS64726.1| beta-lactamase domain protein [Parvibaculum lavamentivorans DS-1]
          Length = 216

 Score =  177 bits (448), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 90/211 (42%), Positives = 129/211 (61%), Gaps = 1/211 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L   I+ VTPF+QNCT ++++E++   V DPGGDL+ IK         +++I +THGH+D
Sbjct: 3   LKAAILPVTPFQQNCTLMWNDENMRGAVSDPGGDLERIKAAAAEAGVTIEKILLTHGHLD 62

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H   A  L  +L + + GPH+DD  ++  + +QA              DRWL+DGD +  
Sbjct: 63  HASAAGDLARELGVPVEGPHEDDLFLIEALPDQAAKYGFPPVG-AFRPDRWLKDGDQVTF 121

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
               F V HCPGH+PGHV++ +  +  A +GD LF+ SIGRTD   GD+  L+ SI  ++
Sbjct: 122 AGLTFDVRHCPGHTPGHVVFFHEPSRLAIVGDVLFQGSIGRTDFPRGDHGALVRSIRERL 181

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
            PLGD+++FV GHGP ST G ERR NPF+  
Sbjct: 182 WPLGDDVTFVPGHGPLSTFGVERRTNPFVAD 212


>gi|83590514|ref|YP_430523.1| Beta-lactamase-like [Moorella thermoacetica ATCC 39073]
 gi|83573428|gb|ABC19980.1| Beta-lactamase-like protein [Moorella thermoacetica ATCC 39073]
          Length = 207

 Score =  177 bits (448), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 71/209 (33%), Positives = 94/209 (44%), Gaps = 3/209 (1%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +    + V P   NC  +   E+ E  V+DPG + + I    +    ++KQI  THGH D
Sbjct: 1   MFLKTLVVGPLGANCYLIGCPETGEGAVIDPGAEGERILAAAREAGLNIKQIINTHGHGD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G    +K      I   H+ DA  +        +L     A   +     +D    + 
Sbjct: 61  HIGANGAIKAATGAAI-LIHRADAHYLTDPGRNLSVLLGSREASPPADRLLEEDDTIAIG 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
            T   +V H PGH+PG              GDTLF  SIGRTD   G Y QLI+SI  K+
Sbjct: 120 KTVTLRVIHTPGHTPGG--ICLHGEGLVFTGDTLFAGSIGRTDFPGGSYSQLISSIKEKL 177

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
             L D +    GHGP STIG ER  NPF 
Sbjct: 178 FTLDDALEVYPGHGPASTIGAERVDNPFF 206


>gi|322832250|ref|YP_004212277.1| hypothetical protein Rahaq_1528 [Rahnella sp. Y9602]
 gi|321167451|gb|ADW73150.1| hypothetical protein Rahaq_1528 [Rahnella sp. Y9602]
          Length = 215

 Score =  177 bits (448), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 84/213 (39%), Positives = 136/213 (63%), Gaps = 1/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +  H++ VT F QNC+ ++  ++ +A +VDPGG+   I   + ++   V QI +THGH+D
Sbjct: 1   MKTHLITVTAFSQNCSLIWCAKTNQAAIVDPGGEAARIIQEVSAKGVLVTQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AA+L     + +IGP K+D  ++  +  Q+++  +       + D WL++GD++ +
Sbjct: 61  HVGAAAELAAHYQVPVIGPQKEDEFLLDALPTQSQMFGLDHC-DPLTPDTWLEEGDSVSV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G  I  V HCPGH+PGH++++N +   A  GD +F+  +GR+D   GD+Q LI+SI  K+
Sbjct: 120 GEEILSVLHCPGHTPGHIVFINDKARIAVSGDVIFKGGVGRSDFPRGDHQALIHSIKTKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           LPLGD++ F+ GHGP S  G ER+ NPFL+  +
Sbjct: 180 LPLGDDMVFIPGHGPMSDFGYERKTNPFLQDEM 212


>gi|225376527|ref|ZP_03753748.1| hypothetical protein ROSEINA2194_02169 [Roseburia inulinivorans DSM
           16841]
 gi|225211626|gb|EEG93980.1| hypothetical protein ROSEINA2194_02169 [Roseburia inulinivorans DSM
           16841]
          Length = 233

 Score =  177 bits (448), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 71/212 (33%), Positives = 110/212 (51%), Gaps = 3/212 (1%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M+ LS  I  V P + NC F  ++++ E +++DPG     + + ++ +      I +THG
Sbjct: 25  MAPLSIQIYVVGPVQTNCYFAINDDTKEVLIIDPGASAKQLAEKVKEQGLKPVAILLTHG 84

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H DH  GA +L + L + I    K+   +    + Q  L   + +     +D +L+D   
Sbjct: 85  HFDHATGAGELAQLLHIKIYAQEKEKETLE---NPQLNLSGWQGSELVFYADEYLKDEQE 141

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           + L     +VF  PGH+ G   Y     N    GD+LF++SIGRTD   G   QLI++I 
Sbjct: 142 IDLAGFHIRVFLTPGHTVGGCCYYFPYQNTLFSGDSLFQTSIGRTDFPKGSASQLIHAIR 201

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
            K++PL DE +   GHG  +TIG ER  NP+L
Sbjct: 202 EKLMPLPDETAVYTGHGDMTTIGTERMYNPYL 233


>gi|258624452|ref|ZP_05719399.1| glyoxylase II family protein [Vibrio mimicus VM603]
 gi|258583299|gb|EEW08101.1| glyoxylase II family protein [Vibrio mimicus VM603]
          Length = 218

 Score =  177 bits (448), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 93/217 (42%), Positives = 132/217 (60%), Gaps = 3/217 (1%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           MS L + +V VT F QNC+ ++ +E++E VVVDPGGD+  +  +I      V Q+ +THG
Sbjct: 1   MS-LQYQVVPVTAFSQNCSIVWCDETMEGVVVDPGGDVKQLAMLIAELGVKVTQLVLTHG 59

Query: 61  HVDHVGGAAQLKEDLSLT-IIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGD 119
           H+DHVGG   L E L  T I+GPHK D   +  ++ Q+++    +        +WL DGD
Sbjct: 60  HLDHVGGTEPLAEALGGTRIVGPHKADNFWLQGLEGQSKMFGFPL-TEAFEPHQWLNDGD 118

Query: 120 TLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSI 179
            +  G    +V H PGH+PGHV+  +     A +GD LF  SIGRTD   GD+  LI SI
Sbjct: 119 VVTFGKQTLQVLHTPGHTPGHVVLFSDSARLAFVGDVLFNGSIGRTDFPQGDFNTLIASI 178

Query: 180 NNKILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            NK+ PLG++++F+ GHGP ST GRER  NP++   +
Sbjct: 179 KNKLWPLGNDVTFIPGHGPKSTFGRERANNPYVADEM 215


>gi|319405273|emb|CBI78887.1| putative hydrolase [Bartonella sp. AR 15-3]
          Length = 214

 Score =  176 bits (447), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 116/214 (54%), Positives = 146/214 (68%), Gaps = 1/214 (0%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           MS  S +I+ VTPF+QNCT LFD ES   V+VDPGGD   I+  IQ +   V+ IWITHG
Sbjct: 1   MSDFSVYIIPVTPFQQNCTLLFDNESKRGVLVDPGGDWPKIQQTIQEKGVIVEAIWITHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DHVG A Q KE L + IIG H++D  +M  V E+A++     +AR    D+WL+DGD+
Sbjct: 61  HIDHVGAAMQAKEALDIQIIGSHRNDKPVMDDVSERAKIYH-MPDARVCIPDQWLEDGDS 119

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           +    H F VFH PGHSPGHVIY N +  FA LGD LFR +IGRTD     +++LI SI 
Sbjct: 120 VDCAGHTFSVFHTPGHSPGHVIYFNEKRRFALLGDVLFRGAIGRTDFPLCSHEELIKSIK 179

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
            K+LPLGD +SF+CGHGP S IG ER+ NPFL+ 
Sbjct: 180 EKVLPLGDNVSFICGHGPGSQIGYERQYNPFLQG 213


>gi|315426584|dbj|BAJ48213.1| beta-lactamase domain protein [Candidatus Caldiarchaeum
           subterraneum]
          Length = 218

 Score =  176 bits (447), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 77/211 (36%), Positives = 109/211 (51%), Gaps = 5/211 (2%)

Query: 4   LSFHIV--QVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGH 61
           ++  IV  QV P   N   ++DEE+ EAV++D G D  ++ + +Q R   V  ++ THGH
Sbjct: 1   MTLKIVSHQVGPLSSNSYIVYDEETREAVIIDAGDDAWLLLETLQERRLRVNAVYATHGH 60

Query: 62  VDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
            DHV     LK+ L +     H+ D  ++    E  R           S D +L+DG T+
Sbjct: 61  FDHVMAVDDLKQALKIP-FYIHRLDLEILSMAREMTRRFLGIDVGDPPSPDGFLEDGQTI 119

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
            +G    KV H PGHSPG      + +     GD LF  S+GRTD   G  QQL  SI  
Sbjct: 120 QVGGKSLKVIHTPGHSPGS--VCFYGDGVLFSGDLLFMGSVGRTDAPGGSAQQLTQSILE 177

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           K+  L D++    GHGP +TIG E++ NPF+
Sbjct: 178 KVFKLPDDVKVYPGHGPETTIGWEKKHNPFV 208


>gi|53804971|ref|YP_113173.1| metallo-beta-lactamase family protein [Methylococcus capsulatus
           str. Bath]
 gi|53758732|gb|AAU93023.1| metallo-beta-lactamase family protein [Methylococcus capsulatus
           str. Bath]
          Length = 234

 Score =  176 bits (447), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 94/208 (45%), Positives = 126/208 (60%), Gaps = 1/208 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           I+ VT F+QNCT L  E +    VVDPGG+LD I        F + +I +TH H DH  G
Sbjct: 25  IIPVTAFQQNCTILGCETTGLGAVVDPGGELDRIMAAAGDAGFTLSKILLTHAHADHAAG 84

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           AA L   L + I GP +DDA  +  + +Q R+  +       + DRWL+ GDT+  G   
Sbjct: 85  AAGLAAQLGIPIEGPQRDDAFWIETLPQQCRMFGLPGTTV-FTPDRWLEHGDTVSFGAET 143

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
            +V HCPGH+PGHV++ +     A +GD LF+ SIGRTD   GDY  LI SI  ++ PLG
Sbjct: 144 LEVLHCPGHTPGHVVFFHRGQRLALVGDVLFKGSIGRTDFPRGDYDILIRSIRERLFPLG 203

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLKSN 215
           D+++F+ GHGP ST G ERR NPFL++ 
Sbjct: 204 DDVTFIPGHGPTSTFGDERRSNPFLRNG 231


>gi|86148445|ref|ZP_01066735.1| Glyoxylase II family protein [Vibrio sp. MED222]
 gi|85833742|gb|EAQ51910.1| Glyoxylase II family protein [Vibrio sp. MED222]
          Length = 217

 Score =  176 bits (447), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 88/216 (40%), Positives = 133/216 (61%), Gaps = 2/216 (0%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           MS L + +V VT F QNC+ ++ +E++E +VVDPGGD+  +  +I+     V  + +THG
Sbjct: 1   MS-LKYQVVPVTSFSQNCSIVWCDETMEGIVVDPGGDVQQLAAIIEELGVKVVNLVLTHG 59

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DHVGG   L E L++ I+GPHK D   +  ++ Q+++    +  +    + WL++GD 
Sbjct: 60  HLDHVGGTVPLAEILNVNIVGPHKADNFWLQGLENQSQMFGFPLC-KAFEPNTWLEEGDK 118

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           +  G  +  V H PGH+PGHV+  + +   A +GD LF  +IGRTD   GD+  LI SI 
Sbjct: 119 VTFGNQVIDVIHTPGHTPGHVVLFSEQARMAFVGDVLFNGAIGRTDFPQGDFNTLIASIK 178

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            K+ PLG +++FV GHG  ST GRER  NPF+   +
Sbjct: 179 TKLWPLGSDVTFVPGHGLESTFGRERASNPFVADEM 214


>gi|147677382|ref|YP_001211597.1| Zn-dependent hydrolases [Pelotomaculum thermopropionicum SI]
 gi|146273479|dbj|BAF59228.1| Zn-dependent hydrolases [Pelotomaculum thermopropionicum SI]
          Length = 207

 Score =  176 bits (447), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 72/209 (34%), Positives = 106/209 (50%), Gaps = 3/209 (1%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + F    V   + NC  +  EE+ E  VVDPG + + I   ++     +K I +THGH+D
Sbjct: 1   MIFVGFPVGMMESNCYIIGCEETREGAVVDPGAEAEKILKKVEELGLKIKYIILTHGHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G  A +++     +   H +DA M+    +   +  +  N     +DR LQ+GD + +
Sbjct: 61  HIGALAGVQQATGAQV-LIHAEDAPMLTDARKNLSMY-VGPNLSLKQADRLLQEGDIISV 118

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V H PGH+    I +    +    GDTLF  S+GR+D   G + QLI SI NK+
Sbjct: 119 GKIAIEVIHTPGHT-RGSISLKCAPDIILTGDTLFAGSVGRSDFPGGSHSQLIASIKNKL 177

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           L          GHGP STIG E+  NPFL
Sbjct: 178 LKFPPGTGVYPGHGPKSTIGEEKLYNPFL 206


>gi|329890029|ref|ZP_08268372.1| metallo-beta-lactamase superfamily protein [Brevundimonas diminuta
           ATCC 11568]
 gi|328845330|gb|EGF94894.1| metallo-beta-lactamase superfamily protein [Brevundimonas diminuta
           ATCC 11568]
          Length = 233

 Score =  176 bits (447), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 96/205 (46%), Positives = 135/205 (65%), Gaps = 1/205 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           +  VTP +QNCT ++  ++ +A V+DPGG +D I   +  R   +  IWITHGH+DH G 
Sbjct: 12  VTPVTPLQQNCTTVWCTQTKKAAVIDPGGSVDAILGEVARRGLTLDAIWITHGHLDHAGA 71

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           AA+++E   L I+GPH +D   +  +  Q +   +   AR+ +  RWL DGD L LG   
Sbjct: 72  AAEMQEKTGLDIVGPHPEDQFWIDLIPTQGQKYGLPE-ARSFTPTRWLDDGDVLTLGETT 130

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
           ++VFHCPGH+PGHVI+ N E  FA +GD LF+ S+GRTD    D+Q L+ +I  K+ PLG
Sbjct: 131 WEVFHCPGHTPGHVIFFNREARFAQVGDVLFQGSVGRTDFPRSDHQALLTAITTKLWPLG 190

Query: 188 DEISFVCGHGPNSTIGRERRLNPFL 212
           D+++FV GHGP+ST G ERR NPF+
Sbjct: 191 DDVTFVPGHGPHSTFGAERRTNPFV 215


>gi|145588220|ref|YP_001154817.1| beta-lactamase domain-containing protein [Polynucleobacter
           necessarius subsp. asymbioticus QLW-P1DMWA-1]
 gi|145046626|gb|ABP33253.1| beta-lactamase domain protein [Polynucleobacter necessarius subsp.
           asymbioticus QLW-P1DMWA-1]
          Length = 214

 Score =  176 bits (447), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 86/213 (40%), Positives = 133/213 (62%), Gaps = 1/213 (0%)

Query: 3   KLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHV 62
            +   IV VTP++QNC+ L  +E+ +A V+DPGGD++ I D ++     VK+I +THGH+
Sbjct: 2   PIKLGIVPVTPYEQNCSILVCQETGDAAVIDPGGDIEKILDGVKQMGGQVKKILLTHGHL 61

Query: 63  DHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLL 122
           DH   A  L + L++ I GP +++   + ++ EQ         A+    +RWL DGD + 
Sbjct: 62  DHCAAAKDLADQLAVPIEGPQEEERFWIDQLPEQTVRFGFGH-AKVFEPNRWLNDGDHVK 120

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
           +G    +VFHCPGH+PGH+++ +  +  A +GD LF  SIGRTD   G++  LI++I  K
Sbjct: 121 VGNVDLEVFHCPGHTPGHIVFFDRADRLAIVGDVLFAGSIGRTDFPRGNHADLIHAIRTK 180

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFLKSN 215
           + PLGD++ FV GHGP S  G+ER+ NP++   
Sbjct: 181 LWPLGDDVQFVPGHGPMSNFGQERKTNPYVGDG 213


>gi|103486908|ref|YP_616469.1| beta-lactamase-like protein [Sphingopyxis alaskensis RB2256]
 gi|98976985|gb|ABF53136.1| beta-lactamase-like protein [Sphingopyxis alaskensis RB2256]
          Length = 221

 Score =  176 bits (447), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 90/211 (42%), Positives = 129/211 (61%), Gaps = 2/211 (0%)

Query: 2   SKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGH 61
             +   IV VT F+QNCT L+  E+ +A  VDPGGDL  +K+ ++     V++I +THGH
Sbjct: 6   PPMRAAIVPVTAFQQNCTLLWCTETNKAAFVDPGGDLPKLKEAVRQTGVEVEKILVTHGH 65

Query: 62  VDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
           +DH G A  L  +L + I GPH+DD   + +  E        M       DRWL DGDT+
Sbjct: 66  MDHCGQAGMLARELGVPIEGPHEDDRFWIERFAEDGARF--GMVGEPFEPDRWLVDGDTV 123

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
            +G  +  V HCPGH+PGHV++ +  +  A +GD +F+ SIGRTD   G++QQL++SI  
Sbjct: 124 TVGNLVIDVIHCPGHTPGHVVFHHAPSKLAIVGDVIFQGSIGRTDFPRGNHQQLLDSITQ 183

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           K+ PLG + +F+ GHG +S    ERR NPF+
Sbjct: 184 KLWPLGGDTTFLPGHGAHSNFAHERRTNPFV 214


>gi|118578537|ref|YP_899787.1| beta-lactamase domain-containing protein [Pelobacter propionicus
           DSM 2379]
 gi|118501247|gb|ABK97729.1| beta-lactamase domain protein [Pelobacter propionicus DSM 2379]
          Length = 207

 Score =  176 bits (447), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 74/209 (35%), Positives = 107/209 (51%), Gaps = 2/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + F  ++V P   NC  L  EE+ + VV+D GGD   I  V++ +   +  I  THGH D
Sbjct: 1   MIFESLEVGPLGVNCFILGCEETGQGVVIDAGGDARDIIAVVERQGLTIAHIINTHGHFD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G    LKE  S  ++  H  D  ++ +  + A+   I     +   D  L+DG  +  
Sbjct: 61  HIGANRALKERFSANLM-IHAADIPLLDRAADIAKAYGIPG-ENSPQPDTCLEDGMEISF 118

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V H PGHSPG   +          GDTLF  SIGRTD+  G ++QL++S+  K+
Sbjct: 119 GKLAMTVLHTPGHSPGGCCFYLEAEQKIITGDTLFADSIGRTDLPGGSHEQLLDSVRAKL 178

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
             L D +    GHGP +TIG E+R NP+ 
Sbjct: 179 FTLPDHVVAYPGHGPETTIGHEKRHNPYF 207


>gi|59711801|ref|YP_204577.1| metal-binding protein [Vibrio fischeri ES114]
 gi|197335598|ref|YP_002155993.1| metallo-beta-lactamase superfamily protein [Vibrio fischeri MJ11]
 gi|59479902|gb|AAW85689.1| predicted metal-binding enzyme [Vibrio fischeri ES114]
 gi|197317088|gb|ACH66535.1| metallo-beta-lactamase superfamily protein [Vibrio fischeri MJ11]
          Length = 217

 Score =  176 bits (447), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 88/216 (40%), Positives = 132/216 (61%), Gaps = 2/216 (0%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           MS L + I+ VT ++QNC+ ++ +E+++ VV+DPGGD+ ++K  I++ N  V  + +THG
Sbjct: 1   MS-LQYQIIPVTSYEQNCSIVWCDETMKGVVIDPGGDVQLLKQAIEALNVDVVHMVLTHG 59

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DHVGG   L    + TI+GPHK+D   +  +  Q+               +WL +GD 
Sbjct: 60  HLDHVGGTEDLAAITNATIVGPHKEDNFWLQGLPNQSERFGFPH-TEAFEPSQWLNEGDV 118

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           +  G     V H PGH+PGHV+  N E   A +GD LF+ +IGR+D   GD+  LI+SI 
Sbjct: 119 IEFGNQKLDVLHTPGHTPGHVVLFNQEAKMAFVGDVLFKGAIGRSDFPKGDFDTLISSIK 178

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            K+ PLG+++ FV GHGP ST G ER+ NPF+   +
Sbjct: 179 TKLWPLGNDMRFVPGHGPESTFGHERQTNPFVADKM 214


>gi|229529649|ref|ZP_04419039.1| hydroxyacylglutathione hydrolase [Vibrio cholerae 12129(1)]
 gi|229333423|gb|EEN98909.1| hydroxyacylglutathione hydrolase [Vibrio cholerae 12129(1)]
 gi|327483958|gb|AEA78365.1| Hypothetical metal-binding enzyme, YcbL-like protein [Vibrio
           cholerae LMA3894-4]
          Length = 218

 Score =  176 bits (447), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 92/217 (42%), Positives = 131/217 (60%), Gaps = 3/217 (1%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           MS L + +V VT F QNC+ ++ +E++E +VVDPGGD+  +  +I      V Q+ +THG
Sbjct: 1   MS-LQYQVVPVTAFAQNCSIVWCDETMEGIVVDPGGDVKQLAMLIAELGVKVTQLVLTHG 59

Query: 61  HVDHVGGAAQLKEDLSLT-IIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGD 119
           H+DHVGG   L + L  T ++GPHK D   +  ++ Q+++    +       D WL DGD
Sbjct: 60  HLDHVGGTQSLAQALGGTRVVGPHKADNFWLQGLEGQSKMFGFPL-TEAFEPDEWLDDGD 118

Query: 120 TLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSI 179
            +  G    +V H PGH+PGHV+  +     A +GD LF  SIGRTD   GD+  LI SI
Sbjct: 119 VIHFGQQTLQVIHTPGHTPGHVVLFSEAARLAFVGDVLFNGSIGRTDFPQGDFNTLIASI 178

Query: 180 NNKILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            NK+ PLG +++F+ GHGP ST GRER  NPF+   +
Sbjct: 179 KNKLWPLGSDVTFIPGHGPQSTFGRERACNPFVADEM 215


>gi|206889881|ref|YP_002248933.1| metallo-beta-lactamase family protein [Thermodesulfovibrio
           yellowstonii DSM 11347]
 gi|206741819|gb|ACI20876.1| metallo-beta-lactamase family protein [Thermodesulfovibrio
           yellowstonii DSM 11347]
          Length = 209

 Score =  176 bits (446), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 72/208 (34%), Positives = 107/208 (51%), Gaps = 4/208 (1%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +     +V P   NC  ++DE + EAVV+DPG + D+I D I+  N ++K I  THGH D
Sbjct: 1   MKIKKFEVGPLFVNCYIIYDERTKEAVVIDPGDEPDLILDFIKEENLNLKYILCTHGHFD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G   +L+++    +   H+ D  +     + A              D  +++G+ L  
Sbjct: 61  HIGSVKELRDETGAKV-VLHEKDIEIYRNSPQIAMQFFGIEIEPQPEPDILIKNGEILNT 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V H  GHSPG      + + +   GDTLF  S+GRTDI+ G   +L+NS+  KI
Sbjct: 120 GNIQLTVIHTSGHSPGS--VCFYTDGYIFTGDTLFAGSVGRTDIIGGSMNELLNSLK-KI 176

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPF 211
             L DE     GHGP + IG E++ NPF
Sbjct: 177 ASLPDETIVFPGHGPKTKIGIEKKTNPF 204


>gi|332288326|ref|YP_004419178.1| hydroxyacylglutathione hydrolase [Gallibacterium anatis UMN179]
 gi|330431222|gb|AEC16281.1| hydroxyacylglutathione hydrolase [Gallibacterium anatis UMN179]
          Length = 216

 Score =  176 bits (446), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 95/216 (43%), Positives = 136/216 (62%), Gaps = 3/216 (1%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           MS ++  I+ VT F+QNC+ ++D+E   A ++DPGGD + I   ++      K I +THG
Sbjct: 1   MS-MNVQIIPVTAFQQNCSVVWDDE-KNAAIIDPGGDAEKILQFLEDNKLIAKFILLTHG 58

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DHVG AA+LK DL++ I+GP K D   +  + EQA    +   A     DRWL +GD 
Sbjct: 59  HLDHVGAAAKLKRDLNIDILGPEKSDEYWLQALPEQASQFGLPYCA-PLIPDRWLNEGDV 117

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           + +G   F++ H PGH+PGH+ ++N E N A  GD LFR SIGRTD   G + +LINSI 
Sbjct: 118 VTIGHLTFEILHLPGHTPGHIGFINKEENIAFTGDVLFRQSIGRTDFQGGSFTELINSIR 177

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           +K+ PL   +  V GHGP +TIG E++ NP+L + I
Sbjct: 178 DKLCPLDQNMQIVAGHGPLTTIGYEKQYNPYLTTQI 213


>gi|319406842|emb|CBI80477.1| putative hydrolase [Bartonella sp. 1-1C]
          Length = 214

 Score =  176 bits (446), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 114/214 (53%), Positives = 147/214 (68%), Gaps = 1/214 (0%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           MS  S +I+ VTPF+QNCT LFD ES   V+VDPGGD   I+  IQ +   V+ IWITHG
Sbjct: 1   MSDFSVYIIPVTPFQQNCTLLFDNESKRGVLVDPGGDWPKIQQTIQKKGVIVEAIWITHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DHVG A Q KE L + IIG H++D  +M  + E+A++     +AR    D+WL+DGD+
Sbjct: 61  HIDHVGAAMQAKEALDIQIIGSHRNDKPIMDDIRERAKIYH-MPDARVCIPDQWLEDGDS 119

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           +    H+F+VFH PGHSPGHVIY N +  F  LGD LFR SIGRTD     +++L+ SI 
Sbjct: 120 VNCAGHVFQVFHTPGHSPGHVIYFNEKKRFVLLGDVLFRGSIGRTDFPLCSHEELMRSIK 179

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
            K+LPLGD +SF+CGHGP S IG ER+ NPFL+ 
Sbjct: 180 EKVLPLGDNVSFICGHGPGSQIGYERQHNPFLRG 213


>gi|152978759|ref|YP_001344388.1| beta-lactamase domain-containing protein [Actinobacillus
           succinogenes 130Z]
 gi|150840482|gb|ABR74453.1| beta-lactamase domain protein [Actinobacillus succinogenes 130Z]
          Length = 210

 Score =  176 bits (446), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 77/210 (36%), Positives = 122/210 (58%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +   I+ VT F+QNC+ ++DE+ + A ++DPGGD   +   I+    + K I +THGH+D
Sbjct: 1   MKLDIIPVTSFQQNCSIIWDEKDMSAAIIDPGGDASKLIKRIEELRLNPKMILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG A +LK      I+GP++ D      + +Q+R   +             ++G+ + L
Sbjct: 61  HVGAAIKLKASFDCEILGPNQLDEYWFQMLPQQSRQFGLFEVEAFLPDRWLNREGEVIRL 120

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   F+V H PGH+PGH+ +++  ++ A  GD LF  SIGRTD   GD+  L+ SI  K+
Sbjct: 121 GELSFEVLHLPGHTPGHIGFIDHAHHIAFTGDVLFNQSIGRTDFPGGDHTDLMRSIKEKL 180

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
             L D+   + GHGP +TIGRE+  NP+++
Sbjct: 181 FALPDDTVVIAGHGPYTTIGREKIHNPYVR 210


>gi|296132726|ref|YP_003639973.1| Hydroxyacylglutathione hydrolase [Thermincola sp. JR]
 gi|296031304|gb|ADG82072.1| Hydroxyacylglutathione hydrolase [Thermincola potens JR]
          Length = 206

 Score =  176 bits (446), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 72/209 (34%), Positives = 105/209 (50%), Gaps = 4/209 (1%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           ++   + V P   NC  +  EE+ EA V+DPGGD   I   + ++   +K I  THGH+D
Sbjct: 1   MNIKSMAVGPMGANCYIVSCEETKEAAVIDPGGDAAKIISYLNNQGLQLKYIINTHGHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+    +LKE     +   H  DAAM+   +         +  R   +DR L +GD + +
Sbjct: 61  HIAANEELKEKTGAEL-LIHTQDAAMLENPNLNLSAFMG-VPVRQQPADRLLNEGDEIEI 118

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    KV H PGH+           +    GDTLF  SIGRTD   G + ++I SI  K+
Sbjct: 119 GNVKLKVIHTPGHT--RGGICLLAGDVVFTGDTLFAGSIGRTDFPGGSFDEIIRSIKTKL 176

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           + L D+     GH   S+IG+E++ NPFL
Sbjct: 177 MTLPDDTEVYPGHMGKSSIGQEKKYNPFL 205


>gi|261253177|ref|ZP_05945750.1| hydroxyacylglutathione hydrolase [Vibrio orientalis CIP 102891]
 gi|260936568|gb|EEX92557.1| hydroxyacylglutathione hydrolase [Vibrio orientalis CIP 102891]
          Length = 218

 Score =  176 bits (445), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 91/217 (41%), Positives = 134/217 (61%), Gaps = 3/217 (1%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           MS L + +V VT F QNC+ ++ +E++E VVVDPGGD+  +  +I+     V  + +THG
Sbjct: 1   MS-LKYQVVPVTSFSQNCSIVWCDETMEGVVVDPGGDVKQLAVLIKELGVKVVNLVLTHG 59

Query: 61  HVDHVGGAAQLKEDL-SLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGD 119
           H+DHVGG   L  +L  + I+GPH+DD   +  ++ Q+++    +       D+WL +GD
Sbjct: 60  HLDHVGGTEPLARELDGVRIVGPHQDDNFWLQGLEGQSQMFGFPL-TEAFEPDQWLNEGD 118

Query: 120 TLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSI 179
            +  G  +  V H PGH+PGHV+  + E   A +GD LF  S+GRTD   GD+  LI+SI
Sbjct: 119 KIKFGNQVMDVIHTPGHTPGHVVLFSDEAKLAFVGDVLFNGSVGRTDFPKGDFDTLISSI 178

Query: 180 NNKILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
             K+ PLG+++ FV GHGP ST GRER  NPF+   +
Sbjct: 179 KTKLWPLGNDVRFVPGHGPESTFGRERASNPFVADEM 215


>gi|154245699|ref|YP_001416657.1| beta-lactamase domain-containing protein [Xanthobacter
           autotrophicus Py2]
 gi|154159784|gb|ABS67000.1| beta-lactamase domain protein [Xanthobacter autotrophicus Py2]
          Length = 235

 Score =  176 bits (445), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 93/212 (43%), Positives = 132/212 (62%), Gaps = 1/212 (0%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M  +   +V VTPF+QNC+ L+   +++ VV+DPGGDLD I+  I      V +I +THG
Sbjct: 23  MQPIQIAVVPVTPFEQNCSLLWCTRTMKGVVIDPGGDLDKIRSAIAETGISVDKILLTHG 82

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           HVDH  GAA+L E L + + GP + D  +M  +   A    I  NAR  + DR+L +G+T
Sbjct: 83  HVDHAAGAAELAETLGVKVEGPGEADQFIMDDIPATAAKYGI-PNARAVTPDRYLSEGET 141

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           + +G     + H PGH+PGH+++V+     A +GDTLFR S+GRTD  +GD   LI  I 
Sbjct: 142 VSVGDLTLDILHVPGHTPGHLVFVHKGVGIAIVGDTLFRGSVGRTDFPYGDPDLLIAGIV 201

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
            K+LPLGD +  + GHGP ++IG E+  NPFL
Sbjct: 202 GKLLPLGDNVVCLPGHGPVTSIGDEKAHNPFL 233


>gi|260772913|ref|ZP_05881829.1| hydroxyacylglutathione hydrolase [Vibrio metschnikovii CIP 69.14]
 gi|260612052|gb|EEX37255.1| hydroxyacylglutathione hydrolase [Vibrio metschnikovii CIP 69.14]
          Length = 218

 Score =  176 bits (445), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 94/217 (43%), Positives = 136/217 (62%), Gaps = 3/217 (1%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           MS L + IV VTPF QNC+ ++ +E+++ +VVDPGGD+  +K +I      V ++ +THG
Sbjct: 1   MS-LKYQIVPVTPFAQNCSIVWCDETMQGIVVDPGGDVKQLKMLIDQLGVQVVKLVLTHG 59

Query: 61  HVDHVGGAAQLKEDLS-LTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGD 119
           H+DHVGG   L   L  + IIGPHK D   +  ++ Q+++    +        +WL +GD
Sbjct: 60  HLDHVGGTQPLAALLGNVDIIGPHKADNFWLQGLEGQSQMFGFPL-TEAFEPHQWLDEGD 118

Query: 120 TLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSI 179
           T+  G     V H PGH+PGHV+  + E + A +GD LF  SIGRTD   GD+  LI+SI
Sbjct: 119 TVTFGNQTLAVLHTPGHTPGHVVLFSEEASLAFVGDVLFNGSIGRTDFPQGDFNTLIDSI 178

Query: 180 NNKILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            NK+ PLG++++F+ GHGP ST GRER  NPF+   +
Sbjct: 179 KNKLWPLGNQVTFIPGHGPTSTFGRERASNPFVADEM 215


>gi|315425048|dbj|BAJ46721.1| metallo-beta-lactamase family protein [Candidatus Caldiarchaeum
           subterraneum]
          Length = 218

 Score =  176 bits (445), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 76/211 (36%), Positives = 109/211 (51%), Gaps = 5/211 (2%)

Query: 4   LSFHIV--QVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGH 61
           ++  IV  QV P   N   ++DEE+ EAV++D G D  ++ + +Q R   V  ++ THGH
Sbjct: 1   MTLKIVSHQVGPLSSNSYIVYDEETREAVIIDAGDDAWLLLETLQERRLRVNAVYATHGH 60

Query: 62  VDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
            DHV     LK+ L +     H+ D  ++    E  R           S D +++DG T+
Sbjct: 61  FDHVMAVDDLKQALKIP-FYIHRLDLEILSMAREMTRRFLGIDVGDPPSPDGYIEDGQTI 119

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
            +G    KV H PGHSPG      + +     GD LF  S+GRTD   G  QQL  SI  
Sbjct: 120 QVGGKSLKVIHTPGHSPGS--VCFYGDGVLFSGDLLFMGSVGRTDAPGGSAQQLTQSILE 177

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           K+  L D++    GHGP +TIG E++ NPF+
Sbjct: 178 KVFKLPDDVKVYPGHGPETTIGWEKKHNPFV 208


>gi|163867951|ref|YP_001609155.1| hydrolase [Bartonella tribocorum CIP 105476]
 gi|161017602|emb|CAK01160.1| probable hydrolase [Bartonella tribocorum CIP 105476]
          Length = 216

 Score =  176 bits (445), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 117/214 (54%), Positives = 146/214 (68%), Gaps = 1/214 (0%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           MS  S HI+ VTPF+QNCT LFD E    V+VDPGGD   I++VI+ +   V+ IWITHG
Sbjct: 1   MSHFSTHIIPVTPFQQNCTLLFDTEQKGGVLVDPGGDWRRIQEVIEKKGITVEAIWITHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H DHVG A Q KEDL + IIG H DD  +M  V E AR   I  +A     D+WL+DGD+
Sbjct: 61  HFDHVGAAMQAKEDLGVKIIGSHCDDRPVMDAVVESARSYGI-TDASVCIPDQWLEDGDS 119

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           +    H+F+VFH PGHSPGHVIY N +  FA LGD LFR SIGRTD     +++L+ S+ 
Sbjct: 120 VHFSDHVFRVFHTPGHSPGHVIYFNEKERFALLGDVLFRGSIGRTDFPFCSHEKLMRSLR 179

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
            KILPLGD++ F+CGHGP S +G ER+ NPFL+ 
Sbjct: 180 EKILPLGDDVRFICGHGPGSYLGYERQWNPFLQE 213


>gi|146337644|ref|YP_001202692.1| metallo-hydrolase/oxidoreductase domain-containing protein
           [Bradyrhizobium sp. ORS278]
 gi|146190450|emb|CAL74449.1| putative enzyme with metallo-hydrolase/oxidoreductase domain
           (ycbL-like) [Bradyrhizobium sp. ORS278]
          Length = 222

 Score =  176 bits (445), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 103/205 (50%), Positives = 144/205 (70%), Gaps = 1/205 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           IV VTPF+QNCT L+ E + +A+V+DPGGD+  I+  I   N  V++IW+THGH+DHVGG
Sbjct: 15  IVPVTPFEQNCTILWCEATKKAIVIDPGGDVPNIQAAIAQANVTVEKIWLTHGHIDHVGG 74

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
           AA L++ L + I GPH  D  ++  V E  +   I    R+ + DRWL++GDT+ +G  +
Sbjct: 75  AADLRDALKVPIEGPHIADKYLLDNVVESGKRFGI-TGVRDVTPDRWLEEGDTVQIGELV 133

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
           F + HCPGHSPG V++ N +  FAH+GD LF  S+GRTD+  G ++ LI+SI +K+LPLG
Sbjct: 134 FDILHCPGHSPGSVVFFNKQMRFAHVGDVLFNGSVGRTDLPGGSHETLISSIKDKLLPLG 193

Query: 188 DEISFVCGHGPNSTIGRERRLNPFL 212
           D+I F+CGHG  S+ G+ER  NPFL
Sbjct: 194 DDIGFICGHGAGSSFGQERMTNPFL 218


>gi|325267543|ref|ZP_08134195.1| metallo-beta-lactamase domain protein [Kingella denitrificans ATCC
           33394]
 gi|324980893|gb|EGC16553.1| metallo-beta-lactamase domain protein [Kingella denitrificans ATCC
           33394]
          Length = 213

 Score =  176 bits (445), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 80/212 (37%), Positives = 128/212 (60%), Gaps = 1/212 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L + I  VTPF+QNCT L+D+ + +AV+ D GGD   +   ++ +  +++ +W+THGH+D
Sbjct: 3   LQYRIFPVTPFRQNCTLLWDDATNDAVLTDVGGDSGFLWQHVRQQGLNLRAVWLTHGHLD 62

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GG   L +     I+GPH++D  ++  + +        +     +  R+L +GDTL +
Sbjct: 63  HAGGVPFLLQQHETEILGPHREDEFLLQSLPQTTAEYGFPVC-PAFAPTRYLNEGDTLTV 121

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   F V H  GH+PGHV++ + +N     GD LFR SIGRTD   G++Q L+N+I  K+
Sbjct: 122 GQQRFDVLHIDGHTPGHVVFHSPDNKLLIAGDVLFRESIGRTDFPRGNHQALLNNIRRKL 181

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSN 215
             L D+   + GHG  +TIG E+R NPF++++
Sbjct: 182 YTLPDDTLVIPGHGRTTTIGHEKRHNPFVRAD 213


>gi|229845071|ref|ZP_04465207.1| predicted Zn-dependent hydrolase-like protein [Haemophilus
           influenzae 6P18H1]
 gi|229812043|gb|EEP47736.1| predicted Zn-dependent hydrolase-like protein [Haemophilus
           influenzae 6P18H1]
          Length = 212

 Score =  176 bits (445), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 80/210 (38%), Positives = 126/210 (60%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           ++  I+ VT F+QNC+ ++D++   A ++DPGG+ + +   I+  + ++K I ITHGH+D
Sbjct: 1   MNIEIIPVTAFQQNCSLIWDDD-KNAAIIDPGGEAERLIQRIEELHLNLKVILITHGHLD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG A QLK+   + I G  ++D  +   + EQA+   +           + Q+G+ L L
Sbjct: 60  HVGAAMQLKQHFGVEIWGSQEEDKFLFESLPEQAQRFGLPNIEAFLPDRWFNQEGEILKL 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
               F++ H PGH+PGH+ ++  E   A  GD LF+  IGRTD   GDY  LI+SI  K+
Sbjct: 120 DGFNFEILHLPGHTPGHIGFIEHEKKVAFTGDVLFQGGIGRTDFPRGDYDVLISSIRTKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           L L D++  + GHG  +TIG+E++ NPFL 
Sbjct: 180 LSLNDDLIIIAGHGSYTTIGQEKQTNPFLN 209


>gi|261211001|ref|ZP_05925291.1| hydroxyacylglutathione hydrolase [Vibrio sp. RC341]
 gi|260839976|gb|EEX66576.1| hydroxyacylglutathione hydrolase [Vibrio sp. RC341]
          Length = 218

 Score =  175 bits (444), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 94/217 (43%), Positives = 133/217 (61%), Gaps = 3/217 (1%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           MS L + +V VT F QNC+ ++ +E++E VVVDPGGD+  +  +I      V Q+ +THG
Sbjct: 1   MS-LQYQVVPVTAFAQNCSIVWCDETMEGVVVDPGGDVKQLAMLIAELGVKVTQLVLTHG 59

Query: 61  HVDHVGGAAQLKEDLSLT-IIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGD 119
           H+DHVGG   L E L  T I+GPHK D   +  ++ Q+++    +       D+WL DGD
Sbjct: 60  HLDHVGGTEPLAEALGGTRIVGPHKADNFWLQGLEGQSKMFGFPL-TETFEPDQWLNDGD 118

Query: 120 TLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSI 179
            +  G    +V H PGH+PGHV+  +     A +GD LF  SIGRTD   GD+  LI SI
Sbjct: 119 AVTFGKQTLQVIHTPGHTPGHVVLFSESARLAFVGDVLFNGSIGRTDFPQGDFNTLIASI 178

Query: 180 NNKILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            NK+ PLG++++F+ GHGP ST GRER  NP++   +
Sbjct: 179 KNKLWPLGNDVTFIPGHGPKSTFGRERASNPYVADEM 215


>gi|74316086|ref|YP_313826.1| metallo-beta-lactamase superfamily protein [Thiobacillus
           denitrificans ATCC 25259]
 gi|74055581|gb|AAZ96021.1| metallo-beta-lactamase superfamily protein [Thiobacillus
           denitrificans ATCC 25259]
          Length = 212

 Score =  175 bits (444), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 89/209 (42%), Positives = 137/209 (65%), Gaps = 2/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + F I+ VTP++QNC+ ++D +   A ++DPGG+ + + D +  R   +  + +THGH+D
Sbjct: 1   MEFTILPVTPYQQNCSLVWDAD-GVAALIDPGGETERLLDEVSRRKLVLASVLLTHGHLD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG A +L+E L + IIGP +D+A  +  + +QA L      A+  + DRWL+DGDT+ +
Sbjct: 60  HVGAALELRERLGIPIIGPQRDEAFWLDSLPQQAELFGFPP-AKAFTPDRWLEDGDTVDV 118

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   F V HCPGH+PGHV++ +     A +GD LF+ SIGR+D   G+++ L+ +I  K+
Sbjct: 119 GAIRFDVLHCPGHTPGHVVFYDASARLAFVGDVLFKGSIGRSDFPRGNHRALVAAIREKL 178

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
            PLGD++ FV GHG  S+ G ERR NPF+
Sbjct: 179 FPLGDDVRFVPGHGAMSSFGHERRDNPFV 207


>gi|323500085|ref|ZP_08105039.1| hypothetical protein VISI1226_08734 [Vibrio sinaloensis DSM 21326]
 gi|323314941|gb|EGA67998.1| hypothetical protein VISI1226_08734 [Vibrio sinaloensis DSM 21326]
          Length = 218

 Score =  175 bits (444), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 88/217 (40%), Positives = 133/217 (61%), Gaps = 3/217 (1%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           MS L + +V VT F QNC+ ++ +E+++ +VVDPGGD+  +  +I+     V  + +THG
Sbjct: 1   MS-LKYQVVPVTSFSQNCSIVWCDETMKGIVVDPGGDVKQLAMLIKELGVDVVNLVLTHG 59

Query: 61  HVDHVGGAAQLKEDLS-LTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGD 119
           H+DHVGG   L + L  + I+GPH++D   +  ++ Q+++    +        +WL +GD
Sbjct: 60  HLDHVGGTEPLADALGGVEIVGPHREDNFWLQGLEGQSQMFGFPL-TEAFEPHKWLNEGD 118

Query: 120 TLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSI 179
            +  G  +  V H PGH+PGHV+  + E   A +GD LF  S+GRTD   GD+  LINSI
Sbjct: 119 KITFGNQVMDVIHTPGHTPGHVVLFSQEAKLAFVGDVLFNGSVGRTDFPKGDFNTLINSI 178

Query: 180 NNKILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
             K+ PLG+++ FV GHGP ST GRER  NPF+   +
Sbjct: 179 KTKLWPLGNDVRFVPGHGPESTFGRERASNPFVADEM 215


>gi|320156747|ref|YP_004189126.1| hypothetical protein VVM_03483 [Vibrio vulnificus MO6-24/O]
 gi|319932059|gb|ADV86923.1| hypothetical metal-binding enzyme YcbL-like protein [Vibrio
           vulnificus MO6-24/O]
          Length = 218

 Score =  175 bits (444), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 89/214 (41%), Positives = 134/214 (62%), Gaps = 2/214 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L + IV VTPF QNC+ ++ +++++ +V+DPGGD   +  +I+     V  + +THGH+D
Sbjct: 3   LKYQIVPVTPFAQNCSIVWCDDTMKGIVIDPGGDEKQLAVIIKELGVEVVNLVLTHGHLD 62

Query: 64  HVGGAAQLKEDL-SLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLL 122
           HVGG  +L E L  + I+GPHK D   +  ++ Q+++    +       ++WL DGD + 
Sbjct: 63  HVGGTERLAEMLDGIEIVGPHKADNFWLQGLEGQSQMFGFPL-TEAFEPNQWLNDGDEVR 121

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
            G  + +V H PGH+PGHV+  + E   A +GD LF  SIGRTD   GD+  LI SI NK
Sbjct: 122 FGNQVLQVLHTPGHTPGHVVLYSEEARRAFVGDVLFNGSIGRTDFPQGDFNTLIASIKNK 181

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           + PLG++++F+ GHGP ST G ERR NPF+   +
Sbjct: 182 LWPLGNDVTFIPGHGPESTFGHERRTNPFVADEM 215


>gi|319896898|ref|YP_004135093.1| zn-dependent hydrolase-like protein, including glyoxylases
           [Haemophilus influenzae F3031]
 gi|317432402|emb|CBY80757.1| predicted Zn-dependent hydrolase-like protein,including glyoxylases
           [Haemophilus influenzae F3031]
          Length = 212

 Score =  175 bits (444), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 84/210 (40%), Positives = 128/210 (60%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           ++  I+ VT F+QNC+ ++D+E   A ++DPGG+ + +   I+  + ++K I ITHGH+D
Sbjct: 1   MNIEIIPVTAFQQNCSLIWDDE-KNATIIDPGGEAERLIQRIEELDLNLKVILITHGHLD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG A QLK+   + I G ++ D  +   + EQA+   +           + Q+G+ L L
Sbjct: 60  HVGAAMQLKQHFGVEIWGSNEKDKFLFESLPEQAQRFGLPNIDAFLPDRWFNQEGEILKL 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
               F++ H PGH+PGH+ ++  E   A  GD LF+  IGRTD   GDY+ LI+SI  K+
Sbjct: 120 DGFNFEILHLPGHTPGHIGFIEHEKKVAFTGDVLFQGGIGRTDFPRGDYETLISSIRTKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           LPL D+I  + GHG  +TIG+E+R NPFL 
Sbjct: 180 LPLNDDIIIIAGHGSYTTIGQEKRSNPFLN 209


>gi|89898986|ref|YP_521457.1| beta-lactamase-like protein [Rhodoferax ferrireducens T118]
 gi|89343723|gb|ABD67926.1| beta-lactamase-like [Rhodoferax ferrireducens T118]
          Length = 212

 Score =  175 bits (443), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 92/211 (43%), Positives = 134/211 (63%), Gaps = 1/211 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L +  V VTP++QNC+ L+ +++++  V+DPGGDL+ +   +      + QIW+THGH+D
Sbjct: 2   LRYLTVPVTPYQQNCSLLWCDQTMKTAVLDPGGDLERVLAQVARAGLVLDQIWLTHGHID 61

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GGAA+L     L IIGPH+ D  ++  +  Q ++       +  +  RWL DGDT+ L
Sbjct: 62  HAGGAAELALRFGLPIIGPHQADQFLIDGLALQGKMFGFAH-VQTFTPTRWLNDGDTVKL 120

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGH+PGHV++ + E N A +GD LF  SIGRTD+  GD+  LI SI  ++
Sbjct: 121 GHSTLTVRHCPGHTPGHVVFYSSEANRAFVGDVLFAGSIGRTDLPQGDHDTLIASITQRL 180

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
            P+G++  FV GHGP ST G ERR NP+++ 
Sbjct: 181 WPMGNDTVFVPGHGPESTFGIERRSNPYVRD 211


>gi|27366238|ref|NP_761766.1| hydroxyacylglutathione hydrolase [Vibrio vulnificus CMCP6]
 gi|27362439|gb|AAO11293.1| Hydroxyacylglutathione hydrolase [Vibrio vulnificus CMCP6]
          Length = 218

 Score =  175 bits (443), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 89/214 (41%), Positives = 134/214 (62%), Gaps = 2/214 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L + IV VTPF QNC+ ++ +++++ +V+DPGGD   +  +I+     V  + +THGH+D
Sbjct: 3   LKYQIVPVTPFAQNCSIVWCDDTMKGIVIDPGGDEKQLAVIIKELGVEVVNLVLTHGHLD 62

Query: 64  HVGGAAQLKEDL-SLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLL 122
           HVGG  +L E L  + I+GPHK D   +  ++ Q+++    +       ++WL DGD + 
Sbjct: 63  HVGGTERLAEMLDGIEIVGPHKADNFWLQGLEGQSQMFGFPL-TEAFEPNQWLNDGDEVC 121

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
            G  + +V H PGH+PGHV+  + E   A +GD LF  SIGRTD   GD+  LI SI NK
Sbjct: 122 FGNQVLQVLHTPGHTPGHVVLYSEEARRAFVGDVLFNGSIGRTDFPQGDFNTLIASIKNK 181

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           + PLG++++F+ GHGP ST G ERR NPF+   +
Sbjct: 182 LWPLGNDVTFIPGHGPESTFGHERRTNPFVADEM 215


>gi|322419018|ref|YP_004198241.1| beta-lactamase domain-containing protein [Geobacter sp. M18]
 gi|320125405|gb|ADW12965.1| beta-lactamase domain protein [Geobacter sp. M18]
          Length = 209

 Score =  175 bits (443), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 80/211 (37%), Positives = 108/211 (51%), Gaps = 2/211 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + F  + V P   NC  L D+ S E +VVDPG D D+I   + +    +K I  THGH D
Sbjct: 1   MLFETIVVGPLGVNCFILGDKHSNEGMVVDPGADCDMILATVANFGVEIKYIVNTHGHFD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG   QLKE     ++   +D   ++       +         +   D +L DG  L L
Sbjct: 61  HVGCNRQLKERTGAQLLAHQEDLPFLLNAGRSAQK--YGLSVEDSPQPDLFLTDGMRLEL 118

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V H PGH+ G              GDTLF  S+GRTD+  G++ QLI +I  K+
Sbjct: 119 GRRSIEVLHTPGHTQGGCCLYLANEKLVITGDTLFADSVGRTDLPGGNHSQLIAAIKTKL 178

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           LPL D+     GHGP+STIG+ERRLNP+L  
Sbjct: 179 LPLPDDTIVWPGHGPSSTIGQERRLNPYLNE 209


>gi|145641088|ref|ZP_01796669.1| hypothetical protein CGSHiR3021_08461 [Haemophilus influenzae
           R3021]
 gi|145274249|gb|EDK14114.1| hypothetical protein CGSHiR3021_08461 [Haemophilus influenzae
           22.4-21]
          Length = 213

 Score =  175 bits (443), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 85/212 (40%), Positives = 129/212 (60%), Gaps = 2/212 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           ++  I+ VT F+QNC+ ++D+E   A ++DPGG+ + +   I+  + ++K I ITHGH+D
Sbjct: 1   MNIEIIPVTAFQQNCSLIWDDE-KNAAIIDPGGEAERLIQRIEELDLNLKVILITHGHLD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG A QLK+   + I G  ++D  +   + EQA+   +           + Q+G+ L L
Sbjct: 60  HVGAAMQLKQHFGVEIWGSQEEDKFLFESLPEQAQRFGLPNIDAFLPDRWFNQEGEILKL 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
               F++ H PGH+PGH+ ++  E   A  GD LF+  IGRTD   GDY+ LI+SI  K+
Sbjct: 120 DGFNFEILHLPGHTPGHIGFIEHEKKVAFTGDVLFQGGIGRTDFPRGDYETLISSIRTKL 179

Query: 184 LPLGDE-ISFVCGHGPNSTIGRERRLNPFLKS 214
           LPL D+ I  + GHG  +TIG+E+R NPFL S
Sbjct: 180 LPLNDDIIIIIAGHGSYTTIGQEKRSNPFLNS 211


>gi|332991609|gb|AEF01664.1| putative metallo-beta-lactamase [Alteromonas sp. SN2]
          Length = 213

 Score =  174 bits (442), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 82/209 (39%), Positives = 125/209 (59%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +   I+ VTPF QNC+ ++D  S +   VDPGGD+  +          +++I +THGH+D
Sbjct: 1   MEIVIIPVTPFAQNCSLIWDAGSKQGAFVDPGGDIQKLIGAASDNQVTIEKIILTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVGG  +L +   + IIGPH  D   +  + +Q+++      A     ++WL D DT+ +
Sbjct: 61  HVGGTVELAKHYDVPIIGPHLGDKFWLDALMQQSQMFGF-PPATPFVPNQWLNDKDTISV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGHV+ V   +N   +GD +F  SIGRTD   G++QQLI+SIN  I
Sbjct: 120 GELTLEVLHCPGHTPGHVVLVERTSNKVIVGDVIFAGSIGRTDFPQGNHQQLIDSINANI 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           L L D++    GHGP +T+ +E+  NP++
Sbjct: 180 LTLPDDMEIYPGHGPTTTVAKEKASNPYV 208


>gi|258620188|ref|ZP_05715227.1| glyoxylase II family protein [Vibrio mimicus VM573]
 gi|258587546|gb|EEW12256.1| glyoxylase II family protein [Vibrio mimicus VM573]
          Length = 218

 Score =  174 bits (442), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 93/217 (42%), Positives = 132/217 (60%), Gaps = 3/217 (1%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           MS L + +V VT F QNC+ ++ +E++E VVVDPGGD+  +  +I      V Q+ +THG
Sbjct: 1   MS-LQYQVVPVTAFSQNCSIVWCDETMEGVVVDPGGDVKQLAMLIAGLGVKVTQLVLTHG 59

Query: 61  HVDHVGGAAQLKEDLSLT-IIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGD 119
           H+DHVGG   L E L  T I+GPHK D   +  ++ Q+++    +        +WL DGD
Sbjct: 60  HLDHVGGTEPLAEALGGTRIVGPHKADNFWLQGLEGQSKMFGFPL-TEAFEPHQWLNDGD 118

Query: 120 TLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSI 179
            +  G    +V H PGH+PGHV+  +     A +GD LF  SIGRTD   GD+  LI SI
Sbjct: 119 VVTFGKQTLQVLHTPGHTPGHVVLFSDSARLAFVGDVLFNGSIGRTDFPQGDFNTLIASI 178

Query: 180 NNKILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            NK+ PLG++++F+ GHGP ST GRER  NP++   +
Sbjct: 179 KNKLWPLGNDVTFIPGHGPKSTFGRERANNPYVADEM 215


>gi|15602137|ref|NP_245209.1| hypothetical protein PM0272 [Pasteurella multocida subsp. multocida
           str. Pm70]
 gi|12720503|gb|AAK02356.1| unknown [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 209

 Score =  174 bits (442), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 78/210 (37%), Positives = 127/210 (60%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           ++  I+ VT F+QNC+ ++DE+   A ++DPGGD + +   I+  + +++ I +THGH+D
Sbjct: 1   MNIEIIPVTAFQQNCSLIWDEK-RNAAIIDPGGDAEKLIKRIEELDLNLQAILLTHGHLD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG A +LK   ++ IIGP+  D      +  Q++   +              +G+ + +
Sbjct: 60  HVGAAPKLKAHFNVEIIGPNSQDEYWFNALPAQSQKFGLFEIPAFTPDRWLNNEGEIIQV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   F+V H PGH+PGH+ ++  E   A  GD LF+ SIGRTD   GD+  L++ I  K+
Sbjct: 120 GDMQFEVLHLPGHTPGHIGFIEHEKRIAFTGDVLFKQSIGRTDFQGGDHATLLSVIKEKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
            PLGD++  V GHGP +TIG+E++ NPF++
Sbjct: 180 YPLGDDMIIVAGHGPYTTIGQEKQHNPFVR 209


>gi|218781796|ref|YP_002433114.1| beta-lactamase domain protein [Desulfatibacillum alkenivorans
           AK-01]
 gi|218763180|gb|ACL05646.1| beta-lactamase domain protein [Desulfatibacillum alkenivorans
           AK-01]
          Length = 206

 Score =  174 bits (442), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 83/210 (39%), Positives = 118/210 (56%), Gaps = 4/210 (1%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +    + V P + NC  +  E++ +AVV+DPGG+ D I   + +    +  I  THGH D
Sbjct: 1   MIIRQLAVGPLQANCFIVGCEKTNQAVVIDPGGEADKILMSLANHKLTLTAILNTHGHFD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HV G   LK+     I   H++DA M+  V   A    ++M      +D++L++GD + +
Sbjct: 61  HVEGNKGLKDATGCDIY-IHEEDAPMLQMVSSLASSFGLQMQNSPP-ADKFLKEGDVITV 118

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    KV H PGHSPG V +    +    +GDTLF  SIGRTD+  G Y QLI S+ +KI
Sbjct: 119 GEESLKVLHTPGHSPGGVSF--CADGVVFVGDTLFAGSIGRTDLPGGSYNQLIASVKDKI 176

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
            PLGDE     GHGP +T+GRE+  NPF +
Sbjct: 177 FPLGDECVVCAGHGPETTVGREKMYNPFFQ 206


>gi|260914199|ref|ZP_05920672.1| metallo-beta-lactamase [Pasteurella dagmatis ATCC 43325]
 gi|260631832|gb|EEX50010.1| metallo-beta-lactamase [Pasteurella dagmatis ATCC 43325]
          Length = 210

 Score =  174 bits (441), Expect = 8e-42,   Method: Composition-based stats.
 Identities = 76/211 (36%), Positives = 130/211 (61%), Gaps = 1/211 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           ++  I+ VT F+QNC+ ++D+E   A ++DPGG+ + +   I+  + ++K I +THGH+D
Sbjct: 1   MNIEIIPVTAFQQNCSLIWDDE-KNAAIIDPGGEAEKLIKRIEELDLNLKVILLTHGHLD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG A +LK+  ++ +IGP+  D     ++ +Q++   +             ++G+ + +
Sbjct: 60  HVGAAPKLKQHFNVEMIGPNSLDDYWFQQLPQQSQKFGLFEIDAFEPDRWLNEEGEIIEI 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   F+V H PGH+PGH+ ++      A  GD LF+ S+GRTD   GD+Q L+  I  K+
Sbjct: 120 GDMRFEVLHLPGHTPGHIGFIEHNKRIAFTGDVLFKQSVGRTDFPGGDHQALLRVIREKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
            PLGD++  V GHGP +TIG+E++ NPF++ 
Sbjct: 180 YPLGDDMIIVAGHGPYTTIGQEKQNNPFVRE 210


>gi|330993049|ref|ZP_08316987.1| hypothetical protein SXCC_02949 [Gluconacetobacter sp. SXCC-1]
 gi|329759819|gb|EGG76325.1| hypothetical protein SXCC_02949 [Gluconacetobacter sp. SXCC-1]
          Length = 219

 Score =  174 bits (440), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 97/217 (44%), Positives = 140/217 (64%), Gaps = 7/217 (3%)

Query: 2   SKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGH 61
           + LS  IV VT F QNC+ L++  +L AVVVDPGGD+  I   I +++  V  IW+THGH
Sbjct: 3   APLSLEIVPVTAFGQNCSILWNPATLHAVVVDPGGDVPRIMAFIAAKDLVVDSIWLTHGH 62

Query: 62  VDHVGGAAQLKEDLSL------TIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWL 115
           +DH GGA  L+ +L+        +IGP + D  ++  + +QA L  +     +   DR++
Sbjct: 63  LDHAGGADALRRELTARQGKAVPVIGPDRADEPLLSAIPQQAALFGVTG-LESVRPDRFV 121

Query: 116 QDGDTLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQL 175
             G+TL    H F+V H PGH+PGHVI+ +  + FA +GDTLFR  +GRTD  +GD+ QL
Sbjct: 122 SHGETLEALGHSFEVRHVPGHTPGHVIFYDPASRFAFVGDTLFRGGVGRTDFPYGDHDQL 181

Query: 176 INSINNKILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           I +I +++LPLGD+++ + GHGP +TIG ER  NPFL
Sbjct: 182 IAAIRDQLLPLGDDVTILPGHGPATTIGAERAGNPFL 218


>gi|304415072|ref|ZP_07395812.1| metallo-beta-lactamase superfamily protein [Candidatus Regiella
           insecticola LSR1]
 gi|304283076|gb|EFL91499.1| metallo-beta-lactamase superfamily protein [Candidatus Regiella
           insecticola LSR1]
          Length = 209

 Score =  174 bits (440), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 86/210 (40%), Positives = 135/210 (64%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + I+ VT F QNC+ ++ E + +A ++DPGGD D +   I  +   + +I +THGH+D
Sbjct: 1   MKYEILPVTAFNQNCSLIWCERTYQAALIDPGGDADKLIAAINHKKVTINKILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG AAQL +   ++I GP  +D  ++ K+  Q+++  +    +      WL++GD + +
Sbjct: 61  HVGAAAQLAKHFQVSIHGPAVEDRFLLEKLPIQSKMFGLDEC-QPFEPTCWLKEGDKITI 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V HCPGH+PGH++++N  +  A +GD +FR S+GRTD    D+ QLI+SI NK+
Sbjct: 120 GDIKLMVLHCPGHTPGHIVFINQTDRLALVGDVIFRGSVGRTDFPLSDHAQLISSIQNKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           LPLGD+I+F+ GHG  ST G ER+ NPF+ 
Sbjct: 180 LPLGDDITFIPGHGKISTFGYERKHNPFIN 209


>gi|121535599|ref|ZP_01667406.1| beta-lactamase domain protein [Thermosinus carboxydivorans Nor1]
 gi|121305839|gb|EAX46774.1| beta-lactamase domain protein [Thermosinus carboxydivorans Nor1]
          Length = 206

 Score =  173 bits (439), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 78/210 (37%), Positives = 114/210 (54%), Gaps = 4/210 (1%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +    ++V     NC  ++ E++  A V+DPGG+ + I  VI   N  V+ I  THGH D
Sbjct: 1   MKIIALEVGSLGTNCYIVYCEKTRAAAVIDPGGNAEEILAVINGENLKVECIINTHGHAD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+   A++K+     I   H++DA M+  +     +  I    +   +DR LQDGD + +
Sbjct: 61  HIQANAKIKQATCAPIF-IHREDADMLTSIHRNLSVF-IGGGIKCEPADRLLQDGDIIRI 118

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V H PGH+PG         +    GDTLF  SIGRTD   G Y+QLI+SI  K+
Sbjct: 119 GEIALTVIHTPGHTPGG--ICLLGGDVLFSGDTLFAESIGRTDFPGGSYRQLIHSIKEKL 176

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           + L D +  + GHGP +TIG ER+ NPF++
Sbjct: 177 MVLDDNVRVLPGHGPETTIGWERQHNPFIQ 206


>gi|71892197|ref|YP_277930.1| metallo-hydrolase/oxidoreductase domain-containing protein
           [Candidatus Blochmannia pennsylvanicus str. BPEN]
 gi|71796303|gb|AAZ41054.1| putative enzyme with metallo-hydrolase/oxidoreductase domain
           [Candidatus Blochmannia pennsylvanicus str. BPEN]
          Length = 217

 Score =  173 bits (439), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 95/216 (43%), Positives = 138/216 (63%), Gaps = 3/216 (1%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + ++I+ VTPF QNC+ ++ E + EAV+VDPGG+ D ++  I      V +I +THGH D
Sbjct: 1   MQYNIIPVTPFHQNCSIIWCEVTHEAVLVDPGGESDKLRSEIDKLGVKVNKILLTHGHFD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSI---RMNARNASSDRWLQDGDT 120
           HVG A +L+E   + IIGP+K D +++  +  Q R+L I     +      D WL+DGDT
Sbjct: 61  HVGSAMELREYYKIPIIGPNKADQSLLDNLSVQCRILDIDLPNNSTTAVIPDVWLEDGDT 120

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           + +G  +F + HCPGHSPGH+++ N    F  +GD LF+ SIGRTD+  G+   LINSI 
Sbjct: 121 VQVGREVFDILHCPGHSPGHIVFWNKIRKFMVMGDVLFKRSIGRTDLPGGNIAVLINSIK 180

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
            K+ PLGD+I F+ GHG +ST+G ER  N ++   I
Sbjct: 181 TKLFPLGDDILFLPGHGSSSTLGYERLNNIYITHAI 216


>gi|258543469|ref|YP_003188902.1| metallo-beta-lactamase [Acetobacter pasteurianus IFO 3283-01]
 gi|256634547|dbj|BAI00523.1| metallo-beta-lactamase [Acetobacter pasteurianus IFO 3283-01]
 gi|256637605|dbj|BAI03574.1| metallo-beta-lactamase [Acetobacter pasteurianus IFO 3283-03]
 gi|256640657|dbj|BAI06619.1| metallo-beta-lactamase [Acetobacter pasteurianus IFO 3283-07]
 gi|256643714|dbj|BAI09669.1| metallo-beta-lactamase [Acetobacter pasteurianus IFO 3283-22]
 gi|256646769|dbj|BAI12717.1| metallo-beta-lactamase [Acetobacter pasteurianus IFO 3283-26]
 gi|256649822|dbj|BAI15763.1| metallo-beta-lactamase [Acetobacter pasteurianus IFO 3283-32]
 gi|256652810|dbj|BAI18744.1| metallo-beta-lactamase [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256655866|dbj|BAI21793.1| metallo-beta-lactamase [Acetobacter pasteurianus IFO 3283-12]
          Length = 223

 Score =  173 bits (439), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 90/218 (41%), Positives = 134/218 (61%), Gaps = 7/218 (3%)

Query: 2   SKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGH 61
             +   IV VTPF+QNC+ L+ E++ +AV+VD GGD+D++ D ++     V+ I +THGH
Sbjct: 6   PDMQLRIVPVTPFRQNCSVLWHEKTRKAVIVDAGGDVDVLLDFLKKNILEVEAILLTHGH 65

Query: 62  VDHV------GGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWL 115
           +DH           +  +     ++GP+  D  ++  + EQAR   +     NA  DR+ 
Sbjct: 66  LDHAGGVAALCRGLENTQKTQPDVVGPNIHDQFLLQSIVEQARHFGLSD-LENADVDRFT 124

Query: 116 QDGDTLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQL 175
           +DG++L      F+V H PGH+PGHV++V+ +  FA +GD LFR +IGRTD  +G+ QQL
Sbjct: 125 EDGESLNYLGCTFRVVHVPGHTPGHVVFVDEKARFAFVGDVLFRGTIGRTDFAYGNSQQL 184

Query: 176 INSINNKILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           I  I  K+LPLGD+I  V GHG  +T+G ER  NPFL+
Sbjct: 185 IQGIKEKLLPLGDDIVIVPGHGGLTTLGAERASNPFLQ 222


>gi|258515500|ref|YP_003191722.1| beta-lactamase domain-containing protein [Desulfotomaculum
           acetoxidans DSM 771]
 gi|257779205|gb|ACV63099.1| beta-lactamase domain protein [Desulfotomaculum acetoxidans DSM
           771]
          Length = 205

 Score =  173 bits (439), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 69/209 (33%), Positives = 99/209 (47%), Gaps = 4/209 (1%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +      V     NC  +  EE+ EA V+DPG +   I   +       + I +THGHVD
Sbjct: 1   MILERFPVGMMGANCYIIGCEETKEACVIDPGDEDKKILSKLVKHGLTCRYIVLTHGHVD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G   Q+++     +   H+DDA M+    +              +  + L D D + +
Sbjct: 61  HIGALEQVQKATGARV-LIHRDDADMLTNPAKNLSSFMGLQMQFEPADVK-LGDKDVIEV 118

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V H PGH+PG         +    GDTLF  S+GR+D   G + QLI SI NK+
Sbjct: 119 GKLKLEVIHTPGHTPGG--ICLKTGDCLITGDTLFAGSVGRSDFPGGSHSQLIASIKNKL 176

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           L   D      GHGP ++IG E+R NPFL
Sbjct: 177 LNFPDNTRVFSGHGPETSIGTEKRTNPFL 205


>gi|225175876|ref|ZP_03729869.1| beta-lactamase domain protein [Dethiobacter alkaliphilus AHT 1]
 gi|225168800|gb|EEG77601.1| beta-lactamase domain protein [Dethiobacter alkaliphilus AHT 1]
          Length = 205

 Score =  173 bits (438), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 78/210 (37%), Positives = 106/210 (50%), Gaps = 5/210 (2%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +    ++V  F  NC  L  +E+ E VVVDPG D   I  +++    +VK I  THGHVD
Sbjct: 1   MLLKRMEVGSFAANCYLLACDETKEGVVVDPGADARRILKMVEDNQVNVKYIINTHGHVD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG   +++E L   I   H+ D  M  K          +     A  DR ++  DT  +
Sbjct: 61  HVGANEEVREALGAPI-LIHEADGEMCKKPHASLSTFLGKKTL--AEPDRLIKGKDTFTV 117

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V   PGH+ G V      +     GDTLF  SIGRTD+  G + ++I SI  K+
Sbjct: 118 GNLTIEVIETPGHTKGCVTL--LVDGKLFTGDTLFAGSIGRTDLPGGSFDEIIRSIKEKL 175

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           L   DE     GHGP STIG E++ NPFL+
Sbjct: 176 LVFPDETPVFPGHGPESTIGDEKQYNPFLR 205


>gi|262393900|ref|YP_003285754.1| hydroxyacylglutathione hydrolase [Vibrio sp. Ex25]
 gi|262337494|gb|ACY51289.1| hydroxyacylglutathione hydrolase [Vibrio sp. Ex25]
          Length = 216

 Score =  173 bits (438), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 87/214 (40%), Positives = 132/214 (61%), Gaps = 2/214 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + +V VT F QNC+ ++ +E+++ +V+DPGGD   +  +I+     +  + +THGH+D
Sbjct: 1   MKYQVVPVTSFSQNCSIVWCDETMKGIVIDPGGDEKQLAMLIKELGIEIVNLVLTHGHLD 60

Query: 64  HVGGAAQLKEDLS-LTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLL 122
           HVGG   L   L  + IIGPHK D   +  ++ Q+++    +        +WL +GDT+ 
Sbjct: 61  HVGGTEPLAAMLGGIEIIGPHKADNFWLQGLEGQSQMFGFPL-TEAFEPHQWLNEGDTVT 119

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
            G  + KVFH PGH+PGHV+  + E   A +GD LF  SIGRTD   GD+  LI+SI  K
Sbjct: 120 FGNQVLKVFHTPGHTPGHVVLYSEEARLAFVGDVLFNGSIGRTDFPQGDFNTLISSIKEK 179

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           + PLG++++FV GHGP ST G ER+ NPF+   +
Sbjct: 180 LWPLGNDVTFVPGHGPQSTFGHERKTNPFVADEM 213


>gi|225872105|ref|YP_002753560.1| metallo-beta-lactamase family protein [Acidobacterium capsulatum
           ATCC 51196]
 gi|225791351|gb|ACO31441.1| metallo-beta-lactamase family protein [Acidobacterium capsulatum
           ATCC 51196]
          Length = 208

 Score =  173 bits (438), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 78/210 (37%), Positives = 115/210 (54%), Gaps = 2/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +      V   + NCT + DE S EA+V+DPG ++  I   +++    +KQI +TH H+D
Sbjct: 1   MILETFPVGMLQCNCTLIGDETSHEAMVIDPGDNIPQILARLKAHGLVLKQIVVTHAHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVGGA  LK      I+    D   +  K+ +             A  D   + G  + L
Sbjct: 61  HVGGALALKRATGAPILLNANDLPLL--KMMDVQAGWLGIEPPEVAPPDASAEHGMIVGL 118

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
             H  +V H PGH+PG +  +  ++N    GDTLF  SIGRTD+  GD +Q++ SI++++
Sbjct: 119 AAHPAEVLHTPGHTPGSICLLFKKDNLLLAGDTLFAGSIGRTDLPGGDSEQILRSIHDRL 178

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           LPL D++  V GHGP +TIG ER  NPFL+
Sbjct: 179 LPLPDDLRVVPGHGPVTTIGEERESNPFLR 208


>gi|88859302|ref|ZP_01133942.1| putative enzyme with metallo-hydrolase/oxidoreductase domain
           [Pseudoalteromonas tunicata D2]
 gi|88818319|gb|EAR28134.1| putative enzyme with metallo-hydrolase/oxidoreductase domain
           [Pseudoalteromonas tunicata D2]
          Length = 213

 Score =  173 bits (438), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 84/209 (40%), Positives = 119/209 (56%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +   I  VT F QNC+ L  E+S +AV++DPGGD   +  +   +   V +I +THGH+D
Sbjct: 1   MHVIIEPVTAFAQNCSLLICEQSAQAVMIDPGGDPQQLIALTTKQGCKVVKIILTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG A +L E   + IIGPH DD   +  + +QA++      A       WL     +  
Sbjct: 61  HVGAAKELAEYFQVDIIGPHHDDQFWLDALPQQAQMFGFNA-AEPFLPTSWLVHQQRVHF 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGHV+ ++ ++ F   GD LF+ SIGRTD   G+  QL++SI  ++
Sbjct: 120 GEQELEVRHCPGHTPGHVVLISHQDKFVIAGDVLFKGSIGRTDFPKGNQAQLVSSIKQQL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
             L D      GHGP +TIG E+R NPFL
Sbjct: 180 FDLPDGYVVYPGHGPITTIGDEKRHNPFL 208


>gi|319403832|emb|CBI77419.1| putative hydrolase [Bartonella rochalimae ATCC BAA-1498]
          Length = 214

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 116/214 (54%), Positives = 148/214 (69%), Gaps = 1/214 (0%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           MS  S +I+ VTPF+QNCT LFD ES   V+VDPGGD   I+  IQ +   V+ IWITHG
Sbjct: 1   MSDFSVYIIPVTPFQQNCTLLFDNESKRGVLVDPGGDWLKIQQAIQKKGVIVEAIWITHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DHVG A Q KE L + IIG H++D  +M  V E+A++     +AR    D+WL+DGD+
Sbjct: 61  HIDHVGAAMQAKEVLDIQIIGSHRNDKPVMDDVRERAKIYH-MPDARVCIPDQWLEDGDS 119

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           +    H+F+VFH PGHSPGHVIY N +  FA LGD LFR SIGRTD     +++L+ SI 
Sbjct: 120 VDCAGHVFQVFHTPGHSPGHVIYFNEKKRFALLGDVLFRGSIGRTDFPLCSHEELMRSIK 179

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
            K+LPLGD +SF+CGHGP S IG ER+ NPFL+ 
Sbjct: 180 EKVLPLGDNVSFICGHGPGSQIGYERQHNPFLQG 213


>gi|254230626|ref|ZP_04923978.1| Zn-dependent hydrolases, including glyoxylases [Vibrio sp. Ex25]
 gi|151936851|gb|EDN55757.1| Zn-dependent hydrolases, including glyoxylases [Vibrio sp. Ex25]
          Length = 218

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 87/214 (40%), Positives = 132/214 (61%), Gaps = 2/214 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + +V VT F QNC+ ++ +E+++ +V+DPGGD   +  +I+     +  + +THGH+D
Sbjct: 3   MKYQVVPVTSFSQNCSIVWCDETMKGIVIDPGGDEKQLAMLIKELGIEIVNLVLTHGHLD 62

Query: 64  HVGGAAQLKEDLS-LTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLL 122
           HVGG   L   L  + IIGPHK D   +  ++ Q+++    +        +WL +GDT+ 
Sbjct: 63  HVGGTEPLAAMLGGIEIIGPHKADNFWLQGLEGQSQMFGFPL-TEAFEPHQWLNEGDTVT 121

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
            G  + KVFH PGH+PGHV+  + E   A +GD LF  SIGRTD   GD+  LI+SI  K
Sbjct: 122 FGNQVLKVFHTPGHTPGHVVLYSEEARLAFVGDVLFNGSIGRTDFPQGDFNTLISSIKEK 181

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           + PLG++++FV GHGP ST G ER+ NPF+   +
Sbjct: 182 LWPLGNDVTFVPGHGPQSTFGHERKTNPFVADEM 215


>gi|229098733|ref|ZP_04229673.1| Metallo-beta-lactamase [Bacillus cereus Rock3-29]
 gi|228684812|gb|EEL38750.1| Metallo-beta-lactamase [Bacillus cereus Rock3-29]
          Length = 239

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 60/210 (28%), Positives = 109/210 (51%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + +  + + P + N   L +++  E ++ DPG + + +   +Q        + +TH H D
Sbjct: 31  MKWKQMPLGPLQTNAYILTNDQ-NECIIFDPGHEGEKLVTYLQEEQLKPLAVLLTHAHFD 89

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G    +++   + +    ++   +       +++  +  +     +D  +    TL +
Sbjct: 90  HIGAVDAVRDAFHIPVYVHKEEADWLGDGTVNGSQIFMMNRSITAKPADHIIDAEGTLTV 149

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G+  F++F  PGHSPG + Y + E N    GD LF+ SIGRTD+  G + +LI SI  K+
Sbjct: 150 GSFNFEIFETPGHSPGSISYYSKEANAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKL 209

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
             L DE + +CGHGP ++IG E+  NPFL+
Sbjct: 210 FVLPDETAVLCGHGPETSIGFEKENNPFLQ 239


>gi|49473984|ref|YP_032026.1| hypothetical protein BQ03400 [Bartonella quintana str. Toulouse]
 gi|49239487|emb|CAF25840.1| hypothetical protein BQ03400 [Bartonella quintana str. Toulouse]
          Length = 217

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 113/214 (52%), Positives = 144/214 (67%), Gaps = 1/214 (0%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M+ L  HI+ VTPF+QNCT LFD E    V+VDPGGD   I++VI+     V+ IWITHG
Sbjct: 1   MTNLRTHIIPVTPFQQNCTLLFDNEQKVGVLVDPGGDWFRIQEVIRKTGIIVEAIWITHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H DHVG A Q KE L++ IIG H+DD  +M  V E A+   I  +A     D+WL+DGD+
Sbjct: 61  HFDHVGAAMQAKEALNVKIIGSHRDDKPVMASVSESAKNYGI-TDACTCIPDQWLEDGDS 119

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           +    H+F V H PGHSPGHVIY N +  FA LGD LFR SIGRTD     +++L+ S+ 
Sbjct: 120 VHFVGHVFHVLHTPGHSPGHVIYFNEKERFALLGDVLFRGSIGRTDFPFCSHKELMKSLR 179

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
            KILPLGD++ F+CGHGP S +G ER+ NPFL+ 
Sbjct: 180 EKILPLGDDVRFICGHGPESQLGYERQWNPFLQG 213


>gi|322435146|ref|YP_004217358.1| beta-lactamase-like protein [Acidobacterium sp. MP5ACTX9]
 gi|321162873|gb|ADW68578.1| beta-lactamase-like protein [Acidobacterium sp. MP5ACTX9]
          Length = 209

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 80/211 (37%), Positives = 112/211 (53%), Gaps = 2/211 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +   I+ V P + NC+ L DE S EA+VVDPG D+  I  ++   N  VKQI ITH H+D
Sbjct: 1   MIHEILAVGPLRCNCSILGDEISREAIVVDPGDDISRIMALVAKHNLTVKQILITHAHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+ GA +LK      I+   +D    +  + +             A+ D+ L DG    +
Sbjct: 61  HIAGAQELKRLTGAPILYNQRDLP--LVAMMDVQAGWVGMKTPEVAAPDQDLADGYVFSI 118

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
                   H PGH+ G V     E      GDTLF+ SIGRTD+  GD + L+ S++NK+
Sbjct: 119 AGLNGIAHHTPGHTEGSVCLHLPEQTLLLAGDTLFQGSIGRTDLPGGDLKTLLRSVHNKL 178

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           L L DE   + GHG ++TIG ER  NPFL++
Sbjct: 179 LTLPDETLVIPGHGDSTTIGEERESNPFLQT 209


>gi|295695641|ref|YP_003588879.1| Hydroxyacylglutathione hydrolase [Bacillus tusciae DSM 2912]
 gi|295411243|gb|ADG05735.1| Hydroxyacylglutathione hydrolase [Bacillus tusciae DSM 2912]
          Length = 219

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 78/217 (35%), Positives = 106/217 (48%), Gaps = 9/217 (4%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +    + +     NC  +  E+   AVV+DPGG L+ I+D +Q +   V+ I +THGH D
Sbjct: 1   MRVERLVINEMGTNCYIVSGEDGG-AVVIDPGGPLEPIEDYLQKQGLVVRAILLTHGHAD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+ G   L+E     +   H+ DA M+            R      +  R L+DGD L +
Sbjct: 60  HLAGLEALRERTGAPVY-VHEADAEMLTDPARNLSAFMGRPVICRPADHR-LKDGDVLEV 117

Query: 124 GTHIFKVFHCPGHSPGHVIYV------NFENNFAHLGDTLFRSSIGRTDILHGDYQQLIN 177
           G  + KV H PGH+PG V                  GDTLF  SIGRTD   G Y+ L+ 
Sbjct: 118 GGLMVKVLHTPGHTPGGVCLDIAPQGAFIHPRVVFTGDTLFAGSIGRTDFPGGSYETLLA 177

Query: 178 SINNKILPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           SI   +LP  D+     GH  +STIG ERR NPFL+ 
Sbjct: 178 SIRRALLPYEDDTVIYPGHEEDSTIGDERRFNPFLQD 214


>gi|300087873|ref|YP_003758395.1| putative metallo-beta-lactamase family protein [Dehalogenimonas
           lykanthroporepellens BL-DC-9]
 gi|299527606|gb|ADJ26074.1| putative metallo-beta-lactamase family protein [Dehalogenimonas
           lykanthroporepellens BL-DC-9]
          Length = 212

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 72/209 (34%), Positives = 112/209 (53%), Gaps = 5/209 (2%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +    + V P + NC  + D  S E +V+DPGGD ++I + I++    +  I +THGH D
Sbjct: 1   MIIERLVVGPIQANCYLVGDPASREGLVIDPGGDGEVIVERIKALGLRIGHIVLTHGHFD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H   A  +K      +   H+DD  ++   D+    ++        + +  L+  + + +
Sbjct: 61  HTAAAEMVKSATGARL-AVHQDDLGLLN--DDFLPRMAGFRVEPLPAPEVVLRGWEDIAV 117

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   F + H PGHSPG +    +  +    GD+LF   IGRTD+  GDY  LI+S+N ++
Sbjct: 118 GALRFTILHLPGHSPGGIAL--YSQDAVFTGDSLFAGGIGRTDLPGGDYDTLIDSLNQRL 175

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           L L D+I    GHGP++TIG ERR NPFL
Sbjct: 176 LALDDDIKVYPGHGPDTTIGTERRGNPFL 204


>gi|328953986|ref|YP_004371320.1| beta-lactamase domain protein [Desulfobacca acetoxidans DSM 11109]
 gi|328454310|gb|AEB10139.1| beta-lactamase domain protein [Desulfobacca acetoxidans DSM 11109]
          Length = 207

 Score =  172 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 85/209 (40%), Positives = 112/209 (53%), Gaps = 2/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +   ++ V   + NC  L DE + EAVV+DPGGD   I  V+Q  N  +K I  THGH D
Sbjct: 1   MIQKVMSVGMLESNCYILGDELTREAVVIDPGGDGPDILAVLQQENLKLKIIINTHGHFD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG   +LKE     I   H  DA M+ +   +  L       R + +D  L++ D L  
Sbjct: 61  HVGANQELKEATGAPI-AIHTADADMLNQPSAE-ALFFTGGRLRPSQADILLKEDDILEF 118

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G +  KV H PGH+ G +  V       ++GDTLF  SIGRTD   G Y  LI S+  KI
Sbjct: 119 GEYQLKVLHTPGHTVGGICLVLQNEPIVYVGDTLFAGSIGRTDFPGGSYNDLIASVRTKI 178

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
            PLGD    + GHGP +T+G+ER+ NPF 
Sbjct: 179 FPLGDHYLVMPGHGPATTVGQERQYNPFF 207


>gi|329850773|ref|ZP_08265618.1| metallo-beta-lactamase superfamily protein [Asticcacaulis
           biprosthecum C19]
 gi|328841088|gb|EGF90659.1| metallo-beta-lactamase superfamily protein [Asticcacaulis
           biprosthecum C19]
          Length = 230

 Score =  172 bits (436), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 99/215 (46%), Positives = 140/215 (65%), Gaps = 2/215 (0%)

Query: 2   SKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGH 61
             +   I  VTP +QNCT ++  ++ +A ++DPGGDLD I + I++R   V++IWITHGH
Sbjct: 6   PPIRLFIAPVTPLQQNCTVVWCTKTNKAAIIDPGGDLDPILEEIKARGLTVEKIWITHGH 65

Query: 62  VDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
            DH GGAA+LKE   ++I GPH+DD   +  +    +   I    R+ ++DRWL+DGDT+
Sbjct: 66  ADHAGGAAELKERTGVSIEGPHEDDQFWIDNIPSMGQRYGIANM-RSFTTDRWLKDGDTV 124

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
            LG   + V HCPGH+PGHVI+ +  + FA +GD LF  SIGRTD   G++  LI+SI  
Sbjct: 125 TLGETTWDVIHCPGHTPGHVIFYHAPSQFAQVGDVLFAGSIGRTDFPRGNHADLIHSITQ 184

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           K+ PLGD + FV GHGP S+  +ER  NPF+   +
Sbjct: 185 KLWPLGD-VRFVPGHGPMSSFHQERLGNPFVGDRV 218


>gi|87200383|ref|YP_497640.1| beta-lactamase-like [Novosphingobium aromaticivorans DSM 12444]
 gi|87136064|gb|ABD26806.1| beta-lactamase-like protein [Novosphingobium aromaticivorans DSM
           12444]
          Length = 245

 Score =  172 bits (436), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 83/211 (39%), Positives = 129/211 (61%), Gaps = 2/211 (0%)

Query: 2   SKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGH 61
                 I+ VTP +QNCT ++  ++++   +D GGDL+ ++  ++     ++++ +THGH
Sbjct: 31  PPFRVAIIPVTPLEQNCTLVWCTKTMKGAFIDAGGDLEKLRKAVEKTGVTIEKLLVTHGH 90

Query: 62  VDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
           +DH G    L ++L + I GPH+ D   + ++DE  R   I          RWL DGD +
Sbjct: 91  IDHCGMTGILAKELGVPIEGPHEADRFWISRLDEDGRRWGI--TGEVFEPTRWLSDGDKV 148

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
            +G     V HCPGH+PGHV++    +  A +GD LF+ SIGRTD   G++Q LI+SI  
Sbjct: 149 TVGEVELDVIHCPGHTPGHVVFHYAPSRVAIVGDVLFQGSIGRTDFPMGNHQDLIDSITG 208

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           K+ PLG++++FV GHGPNST GRER+ N ++
Sbjct: 209 KLWPLGNDVTFVPGHGPNSTFGRERQTNAYV 239


>gi|302389919|ref|YP_003825740.1| beta-lactamase domain protein [Thermosediminibacter oceani DSM
           16646]
 gi|302200547|gb|ADL08117.1| beta-lactamase domain protein [Thermosediminibacter oceani DSM
           16646]
          Length = 206

 Score =  172 bits (436), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 77/210 (36%), Positives = 111/210 (52%), Gaps = 4/210 (1%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +    +QV P   NC  L DE   +A ++DPG + +II +V+    F V  I +THGH D
Sbjct: 1   MFVKRLQVGPLASNCYVLADEHCKKAAIIDPGANPEIILEVVNKEGFEVDYIILTHGHAD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G   ++K+     +   H+ DA M+   +E           + A +D  L+  + L +
Sbjct: 61  HIGAVREIKQSTGSKV-AIHEKDAKMLLSPEENLSSYMGCGFTQPA-ADVELRGDENLQI 118

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G  I +V   PGH+PG         N    GDTLF  S+GRTD   G Y++L+NSI  K+
Sbjct: 119 GDIILEVIWTPGHTPGS--ICVKAGNLLFTGDTLFAGSVGRTDFPGGSYRELLNSIKTKL 176

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           L   D++  + GHGP STIG ER  NPFL+
Sbjct: 177 LVFDDDVRVLPGHGPESTIGGERATNPFLR 206


>gi|153854671|ref|ZP_01995921.1| hypothetical protein DORLON_01919 [Dorea longicatena DSM 13814]
 gi|149752775|gb|EDM62706.1| hypothetical protein DORLON_01919 [Dorea longicatena DSM 13814]
          Length = 207

 Score =  172 bits (436), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 62/209 (29%), Positives = 101/209 (48%), Gaps = 2/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +      V     NC  + +EE+ + V+VDPG     +K+ ++ +   +K + +TH H D
Sbjct: 1   MKIEKYVVGMIGTNCYLVINEETKDTVMVDPGAYPAKLKNAVKEQGLKLKAVLLTHAHFD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+ G + + ED+ + +     D   MM      +            +    ++DG  L +
Sbjct: 61  HIMGLSDVMEDIKVPVYVEEADLPMMMDGESNLSSGYMRGGY--QFADAVPVRDGQQLQI 118

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
               F+V H PGH+PG   Y   + +    GDTLFR+S+GR+D   G    L+ S+  K+
Sbjct: 119 AGFQFRVIHTPGHTPGGCCYYMEQEDVLFSGDTLFRTSVGRSDFPGGSASALVRSVKEKL 178

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           L L +E     GH   +TIG E+R NPF+
Sbjct: 179 LILPEETHVYPGHMEETTIGYEKRHNPFV 207


>gi|254293478|ref|YP_003059501.1| beta-lactamase [Hirschia baltica ATCC 49814]
 gi|254042009|gb|ACT58804.1| beta-lactamase domain protein [Hirschia baltica ATCC 49814]
          Length = 234

 Score =  172 bits (436), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 95/214 (44%), Positives = 136/214 (63%), Gaps = 1/214 (0%)

Query: 3   KLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHV 62
                I+ VTP +QNC+ +FDEES EAV VDPGGD++ ++  ++     + QIW+THGH+
Sbjct: 18  PFKVQIIPVTPLQQNCSLIFDEESKEAVFVDPGGDVEQLEAALKHFGLKLTQIWLTHGHL 77

Query: 63  DHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLL 122
           DH G A  LKE  ++ I+GPHK+D  ++  ++ Q     I    RN  SD++L DGDTL 
Sbjct: 78  DHAGAAQSLKESWNVDIVGPHKEDQWLLDDIEAQGAKYGI-TTGRNTKSDKYLDDGDTLE 136

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
              H F V HCPGH+PGHV+  N     A +GD +F  SIGRTD   G++Q+L++SI  K
Sbjct: 137 FAGHTFGVVHCPGHTPGHVVIYNESAQLAFVGDVIFHGSIGRTDFPRGNHQELLDSITQK 196

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           + PLG ++ F+ GHG  ST G+ER  N ++  ++
Sbjct: 197 LWPLGKDMRFIPGHGQMSTFGQERLTNNYVADSV 230


>gi|315180001|gb|ADT86915.1| glyoxylase II family protein [Vibrio furnissii NCTC 11218]
          Length = 218

 Score =  172 bits (436), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 93/217 (42%), Positives = 134/217 (61%), Gaps = 3/217 (1%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           MS L + IV VTPF QNC+ ++ +E+++ +VVDPGGD+  +K +I     +V ++ +THG
Sbjct: 1   MS-LKYQIVPVTPFAQNCSIVWCDETMDGIVVDPGGDVKQLKMMIDELGVNVVKLVLTHG 59

Query: 61  HVDHVGGAAQLKEDLS-LTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGD 119
           H+DHVGG   L   L  + IIGPHKDD   +  ++ Q+++    +         WL +GD
Sbjct: 60  HLDHVGGTEPLAALLGGIDIIGPHKDDNFWLQGLEGQSQMFGFPL-TEAFEPTAWLDEGD 118

Query: 120 TLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSI 179
           T+  G     V H PGH+PGHV+  + E   A +GD LF  +IGRTD   GD+  LI SI
Sbjct: 119 TITFGHQTLNVLHTPGHTPGHVVLFSDEARLAFVGDVLFNGAIGRTDFPRGDFNTLITSI 178

Query: 180 NNKILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
             K+ PLG++++F+ GHGP ST GRER  NPF+   +
Sbjct: 179 KTKLWPLGNDVTFIPGHGPTSTFGRERASNPFVADEM 215


>gi|307293475|ref|ZP_07573319.1| beta-lactamase-like protein [Sphingobium chlorophenolicum L-1]
 gi|306879626|gb|EFN10843.1| beta-lactamase-like protein [Sphingobium chlorophenolicum L-1]
          Length = 237

 Score =  172 bits (436), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 87/215 (40%), Positives = 125/215 (58%), Gaps = 2/215 (0%)

Query: 2   SKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGH 61
             L   ++ VTP +QNCT  +   +     VDPGGDL ++K   +     +++I +THGH
Sbjct: 23  PPLKAALIPVTPLQQNCTLFWCTATNRGAFVDPGGDLPMLKKAAEQHGVTIEKILVTHGH 82

Query: 62  VDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
           +DH G A  L  DL + I GPH+ D   + ++ E      I  N  +   DRWL+DGD +
Sbjct: 83  IDHCGQAGMLARDLGVPIEGPHEADRFWIDRLGEDGTKYGI--NGESFEPDRWLKDGDQV 140

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
            +G     V+HCPGH+PGHV++ +  +  A +GD LF+ SIGRTD   G++Q LI++I  
Sbjct: 141 TVGNLTLDVYHCPGHTPGHVVFHHAPSKLAIVGDVLFQGSIGRTDFPMGNHQDLIDAITG 200

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           K+ PLG +  FV GHGP S    ERR NPF+   +
Sbjct: 201 KLWPLGGDTVFVPGHGPMSNFAHERRTNPFVGDAV 235


>gi|28898688|ref|NP_798293.1| glyoxylase II family protein [Vibrio parahaemolyticus RIMD 2210633]
 gi|153839463|ref|ZP_01992130.1| glyoxylase II family protein [Vibrio parahaemolyticus AQ3810]
 gi|260363713|ref|ZP_05776497.1| Zn-dependent hydrolase, glyoxalase II family [Vibrio
           parahaemolyticus K5030]
 gi|260879720|ref|ZP_05892075.1| Zn-dependent hydrolase, glyoxalase II family [Vibrio
           parahaemolyticus AN-5034]
 gi|260901619|ref|ZP_05910014.1| Zn-dependent hydrolase, glyoxalase II family [Vibrio
           parahaemolyticus AQ4037]
 gi|28806906|dbj|BAC60177.1| glyoxylase II family protein [Vibrio parahaemolyticus RIMD 2210633]
 gi|149747020|gb|EDM58008.1| glyoxylase II family protein [Vibrio parahaemolyticus AQ3810]
 gi|308093264|gb|EFO42959.1| Zn-dependent hydrolase, glyoxalase II family [Vibrio
           parahaemolyticus AN-5034]
 gi|308108674|gb|EFO46214.1| Zn-dependent hydrolase, glyoxalase II family [Vibrio
           parahaemolyticus AQ4037]
 gi|308113386|gb|EFO50926.1| Zn-dependent hydrolase, glyoxalase II family [Vibrio
           parahaemolyticus K5030]
 gi|328474747|gb|EGF45552.1| glyoxylase II family protein [Vibrio parahaemolyticus 10329]
          Length = 218

 Score =  172 bits (436), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 88/217 (40%), Positives = 132/217 (60%), Gaps = 3/217 (1%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M+ L + +V VT F QNC+ ++ +E+++ +VVDPGGD   +  +I+     V ++ +THG
Sbjct: 1   MA-LKYQVVPVTSFSQNCSIVWCDETMKGIVVDPGGDEKQLAMLIKELGVDVVKLVLTHG 59

Query: 61  HVDHVGGAAQLKEDLSLT-IIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGD 119
           H+DHVGG   L   L  T I+GPHK D   +  ++ Q+++    +       ++WL +GD
Sbjct: 60  HLDHVGGTEPLSALLGGTEIVGPHKADNFWLQGLEGQSKMFGFPL-TEAFEPNQWLNEGD 118

Query: 120 TLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSI 179
            +  G     V H PGH+PGHV+  + E   A +GD LF  SIGRTD   GD+  LI+SI
Sbjct: 119 VVTFGNQKLNVIHTPGHTPGHVVLYSEEARLAFVGDVLFNGSIGRTDFPQGDFNTLISSI 178

Query: 180 NNKILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
             K+ PLG++++FV GHGP ST G ER+ NPF+   +
Sbjct: 179 KEKLWPLGNDVTFVPGHGPQSTFGHERKTNPFVADEM 215


>gi|300023989|ref|YP_003756600.1| beta-lactamase [Hyphomicrobium denitrificans ATCC 51888]
 gi|299525810|gb|ADJ24279.1| beta-lactamase domain protein [Hyphomicrobium denitrificans ATCC
           51888]
          Length = 220

 Score =  172 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 105/211 (49%), Positives = 143/211 (67%), Gaps = 1/211 (0%)

Query: 2   SKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGH 61
           S L   IV+VTPF+QNCT +++E S    VVDPGGDLD I   I      +++I +THGH
Sbjct: 10  SPLKAAIVRVTPFEQNCTLIWNEASKRGAVVDPGGDLDRIFRGIDEAEIEIEKILLTHGH 69

Query: 62  VDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
           +DH G AA+L+++L + I GPHK DA ++  +++Q  +  I  + RN   DRWL DGD +
Sbjct: 70  IDHAGAAAELRQELGVKIEGPHKADALLLDNLEKQGEMYGI-PDVRNVKPDRWLDDGDVV 128

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
            +  H F +FHCPGHSPG V++ +    FA +GD LFR SIGRTD  +GD+  LI++I  
Sbjct: 129 TVAGHTFNIFHCPGHSPGSVVFFDAAQRFALVGDVLFRGSIGRTDFPYGDHDALISAIKT 188

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           K+LPLGD+I+F+CGHGP    G+ER  NPFL
Sbjct: 189 KLLPLGDDIAFICGHGPPGQFGQERLTNPFL 219


>gi|240116904|ref|ZP_04730966.1| putative hydrolase [Neisseria gonorrhoeae PID1]
 gi|268602580|ref|ZP_06136747.1| glyoxalase II family protein [Neisseria gonorrhoeae PID1]
 gi|268586711|gb|EEZ51387.1| glyoxalase II family protein [Neisseria gonorrhoeae PID1]
          Length = 210

 Score =  172 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 81/209 (38%), Positives = 129/209 (61%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L + I  VTPF+QNCT ++D+ES EAV+ D GGD+  +   + +R   +  IW+THGH+D
Sbjct: 3   LRYEIFPVTPFRQNCTLIWDDESGEAVLTDVGGDVPFLLQALANRKLTLTAIWLTHGHLD 62

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GG  ++ +  ++ ++GPH++D  ++  +  Q         +   + +RWL++G+TL +
Sbjct: 63  HAGGVVEMLKTRNVPVLGPHREDEFLLQSLP-QTTAQYGFPVSPAFAPNRWLEEGETLTV 121

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G + F+V H PGH+PGH+++   E      GD LF  +IGRTD   G++  LIN+I NK+
Sbjct: 122 GRYAFQVLHIPGHTPGHIVFYCAEAELLIAGDVLFYETIGRTDFPRGNHADLINNIRNKL 181

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
             L + +  V GHG  ++IG E+R NPF 
Sbjct: 182 FALPETVQVVAGHGRMTSIGHEKRHNPFF 210


>gi|319760549|ref|YP_004124487.1| metallo-beta-lactamase superfamily protein [Candidatus Blochmannia
           vafer str. BVAF]
 gi|318039263|gb|ADV33813.1| metallo-beta-lactamase superfamily protein [Candidatus Blochmannia
           vafer str. BVAF]
          Length = 211

 Score =  172 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 97/210 (46%), Positives = 142/210 (67%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + +H++ VT F QNC+ ++ E++ +A+VVDPGG+ + +  VI + N  + +I +THGH+D
Sbjct: 1   MKYHVIPVTSFNQNCSIVWCEQTHDAIVVDPGGEKEKLFRVIDNLNVRINKIVLTHGHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIR-MNARNASSDRWLQDGDTLL 122
           HVG A  LK+  ++ I GPHKDD  +M  +  Q ++L I+       S D WL+DGD + 
Sbjct: 61  HVGHAVDLKKYYNVPIWGPHKDDEFLMNDLTLQCQILKIKEYCNCAVSPDFWLKDGDIIE 120

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
           +G  +FKV HCPGHSPGHV++ N    F  +GD LF+ ++GR+D+  G Y  LINSI NK
Sbjct: 121 VGYEVFKVLHCPGHSPGHVVFWNESCKFIIMGDVLFKKNVGRSDLPGGSYVTLINSIKNK 180

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           +L L D+I+F+ GHGP S+IG ER+ N FL
Sbjct: 181 LLVLEDDINFLPGHGPISSIGYERKNNTFL 210


>gi|229086831|ref|ZP_04218993.1| Metallo-beta-lactamase [Bacillus cereus Rock3-44]
 gi|228696475|gb|EEL49298.1| Metallo-beta-lactamase [Bacillus cereus Rock3-44]
          Length = 209

 Score =  172 bits (435), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 60/210 (28%), Positives = 109/210 (51%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + +  + + P + N   L +++  E ++ DPG + + +   +Q        + +TH H D
Sbjct: 1   MKWIQMPLGPLQTNAYILSNDQ-KECIIFDPGSEGEKLVTYLQEEQLKPLAVLLTHAHFD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G    +++   + +    ++   +       +++  +  +     +D+ ++   TL +
Sbjct: 60  HIGAVDTVRDAFHIPVYVHKEEADWLGDANVNGSQIFMMNRSITAKQADQIIEGEGTLTI 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G+  F++F  PGHSPG V Y   E +    GD LF+ SIGRTD+  G + +LI SI  K+
Sbjct: 120 GSFTFEMFETPGHSPGSVSYYCKEASAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
             L DE + +CGHGP + IG E+  NPFL+
Sbjct: 180 FALPDETAVLCGHGPETNIGFEKENNPFLQ 209


>gi|94968928|ref|YP_590976.1| beta-lactamase-like [Candidatus Koribacter versatilis Ellin345]
 gi|94550978|gb|ABF40902.1| beta-lactamase-like protein [Candidatus Koribacter versatilis
           Ellin345]
          Length = 209

 Score =  171 bits (434), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 74/211 (35%), Positives = 115/211 (54%), Gaps = 2/211 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +   I  V P + NC+ + DE + EA+V+DPG +++++  +++     V QI +TH H+D
Sbjct: 1   MIHEIFPVGPLQCNCSVIGDETTHEAIVIDPGDEVEVVVAILEKHQLRVTQIVVTHAHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVGGA +LK      ++    DD  +  K+ +         +      D  L DGD++  
Sbjct: 61  HVGGAMKLKALTGAPLLLNENDDQLL--KLLDVQASWLGMKDPGKVVVDESLADGDSVKF 118

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           GT    V H PGH+ G +  +         GDTLF+ SIGRTD+  G Y++++ SI+ K+
Sbjct: 119 GTIEGSVIHTPGHTQGSICLLLKSEKTLIAGDTLFQGSIGRTDLPGGSYEKIMKSIHGKL 178

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           L L  E   + GHGP++TI  ER  NPFL+ 
Sbjct: 179 LVLPGETIVIPGHGPSTTIEEERERNPFLRG 209


>gi|108803964|ref|YP_643901.1| beta-lactamase-like protein [Rubrobacter xylanophilus DSM 9941]
 gi|108765207|gb|ABG04089.1| beta-lactamase-like protein [Rubrobacter xylanophilus DSM 9941]
          Length = 214

 Score =  171 bits (434), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 67/212 (31%), Positives = 109/212 (51%), Gaps = 2/212 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +    + V  F++NC  L DE S    +VDPG +   I   ++     +++I +TH H+D
Sbjct: 1   MILQKLTVGTFQENCYILGDEASGSGALVDPGDEAVRIALAVEQTGLEIEKILLTHAHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG  A L E+    ++  H++   ++ ++  Q  L+      +    D +++D + + +
Sbjct: 61  HVGAVASLVEEYGCPVLA-HRESEPLLEQLPTQ-ALMMGLRFGKVPRLDGYIEDRERVEV 118

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +  + PGH+PGH+ +          GD LF  S+GRTD+  GD   L+ SI  ++
Sbjct: 119 GGLTLEALYTPGHAPGHLAFYLESEGALLSGDALFAGSVGRTDLPGGDAGLLMRSIKERM 178

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSN 215
           L L DE     GHGP +TIG ER  NPFL+  
Sbjct: 179 LVLPDETVVHPGHGPQTTIGNERAYNPFLQQG 210


>gi|254671207|emb|CBA08383.1| glyoxalase II family protein [Neisseria meningitidis alpha153]
          Length = 210

 Score =  171 bits (434), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 81/209 (38%), Positives = 127/209 (60%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L + I  VTPF+QNCT ++D+ES EAV+ D GGD+  +   + +R   +  IW+THGH+D
Sbjct: 3   LRYEIFPVTPFRQNCTLIWDDESGEAVLTDVGGDVPFLLQALANRKLTLTAIWLTHGHLD 62

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GG  ++ +   + ++G H++D  ++  +  Q         +   + +RWL++G+TL +
Sbjct: 63  HAGGVVEMLKTHKVPVLGSHREDEFLLQSLP-QTTAQYGFPVSPAFAPNRWLEEGETLKV 121

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G + F+V H PGH+PGHV++   E      GD LF  +IGRTD   G++  LIN+I NK+
Sbjct: 122 GRYAFQVLHIPGHTPGHVVFYCAEAELLIAGDVLFYETIGRTDFPRGNHADLINNIRNKL 181

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
             L + +  V GHG  ++IG E+R NPF 
Sbjct: 182 FALPETVQVVAGHGRMTSIGHEKRHNPFF 210


>gi|95929446|ref|ZP_01312189.1| beta-lactamase-like [Desulfuromonas acetoxidans DSM 684]
 gi|95134562|gb|EAT16218.1| beta-lactamase-like [Desulfuromonas acetoxidans DSM 684]
          Length = 209

 Score =  171 bits (434), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 76/212 (35%), Positives = 114/212 (53%), Gaps = 4/212 (1%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +    + V P + NC  +    + +A+V+DPG + D I +VI      VK +  THGH D
Sbjct: 1   MLVETLAVGPLQVNCYLVACPRTKQALVIDPGDEGDRILEVIDKLGLKVKMVVNTHGHFD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG   Q+     + +   H+DD  ++    +QA    +    ++    R+L++GD + +
Sbjct: 61  HVGANHQILAVTGVELCM-HRDDLPLLKVAAKQAEGYGL-PAVQSPDPKRFLENGDLVEV 118

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   F+V H PGHSPG      +       GDTLF SSIGRTD+  GD  QL++ I +++
Sbjct: 119 GDLSFEVIHTPGHSPGG--ICLYGEGHLFSGDTLFASSIGRTDLPGGDMNQLLSHIRSQL 176

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSN 215
           + L D      GHGP STIGRE+ +NPFL  +
Sbjct: 177 MVLPDATVVHPGHGPESTIGREKTVNPFLNGD 208


>gi|260768293|ref|ZP_05877227.1| hydroxyacylglutathione hydrolase [Vibrio furnissii CIP 102972]
 gi|260616323|gb|EEX41508.1| hydroxyacylglutathione hydrolase [Vibrio furnissii CIP 102972]
          Length = 218

 Score =  171 bits (434), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 92/217 (42%), Positives = 134/217 (61%), Gaps = 3/217 (1%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           MS L + IV VTPF QNC+ ++ +E+++ +VVDPGGD+  +K ++     +V ++ +THG
Sbjct: 1   MS-LKYQIVPVTPFAQNCSIVWCDETMDGIVVDPGGDVKQLKMMVDELGVNVVKLVLTHG 59

Query: 61  HVDHVGGAAQLKEDLS-LTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGD 119
           H+DHVGG   L   L  + IIGPHKDD   +  ++ Q+++    +         WL +GD
Sbjct: 60  HLDHVGGTEPLAALLGGIDIIGPHKDDNFWLQGLEGQSQMFGFPL-TEAFEPTAWLDEGD 118

Query: 120 TLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSI 179
           T+  G     V H PGH+PGHV+  + E   A +GD LF  +IGRTD   GD+  LI SI
Sbjct: 119 TITFGHQTLNVLHTPGHTPGHVVLFSDEARLAFVGDVLFNGAIGRTDFPRGDFNTLITSI 178

Query: 180 NNKILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
             K+ PLG++++F+ GHGP ST GRER  NPF+   +
Sbjct: 179 KTKLWPLGNDVTFIPGHGPTSTFGRERASNPFVADEM 215


>gi|169831066|ref|YP_001717048.1| beta-lactamase domain-containing protein [Candidatus Desulforudis
           audaxviator MP104C]
 gi|169637910|gb|ACA59416.1| beta-lactamase domain protein [Candidatus Desulforudis audaxviator
           MP104C]
          Length = 213

 Score =  171 bits (434), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 63/212 (29%), Positives = 100/212 (47%), Gaps = 3/212 (1%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M +L    + V   + NC  L    + EA+V+DPG + ++I   +      +K + +THG
Sbjct: 1   MRRLILDTLVVGALQTNCYILGCPNTREALVIDPGAEAELIGSTLDKHGLKLKTVVLTHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H DH+G   +L+ +  +T+   H++DA ++                 +A+          
Sbjct: 61  HADHIGACGELRREPGVTL-AIHREDAPLLSDTHRNLTAYIGPPLTLSAAETLLGDGDRV 119

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
                    V H PGH+            F   GDTLF  ++GRTD   GD++ LI S+ 
Sbjct: 120 EFGAGIQLTVLHTPGHT--RGSICLLGEGFLFSGDTLFAGAVGRTDFPGGDFKTLIASLK 177

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           N++ PL D+     GHGP ST+G E+R NP+L
Sbjct: 178 NRLEPLPDDTRVYPGHGPASTMGVEKRENPYL 209


>gi|229025725|ref|ZP_04182129.1| Metallo-beta-lactamase [Bacillus cereus AH1272]
 gi|228735600|gb|EEL86191.1| Metallo-beta-lactamase [Bacillus cereus AH1272]
          Length = 239

 Score =  171 bits (434), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 60/210 (28%), Positives = 108/210 (51%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + +  + + P + N   L + +  E ++ DPG + + +   +Q        + +TH H D
Sbjct: 31  MKWTQMPLGPLQTNAYILTNNQ-NECIIFDPGHEGEKLVTYLQEAQLKPLAVLLTHAHFD 89

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G    +++   + +    ++   +       +++  +  +     +D+ +    TL +
Sbjct: 90  HIGAVDAVRDAFRIPVYVHKEEADWLGDATVNGSQIFMMNRSITAKPADQIIDAEGTLTI 149

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G+  F++F  PGHSPG + Y   E N    GD LF+ SIGRTD+  G + +LI SI  K+
Sbjct: 150 GSFNFEIFETPGHSPGSISYYCKEANAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKL 209

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
             L DE + +CGHGP ++IG E+  NPFL+
Sbjct: 210 FVLPDETAVLCGHGPETSIGFEKENNPFLQ 239


>gi|326386993|ref|ZP_08208603.1| beta-lactamase-like protein [Novosphingobium nitrogenifigens DSM
           19370]
 gi|326208174|gb|EGD58981.1| beta-lactamase-like protein [Novosphingobium nitrogenifigens DSM
           19370]
          Length = 211

 Score =  171 bits (434), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 89/208 (42%), Positives = 132/208 (63%), Gaps = 2/208 (0%)

Query: 8   IVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
           I+ VTP +QNCT ++  +++    +D GGDL +++  I      V+++ +THGH+DH GG
Sbjct: 3   IIPVTPLQQNCTLVWCTKTMRGAFIDVGGDLPLLRQAIAKTGVTVEKLLVTHGHIDHCGG 62

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
            A    +L + I GP + D   + K+DE      I         DRWL DGDT+ +G  +
Sbjct: 63  TAAFARELGVPIEGPEEADRFWIAKLDEDGPRYGIT--GEVFEPDRWLHDGDTVTIGECV 120

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLG 187
             V HCPGH+PGHV++ +  + FA +GD LF+ SIGRTD   G++QQLI+SI  K+ PLG
Sbjct: 121 LDVLHCPGHTPGHVVFYHAPSRFAIVGDVLFQGSIGRTDFPLGNHQQLIDSITQKLWPLG 180

Query: 188 DEISFVCGHGPNSTIGRERRLNPFLKSN 215
           ++++FV GHGP ST GRER+ NP++  +
Sbjct: 181 NDVTFVPGHGPVSTFGRERQSNPYVADS 208


>gi|89895195|ref|YP_518682.1| hypothetical protein DSY2449 [Desulfitobacterium hafniense Y51]
 gi|219669625|ref|YP_002460060.1| beta-lactamase [Desulfitobacterium hafniense DCB-2]
 gi|89334643|dbj|BAE84238.1| hypothetical protein [Desulfitobacterium hafniense Y51]
 gi|219539885|gb|ACL21624.1| beta-lactamase domain protein [Desulfitobacterium hafniense DCB-2]
          Length = 205

 Score =  171 bits (433), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 70/208 (33%), Positives = 101/208 (48%), Gaps = 4/208 (1%)

Query: 6   FHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHV 65
                V     NC  +   E+ +A ++DPG +   I++ +  R   V+ I +THGH DH+
Sbjct: 2   IECRAVGAMGANCYLVSCPETKKAALIDPGANGPGIQEWVDERGVQVEYILLTHGHFDHI 61

Query: 66  GGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGT 125
           G   +L+E     + G HK+DA M+         +  R      +    L+DG  L +G 
Sbjct: 62  GAVDKLRELYQAKV-GIHKEDAVMLTSGAHNLSRMLGRSYEFKPADF-LLEDGQILQVGN 119

Query: 126 HIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILP 185
               V   PGH+          +     GDTLF  SIGRTD   G Y +LI S+  K+L 
Sbjct: 120 LNLTVIATPGHT--LGGVCFLTSEGLLSGDTLFDGSIGRTDFPGGSYDELIKSVVKKLLV 177

Query: 186 LGDEISFVCGHGPNSTIGRERRLNPFLK 213
           L ++     GHGP +TIGRE+R NPFL+
Sbjct: 178 LPEDTKVYPGHGPETTIGREKRENPFLQ 205


>gi|163782029|ref|ZP_02177028.1| hypothetical protein HG1285_17889 [Hydrogenivirga sp. 128-5-R1-1]
 gi|159882561|gb|EDP76066.1| hypothetical protein HG1285_17889 [Hydrogenivirga sp. 128-5-R1-1]
          Length = 212

 Score =  171 bits (433), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 67/211 (31%), Positives = 111/211 (52%), Gaps = 4/211 (1%)

Query: 6   FHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHV 65
             ++ V P   NC+ + D+ + +AV++DPG D + I +V +   F V  I  THGH+DHV
Sbjct: 5   IEVIPVGPLAVNCSVVADDNTGKAVIIDPGADAERIIEVARE--FEVVGIVNTHGHIDHV 62

Query: 66  GGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGT 125
           G   ++KE   +     H++D  ++   +  +   +          D +L+DG  + +G 
Sbjct: 63  GQVKRVKEFFDVP-FYLHREDVYLIKD-EIWSGFSAYINAEPCPEPDEFLEDGIEIEVGD 120

Query: 126 HIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILP 185
              +V H PGH+PG   +   E +    GD LF+ S+GRTD+  GD +++  S+      
Sbjct: 121 LKMRVLHTPGHTPGLCCFYIEEESVLIAGDLLFKGSVGRTDLPGGDPEKMRRSLERVFTE 180

Query: 186 LGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           L DE   +CGH   +TIG ER+ NP+L+  +
Sbjct: 181 LPDETLVICGHYEETTIGHERKFNPYLRGGL 211


>gi|229075966|ref|ZP_04208942.1| Metallo-beta-lactamase [Bacillus cereus Rock4-18]
 gi|229104891|ref|ZP_04235550.1| Metallo-beta-lactamase [Bacillus cereus Rock3-28]
 gi|229117758|ref|ZP_04247127.1| Metallo-beta-lactamase [Bacillus cereus Rock1-3]
 gi|228665735|gb|EEL21208.1| Metallo-beta-lactamase [Bacillus cereus Rock1-3]
 gi|228678521|gb|EEL32739.1| Metallo-beta-lactamase [Bacillus cereus Rock3-28]
 gi|228707281|gb|EEL59478.1| Metallo-beta-lactamase [Bacillus cereus Rock4-18]
          Length = 239

 Score =  171 bits (433), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 60/210 (28%), Positives = 109/210 (51%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + +  + + P + N   L +++  E ++ DPG + + +   +Q        + +TH H D
Sbjct: 31  MKWTQMPLGPLQTNAYILTNDQ-NECIIFDPGHEGEKLVTYLQEEQLKPLAVLLTHAHFD 89

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G    +++   + +    ++   +       +++  +  +     +D  +    TL +
Sbjct: 90  HIGAVDAVRDAFHIPVYVHKEEADWLGDGTVNGSQIFMMNRSITAKPADHIIDAEGTLTV 149

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G+  F++F  PGHSPG + Y + E N    GD LF+ SIGRTD+  G + +LI SI  K+
Sbjct: 150 GSFNFEIFETPGHSPGSISYYSKEANAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKL 209

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
             L DE + +CGHGP ++IG E+  NPFL+
Sbjct: 210 FVLPDETAVLCGHGPETSIGFEKENNPFLQ 239


>gi|121635707|ref|YP_975952.1| putative hydrolase [Neisseria meningitidis FAM18]
 gi|120867413|emb|CAM11185.1| putative hydrolase [Neisseria meningitidis FAM18]
 gi|316983936|gb|EFV62915.1| metallo-beta-lactamase superfamily protein [Neisseria meningitidis
           H44/76]
 gi|325131292|gb|EGC54003.1| metallo-beta-lactamase domain protein [Neisseria meningitidis
           M6190]
 gi|325139372|gb|EGC61912.1| metallo-beta-lactamase domain protein [Neisseria meningitidis
           CU385]
          Length = 221

 Score =  171 bits (433), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 82/209 (39%), Positives = 127/209 (60%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L + I  VTPF+QNCT ++D+ES EAV+ D GGD+  +   + +R   +  IW+THGH+D
Sbjct: 14  LRYEIFPVTPFRQNCTLIWDDESGEAVLTDVGGDVPFLLQALANRKLTLTAIWLTHGHLD 73

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GG  ++ +   + ++GPH DD  ++  +  Q         +   + +RWL++G+TL +
Sbjct: 74  HAGGVVEMLKTHKVPVLGPHPDDEFLLQSLP-QTTAQYGFPVSPAFAPNRWLEEGETLTV 132

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G + F+V H PGH+PGH+++   E      GD LF  +IGRTD   G++  LIN+I NK+
Sbjct: 133 GRYAFQVLHIPGHTPGHIVFYCAEAELLIAGDVLFYETIGRTDFPRGNHADLINNIRNKL 192

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
             L + +  V GHG  ++IG E+R NPF 
Sbjct: 193 FTLPETVQVVAGHGRMTSIGHEKRHNPFF 221


>gi|319651536|ref|ZP_08005664.1| YqgX protein [Bacillus sp. 2_A_57_CT2]
 gi|317396851|gb|EFV77561.1| YqgX protein [Bacillus sp. 2_A_57_CT2]
          Length = 211

 Score =  171 bits (433), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 63/211 (29%), Positives = 108/211 (51%), Gaps = 1/211 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + ++ + + P + NC  L   E+ + ++ DPG +   +  +I+ +      + +TH H D
Sbjct: 1   MEWNQIPLGPLQTNCYVL-SNETKDCLIFDPGEESGKLSGIIEQKGLKPLAVILTHAHFD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G   ++++  S+ +    K+ A +       + L  I    +   +D  +     L +
Sbjct: 60  HIGAVDEIRDAFSIPVYIHEKEAAWLPDPALNGSHLFKIGKLIKARPADHIITGEQELSI 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    K+   PGHSPG +     + +    GD LF  SIGRTD+  G++QQL+ SI+NK+
Sbjct: 120 GEFNLKILETPGHSPGSISLYFEDADLVVAGDALFSGSIGRTDLPGGNHQQLLESIHNKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           L L +E   + GHGP +TIG+E   NPFL  
Sbjct: 180 LTLPEETEVLPGHGPVTTIGQEMDSNPFLNG 210


>gi|153835592|ref|ZP_01988259.1| glyoxylase II family protein [Vibrio harveyi HY01]
 gi|156974986|ref|YP_001445893.1| hypothetical protein VIBHAR_02708 [Vibrio harveyi ATCC BAA-1116]
 gi|269961713|ref|ZP_06176074.1| glyoxylase II family protein [Vibrio harveyi 1DA3]
 gi|148867809|gb|EDL67049.1| glyoxylase II family protein [Vibrio harveyi HY01]
 gi|156526580|gb|ABU71666.1| hypothetical protein VIBHAR_02708 [Vibrio harveyi ATCC BAA-1116]
 gi|269833578|gb|EEZ87676.1| glyoxylase II family protein [Vibrio harveyi 1DA3]
          Length = 218

 Score =  171 bits (433), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 87/217 (40%), Positives = 130/217 (59%), Gaps = 3/217 (1%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M+ L + +V VT F QNC+ ++ +E+++ +VVDPGGD   +  +I+     V  + +THG
Sbjct: 1   MA-LKYQVVPVTSFSQNCSIVWCDETMKGIVVDPGGDEKQLAMLIKELGVEVVNLVLTHG 59

Query: 61  HVDHVGGAAQLKEDLSLT-IIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGD 119
           H+DHVGG   L   L  T I+GPHK D   +  ++ Q+++    +        +WL +GD
Sbjct: 60  HLDHVGGTEPLSALLGGTEIVGPHKADNFWLQGLEGQSQMFGFPL-TEAFEPHQWLNEGD 118

Query: 120 TLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSI 179
            +  G     V H PGH+PGHV+  + E   A +GD LF  S+GRTD   GD+  LI+SI
Sbjct: 119 KVTFGNQTLNVIHTPGHTPGHVVLYSEEARLAFVGDVLFNGSVGRTDFPQGDFNTLISSI 178

Query: 180 NNKILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
             K+ PLG++++FV GHGP ST G ER+ NPF+   +
Sbjct: 179 KEKLWPLGNDVTFVPGHGPQSTFGHERKTNPFVADEM 215


>gi|319781905|ref|YP_004141381.1| hydrolase [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317167793|gb|ADV11331.1| hydrolase [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 212

 Score =  171 bits (433), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 112/212 (52%), Positives = 146/212 (68%), Gaps = 1/212 (0%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M +L+  IV VTPF+QNCT LFD +    VVVDPGGD+D +  V++        IWITHG
Sbjct: 1   MGQLNAGIVPVTPFQQNCTILFDMDDKHGVVVDPGGDIDKVLAVLKDNAISAGAIWITHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DH GGA +LKE L + IIGPH+ D +++  ++ Q +   I   ARN   DR+L +G+T
Sbjct: 61  HIDHAGGAMELKEALGVEIIGPHEADKSLLDNLENQGKRYGI-AGARNCVPDRFLAEGET 119

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           +  G H+F+V HCPGH+PGHV+Y N    FAH+GD LFR S+GRTD+  GD+  LI SI 
Sbjct: 120 VSFGGHVFEVLHCPGHAPGHVVYYNGAAKFAHVGDVLFRGSVGRTDLPGGDHAALIASIK 179

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           +K+LPLGD+I F+CGHGP    G ERR NPFL
Sbjct: 180 DKLLPLGDDIGFICGHGPGGRFGEERRTNPFL 211


>gi|91227206|ref|ZP_01261665.1| glyoxylase II family protein [Vibrio alginolyticus 12G01]
 gi|91188734|gb|EAS75022.1| glyoxylase II family protein [Vibrio alginolyticus 12G01]
          Length = 218

 Score =  171 bits (433), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 89/214 (41%), Positives = 131/214 (61%), Gaps = 2/214 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L + +V VT F QNC+ ++ +E+++ +VVDPGGD   +  +I+     V  + +THGH+D
Sbjct: 3   LKYQVVPVTSFSQNCSIVWCDETMKGIVVDPGGDEKQLAMLIKELGVDVVNLVLTHGHLD 62

Query: 64  HVGGAAQLKEDLSLT-IIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLL 122
           HVGG   L   L  T I+GPHK D   +  ++ Q+++    +        +WL +GDT+ 
Sbjct: 63  HVGGTEPLSALLGGTEIVGPHKADNFWLQGLEGQSQMFGFPL-TEAFEPHQWLNEGDTVT 121

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
            G  +  VFH PGH+PGHV+  + E   A +GD LF  SIGRTD   GD+  LI+SI  K
Sbjct: 122 FGNQVLNVFHTPGHTPGHVVLYSEEARLAFVGDVLFNGSIGRTDFPQGDFNTLISSIKEK 181

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           + PLG++++FV GHGP ST G ER+ NPF+   +
Sbjct: 182 LWPLGNDVTFVPGHGPQSTFGHERKTNPFVADEM 215


>gi|15677871|ref|NP_275039.1| glyoxalase II family protein [Neisseria meningitidis MC58]
 gi|254804141|ref|YP_003082362.1| putative Zn-dependent hydrolase [Neisseria meningitidis alpha14]
 gi|7227311|gb|AAF42369.1| glyoxalase II family protein [Neisseria meningitidis MC58]
 gi|254667683|emb|CBA03530.1| putative Zn-dependent hydrolase [Neisseria meningitidis alpha14]
 gi|261393373|emb|CAX51009.1| putative metallo-dependent hydrolase [Neisseria meningitidis 8013]
 gi|308390148|gb|ADO32468.1| glyoxalase II family protein [Neisseria meningitidis alpha710]
 gi|325127327|gb|EGC50262.1| metallo-beta-lactamase domain protein [Neisseria meningitidis
           N1568]
 gi|325137321|gb|EGC59909.1| metallo-beta-lactamase domain protein [Neisseria meningitidis
           ES14902]
 gi|325141408|gb|EGC63887.1| metallo-beta-lactamase domain protein [Neisseria meningitidis
           961-5945]
 gi|325199140|gb|ADY94596.1| metallo-beta-lactamase domain protein [Neisseria meningitidis
           G2136]
 gi|325201097|gb|ADY96552.1| metallo-beta-lactamase domain protein [Neisseria meningitidis
           H44/76]
 gi|325204998|gb|ADZ00452.1| metallo-beta-lactamase domain protein [Neisseria meningitidis
           M01-240355]
          Length = 210

 Score =  171 bits (433), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 82/209 (39%), Positives = 127/209 (60%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L + I  VTPF+QNCT ++D+ES EAV+ D GGD+  +   + +R   +  IW+THGH+D
Sbjct: 3   LRYEIFPVTPFRQNCTLIWDDESGEAVLTDVGGDVPFLLQALANRKLTLTAIWLTHGHLD 62

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GG  ++ +   + ++GPH DD  ++  +  Q         +   + +RWL++G+TL +
Sbjct: 63  HAGGVVEMLKTHKVPVLGPHPDDEFLLQSLP-QTTAQYGFPVSPAFAPNRWLEEGETLTV 121

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G + F+V H PGH+PGH+++   E      GD LF  +IGRTD   G++  LIN+I NK+
Sbjct: 122 GRYAFQVLHIPGHTPGHIVFYCAEAELLIAGDVLFYETIGRTDFPRGNHADLINNIRNKL 181

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
             L + +  V GHG  ++IG E+R NPF 
Sbjct: 182 FTLPETVQVVAGHGRMTSIGHEKRHNPFF 210


>gi|198274750|ref|ZP_03207282.1| hypothetical protein BACPLE_00909 [Bacteroides plebeius DSM 17135]
 gi|198272197|gb|EDY96466.1| hypothetical protein BACPLE_00909 [Bacteroides plebeius DSM 17135]
          Length = 213

 Score =  171 bits (433), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 66/214 (30%), Positives = 105/214 (49%), Gaps = 5/214 (2%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGG----DLDIIKDVIQSRNFHVKQIWITH 59
           +     +   F  NC  ++DEE+L+A V+D G     +   +K  I      V  +  TH
Sbjct: 1   MKIKTFEFNMFPVNCYVVWDEETLQAAVIDAGCYYQEEQQTLKKFIAENGLTVTHLLNTH 60

Query: 60  GHVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGD 119
            H+DH+ G A +  +  ++     K+D  ++ +  E  R+    +N    +   ++ DGD
Sbjct: 61  LHLDHIFGNAFMLREFGVSAEAG-KEDEFLLPRTAEYCRMFGFPLNEEPPALGSYVHDGD 119

Query: 120 TLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSI 179
            + +G    K    PGHSPG +++     +    GD LFR SIGR D+  G++ QL  SI
Sbjct: 120 LIKIGNIELKALAVPGHSPGSMVFYCEAQHCMFSGDVLFRGSIGRADLEGGNFDQLRESI 179

Query: 180 NNKILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
             ++L L DE     GHG  +TIG E+  NPF +
Sbjct: 180 VARLLTLPDETMVYPGHGNPTTIGYEKMNNPFFR 213


>gi|269967087|ref|ZP_06181155.1| glyoxylase II family protein [Vibrio alginolyticus 40B]
 gi|269828346|gb|EEZ82612.1| glyoxylase II family protein [Vibrio alginolyticus 40B]
          Length = 218

 Score =  171 bits (433), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 90/217 (41%), Positives = 132/217 (60%), Gaps = 3/217 (1%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M+ L + +V VT F QNC+ ++ +E+++ +VVDPGGD   +  +I+     V  + +THG
Sbjct: 1   MA-LKYQVVPVTSFSQNCSIVWCDETMKGIVVDPGGDEKQLAMLIKELGVDVVNLVLTHG 59

Query: 61  HVDHVGGAAQLKEDLSLT-IIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGD 119
           H+DHVGG   L   L  T I+GPHK D   +  ++ Q+++    +        +WL +GD
Sbjct: 60  HLDHVGGTEPLSALLGGTEIVGPHKADNFWLQGLEGQSQMFGFPL-TEAFEPHQWLSEGD 118

Query: 120 TLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSI 179
           T+  G  +  VFH PGH+PGHV+  + E   A +GD LF  SIGRTD   GD+  LI+SI
Sbjct: 119 TVTFGNQVLNVFHTPGHTPGHVVLYSEEARLAFVGDVLFNGSIGRTDFPQGDFNTLISSI 178

Query: 180 NNKILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
             K+ PLG +++FV GHGP ST G ER+ NPF+   +
Sbjct: 179 KEKLWPLGSDVTFVPGHGPQSTFGHERKTNPFVADEM 215


>gi|298369756|ref|ZP_06981073.1| metallo-beta-lactamase domain protein [Neisseria sp. oral taxon 014
           str. F0314]
 gi|298282313|gb|EFI23801.1| metallo-beta-lactamase domain protein [Neisseria sp. oral taxon 014
           str. F0314]
          Length = 210

 Score =  171 bits (432), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 85/209 (40%), Positives = 127/209 (60%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L F I+ VTPF+QNCT L+D+E+ EAV+ D GGD+  + + + +R   VK+IW+THGH+D
Sbjct: 3   LQFEILAVTPFRQNCTLLWDDETREAVLTDMGGDVLFVLNEVAARRLDVKEIWLTHGHLD 62

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GG  +      + ++GPH+DD  ++  + +        + +      RWL++GD L +
Sbjct: 63  HAGGVVEFLSHKDVPVVGPHRDDEFLLDSLPDITAQYGFPV-SPPFKPTRWLEEGDVLNV 121

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G + F V H PGH+PG V++   +      GD LF  SIGRTD   G++  LI++I  K+
Sbjct: 122 GRYRFDVLHIPGHTPGQVVFYCAQAGLLVAGDVLFYESIGRTDFPRGNHADLIDNIRRKL 181

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           L L D+   + GHG  +TIG E+R NPFL
Sbjct: 182 LVLPDDTQVIAGHGRMTTIGHEKRHNPFL 210


>gi|161869143|ref|YP_001598309.1| hydrolase [Neisseria meningitidis 053442]
 gi|161594696|gb|ABX72356.1| hydrolase [Neisseria meningitidis 053442]
          Length = 210

 Score =  171 bits (432), Expect = 8e-41,   Method: Composition-based stats.
 Identities = 82/209 (39%), Positives = 126/209 (60%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L + I  VTPF+QNCT ++D+ES EAV+ D GGD+  +   + +R   +  IW+THGH+D
Sbjct: 3   LRYEIFPVTPFRQNCTLIWDDESGEAVLTDVGGDVPFLLQALANRKLTLTAIWLTHGHLD 62

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GG  ++ +   + ++GPH DD  ++  +  Q         +   + + WL++G+TL +
Sbjct: 63  HAGGVVEMLKTHKVPVLGPHPDDEFLLQSLP-QTTAQYGFPVSPAFAPNHWLEEGETLKV 121

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G + F+V H PGH+PGHV++   E      GD LF  +IGRTD   G++  LIN+I NK+
Sbjct: 122 GRYAFQVLHIPGHTPGHVVFYCAEAELLIAGDVLFYETIGRTDFPRGNHADLINNIRNKL 181

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
             L + +  V GHG  ++IG E+R NPF 
Sbjct: 182 FALPETVQVVAGHGRMTSIGHEKRHNPFF 210


>gi|240126613|ref|ZP_04739499.1| putative hydrolase [Neisseria gonorrhoeae SK-92-679]
 gi|268685193|ref|ZP_06152055.1| hydrolase [Neisseria gonorrhoeae SK-92-679]
 gi|268625477|gb|EEZ57877.1| hydrolase [Neisseria gonorrhoeae SK-92-679]
          Length = 210

 Score =  171 bits (432), Expect = 9e-41,   Method: Composition-based stats.
 Identities = 81/209 (38%), Positives = 128/209 (61%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L + I  VTPF+QNCT ++D+ES EAV+ D GGD+  +   + +R   +  IW+THGH+D
Sbjct: 3   LRYEIFPVTPFRQNCTLIWDDESGEAVLTDVGGDVPFLLQALANRKLTLTAIWLTHGHLD 62

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GG  ++ +  ++ ++GPH++D  ++  +  Q         +   + +RWL++G+TL +
Sbjct: 63  HAGGVVEMLKTRNVPVLGPHREDEFLLQSLP-QTTAQYGFPVSPAFAPNRWLEEGETLTV 121

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G + F+V H PGH+PGHV++   E      GD LF  +IGRTD   G++  LIN+I NK+
Sbjct: 122 GRYAFQVLHIPGHTPGHVVFYCAEAELLIAGDVLFYETIGRTDFPRGNHADLINNIRNKL 181

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
               + +  V GHG  ++IG E+R NPF 
Sbjct: 182 FAFPETVQVVAGHGRMTSIGHEKRHNPFF 210


>gi|294013221|ref|YP_003546681.1| beta-lactamase-like protein [Sphingobium japonicum UT26S]
 gi|292676551|dbj|BAI98069.1| beta-lactamase-like protein [Sphingobium japonicum UT26S]
          Length = 218

 Score =  171 bits (432), Expect = 9e-41,   Method: Composition-based stats.
 Identities = 86/215 (40%), Positives = 126/215 (58%), Gaps = 2/215 (0%)

Query: 2   SKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGH 61
             L   ++ VTP +QNCT  +   +     VDPGGDL +++   +     +++I +THGH
Sbjct: 4   PPLKAALIPVTPLQQNCTLFWCTATNRGAFVDPGGDLPLLRKAAEQHGVTIEKILVTHGH 63

Query: 62  VDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
           +DH G A  L  DL + I GPH+ D   + ++ E      I  N  +   DRWL+DGD +
Sbjct: 64  IDHCGQAGILARDLGVPIEGPHEADRFWIDRLGEDGARYGI--NGESFEPDRWLKDGDQV 121

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
            +G     V+HCPGH+PGHV++ +  +  A +GD LF+ SIGRTD   G++Q LI++I  
Sbjct: 122 TVGNLTLDVYHCPGHTPGHVVFHHAPSKLAIVGDVLFQGSIGRTDFPMGNHQDLIDAITG 181

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           K+ PLG + +FV GHGP S    ERR NPF+   +
Sbjct: 182 KLWPLGGDTAFVPGHGPMSNFAHERRTNPFVGDAV 216


>gi|167629915|ref|YP_001680414.1| metallo-beta-lactamase family protein, putative [Heliobacterium
           modesticaldum Ice1]
 gi|167592655|gb|ABZ84403.1| metallo-beta-lactamase family protein, putative [Heliobacterium
           modesticaldum Ice1]
          Length = 208

 Score =  170 bits (431), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 70/210 (33%), Positives = 104/210 (49%), Gaps = 5/210 (2%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           ++    +      NC  +   E+ EA ++DPGGD +++    +     +  I  THGH D
Sbjct: 1   MNIRRWEAGMLAANCYLVQCPETGEAALIDPGGDGEMLLRRAEEAKAKIVAIINTHGHSD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+     +K+    TI+    + A+++     +   L I  +  +  +DR L+DGD L +
Sbjct: 61  HIAANGDIKKATGATILCHEAEAASIIS--PGKNLSLYIGASITSPPADRLLKDGDVLTI 118

Query: 124 -GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
             T   +V H PGH+                GDTLF  SIGRTD+  G Y Q+++SI  K
Sbjct: 119 GRTVRLEVLHTPGHT--VGGICLRGQGVVFTGDTLFHGSIGRTDLPGGSYNQILHSIREK 176

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           +L L D+     GHGP STIG ER  NPFL
Sbjct: 177 LLALPDDTVVYPGHGPESTIGFERVNNPFL 206


>gi|33519877|ref|NP_878709.1| hypothetical protein Bfl423 [Candidatus Blochmannia floridanus]
 gi|33504222|emb|CAD83485.1| Zn-dependent hydrolase [Candidatus Blochmannia floridanus]
          Length = 211

 Score =  170 bits (431), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 90/210 (42%), Positives = 130/210 (61%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + +HI+ VT F QNC+ ++ E++  A+VVDPGG+ + I   I      V +I +THGH+D
Sbjct: 1   MQYHIIPVTSFNQNCSIIWCEQTKNAIVVDPGGEKEKIYKAIDLLKVVVNKIVLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMN-ARNASSDRWLQDGDTLL 122
           HVG A ++K    + I GP++ D  ++  +  Q ++L+++         D WL+DGD + 
Sbjct: 61  HVGDAMEIKRYYGVPIFGPNEQDRFLLNDLYLQCQILNVKPMLHITVKPDFWLKDGDQIQ 120

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
           +G   F V HCPGHSPGHV+  N    F  +GD LF+  IGR+D+  GDY  L++SI  K
Sbjct: 121 VGYEKFNVLHCPGHSPGHVVLWNKLQKFIIMGDVLFKKHIGRSDLPGGDYTVLMHSIRTK 180

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           +L L D+I F+ GHGP STIG ER  N FL
Sbjct: 181 LLSLSDDIVFLPGHGPISTIGYERSNNVFL 210


>gi|260752745|ref|YP_003225638.1| beta-lactamase [Zymomonas mobilis subsp. mobilis NCIMB 11163]
 gi|258552108|gb|ACV75054.1| beta-lactamase domain protein [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
          Length = 227

 Score =  170 bits (431), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 93/214 (43%), Positives = 133/214 (62%), Gaps = 2/214 (0%)

Query: 3   KLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHV 62
            L   ++ VTP +QNC+ L+  E+++  +VDPGGD+ +I D I  +   V++I ITHGH 
Sbjct: 11  PLEATVIPVTPLRQNCSLLYCVETMKGAIVDPGGDIPLILDSITKKQVTVEKILITHGHF 70

Query: 63  DHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLL 122
           DH GGAA L + L   IIGPH DD   + ++ E A+         + + D+WL+D D + 
Sbjct: 71  DHCGGAAALSQILGCPIIGPHPDDQFWIDQIPENAQQYGF--EGESFTPDQWLKDKDEIT 128

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
           +G     V HCPGH+PGHV++ N  ++ A +GD LFR+SIGR+D   GD+Q LI SI  K
Sbjct: 129 VGEERLLVRHCPGHTPGHVVFYNAASHLAIVGDVLFRNSIGRSDFAGGDHQALIQSITEK 188

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           + P+G E  F+ GHG  ST G ER  NPF+  ++
Sbjct: 189 LWPMGRETVFIPGHGRPSTFGAERDHNPFVADSV 222


>gi|261400817|ref|ZP_05986942.1| metallo-beta-lactamase domain protein [Neisseria lactamica ATCC
           23970]
 gi|269209427|gb|EEZ75882.1| metallo-beta-lactamase domain protein [Neisseria lactamica ATCC
           23970]
          Length = 210

 Score =  170 bits (431), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 81/209 (38%), Positives = 128/209 (61%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L + I+ VTPF+QNCT ++D+ES EAV+ D GGD+  +   + +R   +  IW+THGH+D
Sbjct: 3   LRYEILPVTPFRQNCTLIWDDESGEAVLTDVGGDVPFLLQALANRKLTLTAIWLTHGHLD 62

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GG  ++ +   + ++GPH++D  ++  +  Q         +   +  RWL++G+TL +
Sbjct: 63  HAGGVVEMLKTHKVPVLGPHREDEFLLQSLP-QTTAQYGFPASPAFAPTRWLEEGETLTV 121

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G + F+V H PGH+PGH+++   E      GD LF  +IGRTD   G++  LIN+I NK+
Sbjct: 122 GRYAFQVLHIPGHTPGHIVFYCAEAELLIAGDVLFYETIGRTDFPRGNHADLINNIRNKL 181

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
             L + +  V GHG  ++IG E+R NPF 
Sbjct: 182 FALPETVQVVAGHGRMTSIGHEKRHNPFF 210


>gi|319408900|emb|CBI82557.1| putative enzyme [Bartonella schoenbuchensis R1]
          Length = 214

 Score =  170 bits (431), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 111/214 (51%), Positives = 144/214 (67%), Gaps = 1/214 (0%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           MS LS HI+ VT F+QNCT LFD +S + V+VDPGGD   I+  IQ  +  ++ IWITHG
Sbjct: 1   MSNLSAHIIPVTSFQQNCTLLFDSKSKKGVLVDPGGDWPKIQATIQEISVSIEAIWITHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           HVDHVG A Q KE+L++ IIG H+ D  +M  V E+A++     + R    D+WL+DGD+
Sbjct: 61  HVDHVGAAMQAKEELNVKIIGSHRGDKPIMEDVIERAKVYR-MADVRICVPDQWLEDGDS 119

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           L    H+F V H PGH+PGHVIY N +   A +GD LFR SIGRTD     ++ L+ SI 
Sbjct: 120 LDCAGHVFDVLHIPGHTPGHVIYFNKKERLALVGDVLFRGSIGRTDFPLSSHEALMTSIK 179

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
            K+LPLGD++SF+ GHG  STIG ERR N FL+ 
Sbjct: 180 EKVLPLGDDVSFISGHGSGSTIGYERRFNSFLQG 213


>gi|150390119|ref|YP_001320168.1| beta-lactamase domain-containing protein [Alkaliphilus
           metalliredigens QYMF]
 gi|149949981|gb|ABR48509.1| beta-lactamase domain protein [Alkaliphilus metalliredigens QYMF]
          Length = 206

 Score =  170 bits (431), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 76/210 (36%), Positives = 111/210 (52%), Gaps = 4/210 (1%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +    +    F  NC  + D+E+ +A VVDPGGD D I ++I+   F +  I +THGH D
Sbjct: 1   MFLEKIAAGVFGVNCYVISDDETGKAAVVDPGGDADKILELIKDNQFELTHILLTHGHGD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G   +L E     +   H+DD  ++   +               +   +L+DG+ L +
Sbjct: 61  HIGAVNELHEKTKAPVY-VHEDDLYILKDANINYSARMGGPVVTIDTD-VFLKDGEVLTI 118

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V H PGHSP               GDTLF +SIGR+D+  G+Y QLI SI +K+
Sbjct: 119 GNLKLHVLHTPGHSP--GGVCIRGEGVVFTGDTLFANSIGRSDLEGGNYDQLIASIQSKL 176

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           + L DE++ + GHGP STIG ER  NP++K
Sbjct: 177 MTLDDELTVLPGHGPASTIGIERMTNPYIK 206


>gi|228916895|ref|ZP_04080457.1| Metallo-beta-lactamase [Bacillus thuringiensis serovar pulsiensis
           BGSC 4CC1]
 gi|228929306|ref|ZP_04092331.1| Metallo-beta-lactamase [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|228830320|gb|EEM75932.1| Metallo-beta-lactamase [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|228842719|gb|EEM87805.1| Metallo-beta-lactamase [Bacillus thuringiensis serovar pulsiensis
           BGSC 4CC1]
          Length = 239

 Score =  170 bits (431), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 60/210 (28%), Positives = 109/210 (51%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + +  + + P + N   L +++  E V+ DPG + + +   +Q        + +TH H D
Sbjct: 31  MKWIQMPLGPLQTNAYILKNDK-NECVIFDPGHEGEKLVTYLQEEQLKPLAVLLTHAHFD 89

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G    +++   + +    +++  +       +++  +  +     +D  +    TL +
Sbjct: 90  HIGAVDAVRDAFHIPVYVHKEEEDWLGDATVNGSQIFMMNRSITAKPADHIIDAEGTLAI 149

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G+  F++F  PGHSPG + Y   E +    GD LF+ SIGRTD+  G + +LI SI  K+
Sbjct: 150 GSFNFEIFETPGHSPGSISYYCKEASAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKL 209

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
             L DE + +CGHGP ++IG E+  NPFL+
Sbjct: 210 FVLPDETAVLCGHGPETSIGFEKENNPFLQ 239


>gi|152976694|ref|YP_001376211.1| beta-lactamase domain-containing protein [Bacillus cereus subsp.
           cytotoxis NVH 391-98]
 gi|152025446|gb|ABS23216.1| beta-lactamase domain protein [Bacillus cytotoxicus NVH 391-98]
          Length = 209

 Score =  170 bits (431), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 61/210 (29%), Positives = 105/210 (50%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + +  + + P + N   L +++  E V+ DPG + + +   +Q        I +TH H D
Sbjct: 1   MKWIQMPLGPLQTNAYILSNDQ-KECVIFDPGSEGEKLVTYLQQEGLKPLAILLTHAHFD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G    ++E   + +    ++   +       +++  +  +     +D  +    TL +
Sbjct: 60  HIGAVDAVREAFRIPVYVHKEEAEWLGDPAVNGSQIFMMNRSITAKPADYRIDGEGTLTI 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   F++F  PGHSPG + Y   E N    GD LF+ SIGRTD+  G   +L+ SI  K+
Sbjct: 120 GPFTFEMFETPGHSPGSISYYCKEVNAVFSGDVLFQMSIGRTDLPGGSLTELMGSIEEKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
             L D+ + +CGHGP + IG E+  NPFL+
Sbjct: 180 FMLPDDTTVLCGHGPETNIGFEKENNPFLQ 209


>gi|56551673|ref|YP_162512.1| beta-lactamase domain-containing protein [Zymomonas mobilis subsp.
           mobilis ZM4]
 gi|241761206|ref|ZP_04759294.1| beta-lactamase domain protein [Zymomonas mobilis subsp. mobilis
           ATCC 10988]
 gi|56543247|gb|AAV89401.1| beta-lactamase domain protein [Zymomonas mobilis subsp. mobilis
           ZM4]
 gi|241374113|gb|EER63610.1| beta-lactamase domain protein [Zymomonas mobilis subsp. mobilis
           ATCC 10988]
          Length = 227

 Score =  170 bits (431), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 94/214 (43%), Positives = 133/214 (62%), Gaps = 2/214 (0%)

Query: 3   KLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHV 62
            L   ++ VTP +QNC+ L+  E+++  +VDPGGD+ +I D I  +   V++I ITHGH 
Sbjct: 11  PLEATVIPVTPLRQNCSLLYCVETMKGAIVDPGGDIPLILDSITKKQVTVEKILITHGHF 70

Query: 63  DHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLL 122
           DH GGAA L + L   IIGPH DD   + ++ E A+         + + D+WL+D D + 
Sbjct: 71  DHCGGAAALSQILGCPIIGPHPDDQFWIDQIPENAQQYGF--EGESFTPDQWLKDKDEIT 128

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
           LG     V HCPGH+PGHV++ N  ++ A +GD LFR+SIGR+D   GD+Q LI SI  K
Sbjct: 129 LGEERLLVRHCPGHTPGHVVFYNAASHLAIVGDVLFRNSIGRSDFAGGDHQALIQSITEK 188

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           + P+G E  F+ GHG  ST G ER  NPF+  ++
Sbjct: 189 LWPMGRETVFIPGHGRPSTFGAERDHNPFVADSV 222


>gi|124265285|ref|YP_001019289.1| putative metallo-beta-lactamase family protein [Methylibium
           petroleiphilum PM1]
 gi|124258060|gb|ABM93054.1| putative metallo-beta-lactamase family protein [Methylibium
           petroleiphilum PM1]
          Length = 215

 Score =  170 bits (431), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 87/214 (40%), Positives = 131/214 (61%), Gaps = 4/214 (1%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L +  V VT F+QNC+ ++ + +  A V+DPGG+L  ++  ++     ++ IW+TH H+D
Sbjct: 2   LQYLTVPVTAFQQNCSIVWCDATRRAAVIDPGGELPRLRAEVRRLGLTLEAIWLTHAHID 61

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDG---DT 120
           H GG AQL  + +L IIGPH  D   +  + +Q+R+      +   +  RWL  G   D 
Sbjct: 62  HAGGTAQLAREDALPIIGPHAADQFWIDGLAQQSRMFGF-PPSEPFTPTRWLCPGGVDDR 120

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           + LG    +V HCPGH+PGHV++V+ E   A +GD LF   IGRTD   GD+  L+ +I 
Sbjct: 121 VTLGDCELEVRHCPGHTPGHVVFVSREAQRAFVGDVLFAGGIGRTDFPLGDHDTLVAAIR 180

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
            ++ PLGD+I F+ GHGP S+ GRERR NP+++ 
Sbjct: 181 TQLWPLGDDIVFIPGHGPESSFGRERRHNPYVRD 214


>gi|118479436|ref|YP_896587.1| metallo-beta-lactamase family protein [Bacillus thuringiensis str.
           Al Hakam]
 gi|118418661|gb|ABK87080.1| metallo-beta-lactamase family protein [Bacillus thuringiensis str.
           Al Hakam]
          Length = 239

 Score =  170 bits (431), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 61/210 (29%), Positives = 108/210 (51%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + +  + + P + N   L +++  E V+ DPG + + +   +Q        + +TH H D
Sbjct: 31  MKWIQMPLGPLQTNAYILKNDQ-NECVIFDPGHEGEKLVTYLQEEQLKPLAVLLTHAHFD 89

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G    ++E   + +    +++  +       +++  +  +     +D  +     L +
Sbjct: 90  HIGAVDAVREAFHIPVYVHKEEEDWLGDATVNGSQIFMMNRSITAKPADHIIDAEGKLAI 149

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G+  F++F  PGHSPG + Y   E N    GD LF+ SIGRTD+  G + +LI SI  K+
Sbjct: 150 GSFNFEIFETPGHSPGSISYYCKEANAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKL 209

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
             L DE + +CGHGP ++IG E+  NPFL+
Sbjct: 210 FVLPDETAVLCGHGPETSIGFEKENNPFLQ 239


>gi|309379267|emb|CBX22040.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 210

 Score =  170 bits (431), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 82/209 (39%), Positives = 128/209 (61%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L + I  VTPF+QNCT ++D+ES +AV+ D GGD+  +   + +R   +  IW+THGH+D
Sbjct: 3   LRYEIFPVTPFRQNCTLIWDDESGKAVLTDVGGDVPFLLQALANRKLTLTAIWLTHGHLD 62

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GG  ++ +   + I+GPH++D  ++  +  Q         +   S +RWL++G+TL +
Sbjct: 63  HAGGVVEMLKTHKVPILGPHREDEFLLQSLP-QTTAQYGFPVSPAFSPNRWLEEGETLAV 121

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G + F+V H PGH+PGH+++   E      GD LF  +IGRTD   G++  LIN+I NK+
Sbjct: 122 GRYAFQVLHIPGHTPGHIVFYCAEAELLIAGDVLFYETIGRTDFPRGNHADLINNIRNKL 181

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
             L + +  V GHG  ++IG E+R NPF 
Sbjct: 182 FTLPETVQVVAGHGRMTSIGHEKRHNPFF 210


>gi|260467120|ref|ZP_05813299.1| beta-lactamase domain protein [Mesorhizobium opportunistum WSM2075]
 gi|259029132|gb|EEW30429.1| beta-lactamase domain protein [Mesorhizobium opportunistum WSM2075]
          Length = 212

 Score =  170 bits (431), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 111/212 (52%), Positives = 142/212 (66%), Gaps = 1/212 (0%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M +L+  IV VTPF+QNCT LFD +    VVVDPGGD+D +  V++        IWITHG
Sbjct: 1   MGQLNAGIVPVTPFQQNCTILFDMDDKRGVVVDPGGDIDKVLAVLKDNAITAGAIWITHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DH GGA  LKE L + IIGPH  D  ++  +  Q R   I   +R+   DR+L +G+T
Sbjct: 61  HIDHAGGAMDLKEALGIEIIGPHAADKPLLDNLANQGRRYGI-DGSRDCVPDRFLTEGET 119

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           +  G H+F+V HCPGH+PGHV+Y N    FAH+GD LFR S+GRTD+  GD+  LI SI 
Sbjct: 120 VSFGGHVFEVLHCPGHAPGHVVYYNRAAKFAHVGDVLFRGSVGRTDLPGGDHATLIASIK 179

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           +K+LPLGD+I F+CGHGP    G ERR NPFL
Sbjct: 180 DKLLPLGDDIGFICGHGPGGRFGEERRTNPFL 211


>gi|228947975|ref|ZP_04110261.1| Metallo-beta-lactamase [Bacillus thuringiensis serovar monterrey
           BGSC 4AJ1]
 gi|228811665|gb|EEM58000.1| Metallo-beta-lactamase [Bacillus thuringiensis serovar monterrey
           BGSC 4AJ1]
          Length = 239

 Score =  170 bits (431), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 60/210 (28%), Positives = 109/210 (51%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + +  + + P + N   L +++  E V+ DPG + + +   +Q        + +TH H D
Sbjct: 31  MKWIQMPLGPLQTNAYILKNDK-NECVIFDPGHEGEKLVTYLQEEQLKPLAVLLTHAHFD 89

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G    +++   + +    +++  +       +++  +  +     +D  +    TL +
Sbjct: 90  HIGAVDAVRDAFHIPVYVHKEEEDWLGDATVNGSQIFMMNRSITAKPADHIIDAEGTLAI 149

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G+  F++F  PGHSPG + Y   E +    GD LF+ SIGRTD+  G + +LI SI  K+
Sbjct: 150 GSFNFEIFETPGHSPGSISYYCKEASALFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKL 209

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
             L DE + +CGHGP ++IG E+  NPFL+
Sbjct: 210 FVLPDETAVLCGHGPETSIGFEKENNPFLQ 239


>gi|229157873|ref|ZP_04285948.1| Metallo-beta-lactamase [Bacillus cereus ATCC 4342]
 gi|228625830|gb|EEK82582.1| Metallo-beta-lactamase [Bacillus cereus ATCC 4342]
          Length = 239

 Score =  170 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 59/210 (28%), Positives = 109/210 (51%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + +  + + P + N   L +++  E ++ DPG + + +   +Q        + +TH H D
Sbjct: 31  MKWIQMPLGPLQTNAYILTNDQ-NECIIFDPGHEGEKLVTYLQEEQLKPLAVLLTHAHFD 89

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G    +++   + +    +++  +       +++  +  +     +D  +    TL +
Sbjct: 90  HIGAVDAVRDAFHIPVYVHKEEEDWLGDATVNGSQIFMMNRSITAKPADHIIDAEGTLAI 149

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G+  F++F  PGHSPG + Y   E +    GD LF+ SIGRTD+  G + +LI SI  K+
Sbjct: 150 GSFNFEIFETPGHSPGSISYYCKEASAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKL 209

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
             L DE + +CGHGP ++IG E+  NPFL+
Sbjct: 210 FVLPDETAVLCGHGPETSIGFEKENNPFLQ 239


>gi|163942020|ref|YP_001646904.1| beta-lactamase domain-containing protein [Bacillus
           weihenstephanensis KBAB4]
 gi|229135085|ref|ZP_04263888.1| Metallo-beta-lactamase [Bacillus cereus BDRD-ST196]
 gi|163864217|gb|ABY45276.1| beta-lactamase domain protein [Bacillus weihenstephanensis KBAB4]
 gi|228648373|gb|EEL04405.1| Metallo-beta-lactamase [Bacillus cereus BDRD-ST196]
          Length = 209

 Score =  170 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 59/210 (28%), Positives = 109/210 (51%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + +  + + P + N   L +++  E ++ DPG + + +   +Q        + +TH H D
Sbjct: 1   MKWIQMPLGPLQTNAYILTNDQ-NECIIFDPGHEGEKLVTYLQEAQLKPLAVLLTHAHFD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G    +++   + +    ++   +       +++  +  +     +D  + +  TL +
Sbjct: 60  HIGAVDAVRDAFHIPVYVHKEEANWLGDATVNGSQIFMMNRSITAKPADHIIDEEGTLTI 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
            +  F++F  PGHSPG + Y + E N    GD LF+ SIGRTD+  G + +LI SI  K+
Sbjct: 120 SSFSFEIFETPGHSPGSISYYSKEANAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
             L DE + +CGHGP ++IG E+  NPFL+
Sbjct: 180 FVLPDETAVLCGHGPETSIGFEKENNPFLQ 209


>gi|291561449|emb|CBL40248.1| Zn-dependent hydrolases, including glyoxylases [butyrate-producing
           bacterium SS3/4]
          Length = 214

 Score =  170 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 62/210 (29%), Positives = 94/210 (44%), Gaps = 2/210 (0%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           MS++    + V     NC  ++D E+  A V+DPG     I ++  S     + I +THG
Sbjct: 1   MSEIRIKTLVVGMVGTNCYLVYDHETKRAAVIDPGDGAGQIANMAVSLGLKPEAILLTHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H DH+  A +LKE  ++ I    K+   +                      D  +++GD 
Sbjct: 61  HFDHIMAAKELKETWNVPIYACEKEIDVLTDGRKSLVAGYFREPYTIT--PDVTVKEGDE 118

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           L +    +KVF  PGH+ G   Y   +      GDTLF  S GRTD   G  +Q+  S+ 
Sbjct: 119 LSIAGFTWKVFETPGHTIGSCCYYIEKEEVLFSGDTLFAGSYGRTDFPTGSGRQIAESVR 178

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNP 210
             +  L D+     GH   +TIG E++ NP
Sbjct: 179 RLLSTLPDDTMVYPGHMDTTTIGFEKKYNP 208


>gi|240127248|ref|ZP_04739909.1| putative hydrolase [Neisseria gonorrhoeae SK-93-1035]
 gi|268685609|ref|ZP_06152471.1| hydrolase [Neisseria gonorrhoeae SK-93-1035]
 gi|268625893|gb|EEZ58293.1| hydrolase [Neisseria gonorrhoeae SK-93-1035]
          Length = 210

 Score =  170 bits (430), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 82/209 (39%), Positives = 127/209 (60%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L + I  VTPF+QNCT ++D+ES EAV+ D GGD+  +   + +R   +  IW+THGH+D
Sbjct: 3   LRYEIFPVTPFRQNCTLIWDDESGEAVLTDVGGDVPFLLQALANRKLTLTAIWLTHGHLD 62

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GG  ++ E   + ++GPH++D  ++  +  Q         +   + +RWL++G+TL +
Sbjct: 63  HAGGVVEMLETHKVPVLGPHREDEFLLQSLP-QTTAQYGFPVSPAFAPNRWLEEGETLTV 121

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G + F+V H PGH+PGHV++   E      GD LF  +IGRTD   G++  LIN+I NK+
Sbjct: 122 GRYAFQVLHIPGHTPGHVVFYCAEAELLIAGDVLFYETIGRTDFPRGNHADLINNIRNKL 181

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
               + +  V GHG  ++IG E+R NPF 
Sbjct: 182 FAFPETVQVVAGHGRMTSIGHEKRHNPFF 210


>gi|319638918|ref|ZP_07993676.1| glyoxalase II family protein [Neisseria mucosa C102]
 gi|317399822|gb|EFV80485.1| glyoxalase II family protein [Neisseria mucosa C102]
          Length = 212

 Score =  170 bits (430), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 86/209 (41%), Positives = 130/209 (62%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L F I  VTPF+QNCT ++D+E+ EAV+ D GGD+  +   +Q++   +  IW+THGH+D
Sbjct: 3   LQFEINAVTPFRQNCTLIWDDETKEAVLTDVGGDVPYLLQQVQNKGLRLTAIWLTHGHLD 62

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GG  +L +   + ++GPHKDD  ++  +  Q         + + +  RWL++G+TL +
Sbjct: 63  HAGGVVELLKTCDVPVLGPHKDDEFLLQALP-QTTAQYGFPVSPSFTPTRWLEEGETLKV 121

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G H F+V H PGH+PG V++ N EN     GD LF  ++GRTD   G++  LIN+I  K+
Sbjct: 122 GNHSFQVLHIPGHTPGQVVFYNAENGLLVAGDVLFYETVGRTDFPRGNHDDLINNICAKL 181

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           L L +    + GHG  ++IG E+R NPFL
Sbjct: 182 LTLPENTQVIAGHGRMTSIGHEKRYNPFL 210


>gi|240013170|ref|ZP_04720083.1| putative hydrolase [Neisseria gonorrhoeae DGI18]
 gi|240120241|ref|ZP_04733203.1| putative hydrolase [Neisseria gonorrhoeae PID24-1]
          Length = 210

 Score =  169 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 81/209 (38%), Positives = 129/209 (61%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L + I+ VTPF+QNCT ++D+ES EAV+ D GGD+  +   + +R   +  IW+THGH+D
Sbjct: 3   LRYEILPVTPFRQNCTLIWDDESGEAVLTDVGGDVPFLLQALANRKLTLTAIWLTHGHLD 62

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GG  ++ +  ++ ++GPH++D  ++  +  Q         +   + +RWL++G+TL +
Sbjct: 63  HAGGVVEMLKTRNVPVLGPHREDEFLLQSLP-QTTAQYGFPVSPAFAPNRWLEEGETLTV 121

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G + F+V H PGH+PGHV++   E      GD LF  +IGRTD   G++  LIN+I NK+
Sbjct: 122 GRYAFQVLHIPGHTPGHVVFYCAEAELLIAGDVLFYETIGRTDFPRGNHADLINNIRNKL 181

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
               + +  V GHG  ++IG E+R NPF 
Sbjct: 182 FAFPETVQVVAGHGRMTSIGHEKRHNPFF 210


>gi|229061955|ref|ZP_04199282.1| Metallo-beta-lactamase [Bacillus cereus AH603]
 gi|229169007|ref|ZP_04296723.1| Metallo-beta-lactamase [Bacillus cereus AH621]
 gi|228614416|gb|EEK71525.1| Metallo-beta-lactamase [Bacillus cereus AH621]
 gi|228717339|gb|EEL69011.1| Metallo-beta-lactamase [Bacillus cereus AH603]
          Length = 209

 Score =  169 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 60/210 (28%), Positives = 110/210 (52%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + +  + + P + N   L +++  E ++ DPG + + +   +Q        + +TH H D
Sbjct: 1   MKWIQMPLGPLQTNAYILTNDQ-NECIIFDPGHEGEKLVTYLQEAQLKPLAVLLTHAHFD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G    +++   + +    ++   +       +++  +  +     +D  + +  TL +
Sbjct: 60  HIGAVDAVRDAFHIPVYVHKEEADWLGDATVNGSQIFMMNRSITAKPADHIIDEEGTLTI 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G+  F++F  PGHSPG + Y + E N    GD LF+ SIGRTD+  G + +LI SI  K+
Sbjct: 120 GSFSFEIFETPGHSPGSISYYSKEANAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
             L DE + +CGHGP ++IG E+  NPFL+
Sbjct: 180 FVLPDETAVLCGHGPETSIGFEKENNPFLQ 209


>gi|229019482|ref|ZP_04176303.1| Metallo-beta-lactamase [Bacillus cereus AH1273]
 gi|228741837|gb|EEL92016.1| Metallo-beta-lactamase [Bacillus cereus AH1273]
          Length = 221

 Score =  169 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 60/210 (28%), Positives = 108/210 (51%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + +  + + P + N   L + +  E ++ DPG + + +   +Q        + +TH H D
Sbjct: 13  MKWTQMPLGPLQTNAYILTNNQ-NECIIFDPGHEGEKLVTYLQEAQLKPLAVLLTHAHFD 71

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G    +++   + +    ++   +       +++  +  +     +D+ +    TL +
Sbjct: 72  HIGAVDAVRDAFRIPVYVHKEEADWLGDATVNGSQIFMMNRSITAKPADQIIDAEGTLTI 131

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G+  F++F  PGHSPG + Y   E N    GD LF+ SIGRTD+  G + +LI SI  K+
Sbjct: 132 GSFNFEIFETPGHSPGSISYYCKEANAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKL 191

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
             L DE + +CGHGP ++IG E+  NPFL+
Sbjct: 192 FVLPDETAVLCGHGPETSIGFEKENNPFLQ 221


>gi|329113552|ref|ZP_08242332.1| Putative protein YcbL [Acetobacter pomorum DM001]
 gi|326697074|gb|EGE48735.1| Putative protein YcbL [Acetobacter pomorum DM001]
          Length = 223

 Score =  169 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 91/218 (41%), Positives = 133/218 (61%), Gaps = 7/218 (3%)

Query: 2   SKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGH 61
             +   IV VTPF+QNC+ L++E++ +AV+VD GGD +++ D ++     V+ I +THGH
Sbjct: 6   PDMQLRIVPVTPFRQNCSVLWNEKTRKAVIVDAGGDANVLLDFLKKNILEVEAILLTHGH 65

Query: 62  VDHV------GGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWL 115
           +DH           +  +     +IGP+  D  ++  + EQAR   +     NA  DR+ 
Sbjct: 66  LDHAGGVAALCRGLENTQVTRPDVIGPNIHDQFLLQSIVEQARHFGLSD-LENADVDRFT 124

Query: 116 QDGDTLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQL 175
           QDG++L      F+V H PGH+PGHV++V+ +  FA  GD LFR +IGRTD  +G+ QQL
Sbjct: 125 QDGESLNYLGCTFRVVHVPGHTPGHVVFVDEKARFAFGGDVLFRGTIGRTDFAYGNSQQL 184

Query: 176 INSINNKILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           I  I  K+LPLGD+I  V GHG  +T+G ER  NPFL+
Sbjct: 185 IQGIKEKLLPLGDDIVIVPGHGGLTTLGAERASNPFLQ 222


>gi|49480959|ref|YP_038321.1| metallo-beta-lactamase family protein [Bacillus thuringiensis
           serovar konkukian str. 97-27]
 gi|196041608|ref|ZP_03108900.1| metallo-beta-lactamase family protein [Bacillus cereus NVH0597-99]
 gi|49332515|gb|AAT63161.1| metallo-beta-lactamase family protein [Bacillus thuringiensis
           serovar konkukian str. 97-27]
 gi|196027596|gb|EDX66211.1| metallo-beta-lactamase family protein [Bacillus cereus NVH0597-99]
          Length = 209

 Score =  169 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 62/210 (29%), Positives = 109/210 (51%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + +  + + P + N   L +++  E V+ DPG + + +   +Q        + +TH H D
Sbjct: 1   MKWIQMPLGPLQTNAYILKNDQ-NECVIFDPGHEGEKLVTYLQEEQLKPLAVLLTHAHFD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G    ++E   + +    +++  +       +++  +  +     +D  +    TL +
Sbjct: 60  HIGAVDAVREAFHIPVYVHKEEEDWLGDATVNGSQIFMMNRSITAKPADHIIDAEGTLAI 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G+  F++F  PGHSPG + Y   E N    GD LF+ SIGRTD+  G + +LI SI  K+
Sbjct: 120 GSFNFEIFETPGHSPGSISYYCKEANAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
             L DE + +CGHGP ++IG E+  NPFL+
Sbjct: 180 FVLPDETAVLCGHGPETSIGFEKENNPFLQ 209


>gi|254363169|ref|ZP_04979218.1| zinc (Zn2+)-dependent hydrolase [Mannheimia haemolytica PHL213]
 gi|261493952|ref|ZP_05990460.1| glyoxalase II family protein [Mannheimia haemolytica serotype A2
           str. BOVINE]
 gi|261494763|ref|ZP_05991242.1| glyoxalase II family protein [Mannheimia haemolytica serotype A2
           str. OVINE]
 gi|153095063|gb|EDN75614.1| zinc (Zn2+)-dependent hydrolase [Mannheimia haemolytica PHL213]
 gi|261309580|gb|EEY10804.1| glyoxalase II family protein [Mannheimia haemolytica serotype A2
           str. OVINE]
 gi|261310384|gb|EEY11579.1| glyoxalase II family protein [Mannheimia haemolytica serotype A2
           str. BOVINE]
          Length = 209

 Score =  169 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 77/209 (36%), Positives = 129/209 (61%), Gaps = 2/209 (0%)

Query: 5   SFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDH 64
           +  I+ V+PF+QNCT ++DE +  A ++D G + + I   ++S+   V+++ ITHGH+DH
Sbjct: 3   NLQIIPVSPFQQNCTVIWDE-NKNAAIIDGGDNAEGIIQFVESQQLKVQKLLITHGHLDH 61

Query: 65  VGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLG 124
           +    +L+E   + + G H  D  +  ++ E  +   +         D WL++GD + +G
Sbjct: 62  IMAVEKLREHFQVEVFGSHLADKPLFERLPEMCQQFGLPP-VNGFLPDHWLEEGDRVEVG 120

Query: 125 THIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKIL 184
              + V H PGH+PGH+ + +F+N  A  GD LF++SIGRTD+  G++ QL+ +I  K+ 
Sbjct: 121 ELSYTVRHLPGHAPGHIGFFDFDNRIAFSGDVLFQNSIGRTDLYLGNHSQLLETIREKMF 180

Query: 185 PLGDEISFVCGHGPNSTIGRERRLNPFLK 213
            L D+   + GHGP++TIGRE++ NPFLK
Sbjct: 181 DLDDDFIIIPGHGPHTTIGREKQTNPFLK 209


>gi|119472424|ref|ZP_01614542.1| putative enzyme with metallo-hydrolase/oxidoreductase domain
           [Alteromonadales bacterium TW-7]
 gi|119444946|gb|EAW26244.1| putative enzyme with metallo-hydrolase/oxidoreductase domain
           [Alteromonadales bacterium TW-7]
          Length = 213

 Score =  169 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 87/209 (41%), Positives = 121/209 (57%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +    + VTPF QNC  +  E + EA+VVDPGGD D I   + S +  +K +W+THGH+D
Sbjct: 1   MKIITIPVTPFAQNCRIIACESTQEAIVVDPGGDSDKIIATLTSNSLTLKAVWLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG A  L+    + IIGPHKD+      +  QA++            D WL  GDTL L
Sbjct: 61  HVGAADVLRRQFDIKIIGPHKDERFWFDNLPMQAQMFGF-PPIDPFYPDEWLSHGDTLSL 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   F V HCPGH+PGH+++   +N    +GD +F+ S+GRTD   G+ QQLI SI   I
Sbjct: 120 GKLKFDVMHCPGHTPGHIVFYEQDNKCVIVGDVIFKGSVGRTDFPQGNSQQLIESIKANI 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           L L  + + + GHG  +T+  E + NPF+
Sbjct: 180 LTLPVKTAILSGHGSETTVEHEIKTNPFV 208


>gi|228960527|ref|ZP_04122176.1| Metallo-beta-lactamase [Bacillus thuringiensis serovar pakistani
           str. T13001]
 gi|228799127|gb|EEM46095.1| Metallo-beta-lactamase [Bacillus thuringiensis serovar pakistani
           str. T13001]
          Length = 239

 Score =  169 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 60/210 (28%), Positives = 109/210 (51%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + +  + + P + N   L +++  E ++ DPG + + +   +Q        + +TH H D
Sbjct: 31  MKWIQMPLGPLQTNAYILMNDQ-KECIIFDPGHEGEKLVTYLQEEQLKPLAVLLTHAHFD 89

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G    +++   + +    ++   +       +++  +  +     +D  +    TL +
Sbjct: 90  HIGAVDAVRDAFHIPVYVHKEEANWLGDATVNGSQIFMMNRSITAKPADHIIDAEGTLTI 149

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G+  F++F  PGHSPG + Y + E N    GD LF+ SIGRTD+  G + +LI SI  K+
Sbjct: 150 GSFNFEIFETPGHSPGSISYYSKEANAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKL 209

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
             L DE + +CGHGP ++IG E+  NPFL+
Sbjct: 210 FVLPDETAVLCGHGPETSIGFEKENNPFLQ 239


>gi|49079038|gb|AAT49847.1| PA0832 [synthetic construct]
          Length = 214

 Score =  169 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 71/209 (33%), Positives = 107/209 (51%), Gaps = 4/209 (1%)

Query: 7   HIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVG 66
               V P + NCT + D  + +A+VVDPGGD ++I   +      V  I  TH H+DH  
Sbjct: 10  ETFPVGPLQCNCTIIGDPLTRKAIVVDPGGDHELILQRLDRLGLQVVSIIHTHAHLDHFL 69

Query: 67  GAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTH 126
            + ++K+    ++   HKDD  +   ++ Q +L  +      A  DRWL D + L  G  
Sbjct: 70  ASGEMKKRTGASLH-LHKDDQFLWDNLEMQCQLFGVPYTPVPA-PDRWLADDEELACGC- 126

Query: 127 IFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPL 186
                H PGH+PG + +          GDTLFR  IGRTD+  GD   +  SI  ++  L
Sbjct: 127 -GVALHTPGHTPGSMSFWFPRAKLLIAGDTLFRRGIGRTDLWGGDSAAIQRSIRQRLYSL 185

Query: 187 GDEISFVCGHGPNSTIGRERRLNPFLKSN 215
            ++ + V GHGP++T+G E R NPF++  
Sbjct: 186 DEDATVVAGHGPDTTLGEEMRENPFVRGG 214


>gi|291287356|ref|YP_003504172.1| beta-lactamase domain protein [Denitrovibrio acetiphilus DSM 12809]
 gi|290884516|gb|ADD68216.1| beta-lactamase domain protein [Denitrovibrio acetiphilus DSM 12809]
          Length = 205

 Score =  169 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 76/209 (36%), Positives = 105/209 (50%), Gaps = 4/209 (1%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +    + V P   NC  +   +  +AV+VDPGG+ + I   ++        I  THGH D
Sbjct: 1   MKLESIIVGPLAVNCYII--SKDGKAVIVDPGGNTESIVKYLKQGKLTPVAIVNTHGHFD 58

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G  +QLKE   +     HKDD  +     E + +         A +D +L DG  L L
Sbjct: 59  HIGSVSQLKEAYDIP-FMLHKDDEFLCSHGAESSAMFGFDKIENPAITD-YLTDGQQLSL 116

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V H PGHSPG V     E      GDTLF  S+GR+D  +   +QL++SI  K+
Sbjct: 117 GGIEIGVIHTPGHSPGGVCLYVRELKSVMTGDTLFLESVGRSDFPYASTEQLMHSIREKV 176

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
             L DE     GHGP+S+IG E++ NPFL
Sbjct: 177 FSLPDETKVFPGHGPSSSIGHEKKFNPFL 205


>gi|196035030|ref|ZP_03102437.1| metallo-beta-lactamase family protein [Bacillus cereus W]
 gi|218905397|ref|YP_002453231.1| metallo-beta-lactamase family protein [Bacillus cereus AH820]
 gi|254721855|ref|ZP_05183644.1| metallo-beta-lactamase family protein [Bacillus anthracis str.
           A1055]
 gi|195992569|gb|EDX56530.1| metallo-beta-lactamase family protein [Bacillus cereus W]
 gi|218535728|gb|ACK88126.1| metallo-beta-lactamase family protein [Bacillus cereus AH820]
          Length = 209

 Score =  169 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 60/210 (28%), Positives = 109/210 (51%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + +  + + P + N   L +++  E V+ DPG + + +   +Q        + +TH H D
Sbjct: 1   MKWIQMPLGPLQTNAYILKNDK-NECVIFDPGHEGEKLVTYLQEEQLKPLAVLLTHAHFD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G    +++   + +    +++  +       +++  +  +     +D  +    TL +
Sbjct: 60  HIGAVDAVRDAFHIPVYVHKEEEDWLGDATVNGSQIFMMNRSITAKPADHIIDAEGTLAI 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G+  F++F  PGHSPG + Y   E +    GD LF+ SIGRTD+  G + +LI SI  K+
Sbjct: 120 GSFNFEIFETPGHSPGSISYYCKEASAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
             L DE + +CGHGP ++IG E+  NPFL+
Sbjct: 180 FVLPDETAVLCGHGPETSIGFEKENNPFLQ 209


>gi|225075566|ref|ZP_03718765.1| hypothetical protein NEIFLAOT_00579 [Neisseria flavescens
           NRL30031/H210]
 gi|224953111|gb|EEG34320.1| hypothetical protein NEIFLAOT_00579 [Neisseria flavescens
           NRL30031/H210]
          Length = 212

 Score =  169 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 85/209 (40%), Positives = 130/209 (62%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L F I  VTPF+QNCT ++D+E+ EAV+ D GGD+  +   +Q++   +  IW+THGH+D
Sbjct: 3   LQFEINAVTPFRQNCTLIWDDETKEAVLTDVGGDVPYLLQQVQNKGLKLTAIWLTHGHLD 62

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GG  +L +   + ++GPHKDD  ++  +  Q         + + +  RWL++G++L +
Sbjct: 63  HAGGVVELLKTCDIPVLGPHKDDEFLLQALP-QTTAQYSFPVSPSFTPTRWLEEGESLKV 121

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G H F+V H PGH+PG V++ N EN     GD LF  ++GRTD   G++  LIN+I  K+
Sbjct: 122 GNHSFQVLHIPGHTPGQVVFYNAENGLLVAGDVLFYETVGRTDFPRGNHDDLINNICTKL 181

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           L L +    + GHG  ++IG E+R NPFL
Sbjct: 182 LTLPETTQVIAGHGRMTSIGHEKRYNPFL 210


>gi|301055754|ref|YP_003793965.1| metallo-beta-lactamase family protein [Bacillus anthracis CI]
 gi|300377923|gb|ADK06827.1| metallo-beta-lactamase family protein [Bacillus cereus biovar
           anthracis str. CI]
          Length = 209

 Score =  169 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 60/210 (28%), Positives = 108/210 (51%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + +  + + P + N   L +++  E V+ DPG + + +   +Q        + +TH H D
Sbjct: 1   MKWIQMPLGPLQTNAYILKNDQ-NECVIFDPGHEGEKLVTYLQEEQLKPLAVLLTHAHFD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G    ++E   + +    +++  +       +++  +  +     +D  +     L +
Sbjct: 60  HIGAVDAVREAFHIPVYVHKEEEDWLGDATVNGSQIFMMNRSITAKPADHIIDAEGKLAI 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G+  F++F  PGHSPG + Y   E +    GD LF+ SIGRTD+  G + +LI SI  K+
Sbjct: 120 GSFNFEIFETPGHSPGSISYYCKEASAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
             L DE + +CGHGP ++IG E+  NPFL+
Sbjct: 180 FVLPDETAVLCGHGPETSIGFEKENNPFLQ 209


>gi|229129540|ref|ZP_04258511.1| Metallo-beta-lactamase [Bacillus cereus BDRD-Cer4]
 gi|229152461|ref|ZP_04280653.1| Metallo-beta-lactamase [Bacillus cereus m1550]
 gi|228631069|gb|EEK87706.1| Metallo-beta-lactamase [Bacillus cereus m1550]
 gi|228654145|gb|EEL10012.1| Metallo-beta-lactamase [Bacillus cereus BDRD-Cer4]
          Length = 239

 Score =  169 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 60/210 (28%), Positives = 109/210 (51%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + +  + + P + N   L +++  E ++ DPG + + +   +Q +      + +TH H D
Sbjct: 31  MKWIQMPLGPLQTNAYILMNDQ-KECIIFDPGHEGEKLVTYLQEKQLKPLAVLLTHAHFD 89

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G    +++   + +    ++   +       +++  +  +     +D  +    TL +
Sbjct: 90  HIGAVDAVRDAFHIPVYVHKEEADWLGDATVNGSQIFMMNRSITAKPADHIIDAEGTLTI 149

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G+  F++F  PGHSPG + Y   E N    GD LF+ SIGRTD+  G + +LI SI  K+
Sbjct: 150 GSFNFEIFETPGHSPGSISYYTKEANAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKL 209

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
             L DE + +CGHGP ++IG E+  NPFL+
Sbjct: 210 FVLPDETAVLCGHGPETSIGFEKENNPFLQ 239


>gi|47567823|ref|ZP_00238531.1| hydroxyacylglutathione hydrolase [Bacillus cereus G9241]
 gi|47555500|gb|EAL13843.1| hydroxyacylglutathione hydrolase [Bacillus cereus G9241]
          Length = 209

 Score =  169 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 60/210 (28%), Positives = 109/210 (51%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + +  + + P + N   L +++  E ++ DPG + + +   +Q        + +TH H D
Sbjct: 1   MKWIQMPLGPLQTNAYILTNDQ-NECIIFDPGHEGEKLVTYLQEEQLKPLAVLLTHAHFD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G    +++   + +    +++  +       +++  +  +     +D  +    TL +
Sbjct: 60  HIGAVDAVRDAFHIPVYVHKEEEDWLGDATVNGSQIFMMNRSITAKPADHIIDAEGTLAI 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G+  F+VF  PGHSPG + Y   E +    GD LF+ SIGRTD+  G + +LI SI  K+
Sbjct: 120 GSFNFEVFETPGHSPGSISYYCKEASAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
             L DE + +CGHGP ++IG E+  NPFL+
Sbjct: 180 FVLPDETAVLCGHGPETSIGFEKENNPFLQ 209


>gi|261379480|ref|ZP_05984053.1| metallo-beta-lactamase domain protein [Neisseria subflava NJ9703]
 gi|284797939|gb|EFC53286.1| metallo-beta-lactamase domain protein [Neisseria subflava NJ9703]
          Length = 212

 Score =  169 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 86/209 (41%), Positives = 130/209 (62%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L F I  VTPF+QNCT ++D+E+ EAV+ D GGD+  +   +Q++   +  IW+THGH+D
Sbjct: 3   LQFEINAVTPFRQNCTLIWDDETKEAVLTDVGGDVPYLLQQVQNKGLKLTAIWLTHGHLD 62

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GG  +L +   + ++GPHKDD  ++  +  Q         + + +  RWL++G+TL +
Sbjct: 63  HAGGVVELLKTCDVPVLGPHKDDEFLLQALP-QTTAQYGFPVSPSFTPTRWLEEGETLKV 121

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G H F+V H PGH+PG V++ N EN     GD LF  ++GRTD   G++  LIN+I  K+
Sbjct: 122 GNHSFQVLHIPGHTPGQVVFYNAENGLLVAGDVLFYETVGRTDFPRGNHDDLINNICAKL 181

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           L L +    + GHG  ++IG E+R NPFL
Sbjct: 182 LTLPETTQVIAGHGRMTSIGHEKRYNPFL 210


>gi|196046331|ref|ZP_03113557.1| metallo-beta-lactamase family protein [Bacillus cereus 03BB108]
 gi|225866243|ref|YP_002751621.1| metallo-beta-lactamase family protein [Bacillus cereus 03BB102]
 gi|196022801|gb|EDX61482.1| metallo-beta-lactamase family protein [Bacillus cereus 03BB108]
 gi|225788102|gb|ACO28319.1| metallo-beta-lactamase family protein [Bacillus cereus 03BB102]
          Length = 209

 Score =  169 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 61/210 (29%), Positives = 108/210 (51%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + +  + + P + N   L +++  E V+ DPG + + +   +Q        + +TH H D
Sbjct: 1   MKWIQMPLGPLQTNAYILKNDQ-NECVIFDPGHEGEKLVTYLQEEQLKPLAVLLTHAHFD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G    ++E   + +    +++  +       +++  +  +     +D  +     L +
Sbjct: 60  HIGAVDAVREAFHIPVYVHKEEEDWLGDATVNGSQIFMMNRSITAKPADHIIDAEGKLAI 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G+  F++F  PGHSPG + Y   E N    GD LF+ SIGRTD+  G + +LI SI  K+
Sbjct: 120 GSFNFEIFETPGHSPGSISYYCKEANAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
             L DE + +CGHGP ++IG E+  NPFL+
Sbjct: 180 FVLPDETAVLCGHGPETSIGFEKENNPFLQ 209


>gi|228923013|ref|ZP_04086306.1| Metallo-beta-lactamase [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
 gi|228836646|gb|EEM81994.1| Metallo-beta-lactamase [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
          Length = 239

 Score =  169 bits (428), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 60/210 (28%), Positives = 109/210 (51%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + +  + + P + N   L +++  E ++ DPG + + +   +Q        + +TH H D
Sbjct: 31  MKWIQMPLGPLQTNAYILMNDQ-KECIIFDPGHEGEKLVTYLQEEQLKPLAVLLTHAHFD 89

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G    +++   + +    ++   +       +++  +  +     +D  +    TL +
Sbjct: 90  HIGAVDAVRDAFHIPVYVHKEEADWLGDATVNGSQIFMMNRSITAKPADHIIDAEGTLTI 149

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G+  F++F  PGHSPG + Y + E N    GD LF+ SIGRTD+  G + +LI SI  K+
Sbjct: 150 GSFNFEIFETPGHSPGSISYYSKEANAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKL 209

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
             L DE + +CGHGP ++IG E+  NPFL+
Sbjct: 210 FVLPDETAVLCGHGPETSIGFEKENNPFLQ 239


>gi|194099693|ref|YP_002002828.1| putative hydrolase [Neisseria gonorrhoeae NCCP11945]
 gi|239999883|ref|ZP_04719807.1| putative hydrolase [Neisseria gonorrhoeae 35/02]
 gi|240015612|ref|ZP_04722152.1| putative hydrolase [Neisseria gonorrhoeae FA6140]
 gi|240081780|ref|ZP_04726323.1| putative hydrolase [Neisseria gonorrhoeae FA19]
 gi|240114060|ref|ZP_04728550.1| putative hydrolase [Neisseria gonorrhoeae MS11]
 gi|240114702|ref|ZP_04728764.1| putative hydrolase [Neisseria gonorrhoeae PID18]
 gi|240122539|ref|ZP_04735495.1| putative hydrolase [Neisseria gonorrhoeae PID332]
 gi|254492759|ref|ZP_05105930.1| hydrolase [Neisseria gonorrhoeae 1291]
 gi|260441490|ref|ZP_05795306.1| putative hydrolase [Neisseria gonorrhoeae DGI2]
 gi|268595693|ref|ZP_06129860.1| glyoxalase II family protein [Neisseria gonorrhoeae 35/02]
 gi|268597879|ref|ZP_06132046.1| glyoxalase II family protein [Neisseria gonorrhoeae FA19]
 gi|268600127|ref|ZP_06134294.1| hydrolase [Neisseria gonorrhoeae MS11]
 gi|268600348|ref|ZP_06134515.1| hydrolase [Neisseria gonorrhoeae PID18]
 gi|268681128|ref|ZP_06147990.1| hydrolase [Neisseria gonorrhoeae PID332]
 gi|291044854|ref|ZP_06570563.1| conserved hypothetical protein [Neisseria gonorrhoeae DGI2]
 gi|293397932|ref|ZP_06642138.1| hydrolase [Neisseria gonorrhoeae F62]
 gi|193934983|gb|ACF30807.1| putative hydrolase [Neisseria gonorrhoeae NCCP11945]
 gi|226511799|gb|EEH61144.1| hydrolase [Neisseria gonorrhoeae 1291]
 gi|268549082|gb|EEZ44500.1| glyoxalase II family protein [Neisseria gonorrhoeae 35/02]
 gi|268551667|gb|EEZ46686.1| glyoxalase II family protein [Neisseria gonorrhoeae FA19]
 gi|268584258|gb|EEZ48934.1| hydrolase [Neisseria gonorrhoeae MS11]
 gi|268584479|gb|EEZ49155.1| hydrolase [Neisseria gonorrhoeae PID18]
 gi|268621412|gb|EEZ53812.1| hydrolase [Neisseria gonorrhoeae PID332]
 gi|291011748|gb|EFE03744.1| conserved hypothetical protein [Neisseria gonorrhoeae DGI2]
 gi|291611878|gb|EFF40947.1| hydrolase [Neisseria gonorrhoeae F62]
 gi|317165178|gb|ADV08719.1| putative hydrolase [Neisseria gonorrhoeae TCDC-NG08107]
          Length = 210

 Score =  169 bits (428), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 82/209 (39%), Positives = 128/209 (61%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L + I+ VTPF+QNCT ++D+ES EAV+ D GGD+  +   + +R   +  IW+THGH+D
Sbjct: 3   LRYEILPVTPFRQNCTLIWDDESGEAVLTDVGGDVPFLLQALANRKLTLTAIWLTHGHLD 62

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GG  ++ E   + ++GPH++D  ++  +  Q         +   + +RWL++G+TL +
Sbjct: 63  HAGGVVEMLETHKVPVLGPHREDEFLLQSLP-QTTAQYGFPVSPAFAPNRWLEEGETLTV 121

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G + F+V H PGH+PGHV++   E      GD LF  +IGRTD   G++  LIN+I NK+
Sbjct: 122 GRYAFQVLHIPGHTPGHVVFYCAEAELLIAGDVLFYETIGRTDFPRGNHADLINNIRNKL 181

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
               + +  V GHG  ++IG E+R NPF 
Sbjct: 182 FAFPETVQVVAGHGRMTSIGHEKRHNPFF 210


>gi|163803970|ref|ZP_02197794.1| glyoxylase II family protein [Vibrio sp. AND4]
 gi|159172221|gb|EDP57128.1| glyoxylase II family protein [Vibrio sp. AND4]
          Length = 218

 Score =  169 bits (428), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 86/214 (40%), Positives = 129/214 (60%), Gaps = 2/214 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L + +V VT F QNC+ ++ +E+++ +VVDPGGD   +  +I+     V  + +THGH+D
Sbjct: 3   LKYQVVPVTSFSQNCSIVWCDETMKGIVVDPGGDEKQLSMLIKELGVEVVNLVLTHGHLD 62

Query: 64  HVGGAAQLKEDLSLT-IIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLL 122
           HVGG   L   L  T I+GPHK D   +  ++ Q+++    +        +WL +GDT+ 
Sbjct: 63  HVGGTEPLSALLGGTEIVGPHKADNFWLQGLEGQSQMFGFPL-TEAFEPHQWLNEGDTVT 121

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
            G  +  V H PGH+PGHV+  + +   A +GD LF  S+GRTD   GD+  LI SI  K
Sbjct: 122 FGNQVLNVIHTPGHTPGHVVLYSEDARLAFVGDVLFNGSVGRTDFPQGDFNTLICSIKEK 181

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           + PLG++++FV GHGP ST G ER+ NPF+   +
Sbjct: 182 LWPLGNDVTFVPGHGPQSTFGHERKTNPFVADEM 215


>gi|13472383|ref|NP_103950.1| hydrolase [Mesorhizobium loti MAFF303099]
 gi|14023129|dbj|BAB49736.1| probable hydrolase [Mesorhizobium loti MAFF303099]
          Length = 212

 Score =  169 bits (428), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 116/212 (54%), Positives = 148/212 (69%), Gaps = 1/212 (0%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M +L+  IV VTPF+QNCT LFD +    VVVDPGGD+D +  V++      + IWITHG
Sbjct: 1   MGQLNAGIVPVTPFQQNCTILFDMDDKHGVVVDPGGDIDKVLAVLKDNAITAEAIWITHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DH GGA +LKE L L IIGPH  D  ++  +++Q RL SI   ARN   DR+L +G+T
Sbjct: 61  HIDHAGGAMELKEALCLDIIGPHAADKPLLDNLEKQGRLYSI-AGARNCVPDRFLTEGET 119

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           +  G H+F+V HCPGH+PGHV+Y N    FAH+GD LFR S+GRTD+  GD+  LI SI 
Sbjct: 120 VSFGGHVFEVLHCPGHAPGHVVYYNRAAKFAHVGDVLFRGSVGRTDLPGGDHATLIASIK 179

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           +K+LPLGD+I F+CGHGP    G ERR NPFL
Sbjct: 180 DKLLPLGDDIGFICGHGPGGRFGEERRTNPFL 211


>gi|315499969|ref|YP_004088772.1| beta-lactamase domain protein [Asticcacaulis excentricus CB 48]
 gi|315417981|gb|ADU14621.1| beta-lactamase domain protein [Asticcacaulis excentricus CB 48]
          Length = 229

 Score =  169 bits (427), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 94/215 (43%), Positives = 132/215 (61%), Gaps = 2/215 (0%)

Query: 2   SKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGH 61
             +   +  VTP +QNCT ++  ++ +A V+DPGGD+  +   IQ R   +++IW+THGH
Sbjct: 5   PPIRLFVAPVTPLQQNCTVVWCTKTHKAAVIDPGGDIKPVLAEIQRRGLTIEKIWVTHGH 64

Query: 62  VDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
            DH GG   L E     I GPH DD   + ++ E A+      +AR+    RWL  GDT+
Sbjct: 65  ADHAGGTQALHEATGAPIEGPHADDRFWIERIPEDAKR-WGIYDARSFEPTRWLTHGDTV 123

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
            LG   ++V HCPGH+PGHVI+ + E+ FA +GD LFR SIGRTD   G++  LIN+I  
Sbjct: 124 TLGETEWQVIHCPGHTPGHVIFYHPESQFAQVGDILFRGSIGRTDFPRGNHTDLINAITT 183

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           ++ PLGD + FVCGHGP S+   ER  NPF+   +
Sbjct: 184 RLWPLGD-VQFVCGHGPMSSFAAERAHNPFVGDRV 217


>gi|228993006|ref|ZP_04152929.1| Metallo-beta-lactamase [Bacillus pseudomycoides DSM 12442]
 gi|228999056|ref|ZP_04158638.1| Metallo-beta-lactamase [Bacillus mycoides Rock3-17]
 gi|229006604|ref|ZP_04164239.1| Metallo-beta-lactamase [Bacillus mycoides Rock1-4]
 gi|228754653|gb|EEM04063.1| Metallo-beta-lactamase [Bacillus mycoides Rock1-4]
 gi|228760673|gb|EEM09637.1| Metallo-beta-lactamase [Bacillus mycoides Rock3-17]
 gi|228766654|gb|EEM15294.1| Metallo-beta-lactamase [Bacillus pseudomycoides DSM 12442]
          Length = 209

 Score =  169 bits (427), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 58/210 (27%), Positives = 108/210 (51%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + +  + + P + N   L +++  E ++ DPG + + +   +Q        + +TH H D
Sbjct: 1   MKWIQMPLGPLQTNAYILSNDQ-KECIIFDPGSEGEKLVTYLQEEQLKPLAVLLTHAHFD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G    +++   + +    ++   +       +++  +  +     +D+ ++    L +
Sbjct: 60  HIGAVDAVRDAFHIPVYVHKEEVDWLGDATVNGSQIFMMNRSITAKPADQIIEGEGMLTI 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G+  F++F  PGHSPG + Y   E N    GD LF+ SIGRTD+  G + +LI SI  K+
Sbjct: 120 GSFTFEMFETPGHSPGSISYYCKEANAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
             L D+ + +CGHGP + IG E+  NPFL+
Sbjct: 180 FVLPDDTAVLCGHGPETNIGFEKENNPFLQ 209


>gi|116747917|ref|YP_844604.1| beta-lactamase domain-containing protein [Syntrophobacter
           fumaroxidans MPOB]
 gi|116696981|gb|ABK16169.1| beta-lactamase domain protein [Syntrophobacter fumaroxidans MPOB]
          Length = 215

 Score =  169 bits (427), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 76/208 (36%), Positives = 101/208 (48%), Gaps = 2/208 (0%)

Query: 6   FHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHV 65
              + V  F+ NC  L +  S  AVV+DPG + + I   I +       I ITH H+DHV
Sbjct: 10  LEHIPVGMFRTNCYVLGETRSHRAVVIDPGAEGERIAGRIGALGLQPVAILITHAHIDHV 69

Query: 66  GGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGT 125
            GA  LKE+L   I    KD   +   +     L          ++DR L++GD L  G 
Sbjct: 70  MGAWSLKEELGGEIFLHPKDQPLLDDHMIGLDDLACAH--VPRFAADRTLEEGDVLDFGP 127

Query: 126 HIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILP 185
               V   PGH+PGHV     E     +GDT+F  SIGRTD   G + +LI S+  KI  
Sbjct: 128 IRLSVIETPGHTPGHVSVYFPEAKSIFVGDTIFAGSIGRTDFPGGSHDRLIRSVKEKIFT 187

Query: 186 LGDEISFVCGHGPNSTIGRERRLNPFLK 213
           L  +     GHGP +T+ RE R NPF +
Sbjct: 188 LPGDTLVYPGHGPGTTVEREMRTNPFFR 215


>gi|325129367|gb|EGC52202.1| metallo-beta-lactamase domain protein [Neisseria meningitidis
           OX99.30304]
          Length = 210

 Score =  169 bits (427), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 82/209 (39%), Positives = 129/209 (61%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L + I+ VTPF+QNCT ++D+ES EAV+ D GGD+  +   + +R   +  IW+THGH+D
Sbjct: 3   LRYEILSVTPFRQNCTLIWDDESGEAVLTDVGGDVPFLLQALANRKLTLTAIWLTHGHLD 62

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GG  ++ +  ++ ++GPH DD  ++  +  Q         +   + +RWL++G+TL +
Sbjct: 63  HAGGVVEMLKTRNVPVLGPHPDDEFLLQSLP-QTTAQYGFPVSPAFAPNRWLEEGETLTV 121

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G + F+V H PGH+PGH+++   E      GD LF  +IGRTD   G++  LIN+I NK+
Sbjct: 122 GRYAFQVLHIPGHTPGHIVFYCAEAELLIAGDVLFYETIGRTDFPRGNHADLINNIRNKL 181

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
             L + +  V GHG  ++IG E+R NPF 
Sbjct: 182 FALPETVQVVAGHGRMTSIGHEKRHNPFF 210


>gi|307825064|ref|ZP_07655285.1| beta-lactamase domain protein [Methylobacter tundripaludum SV96]
 gi|307733812|gb|EFO04668.1| beta-lactamase domain protein [Methylobacter tundripaludum SV96]
          Length = 210

 Score =  169 bits (427), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 94/209 (44%), Positives = 131/209 (62%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + F I  VT ++QNC+ L  E + +A +VDPGGD+D I   I   N   + I ITHGH+D
Sbjct: 1   MRFCITPVTAYQQNCSLLICEHTNKAAIVDPGGDIDTILKAIDRENATPESILITHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G  A+L   LS+ +IGPH+DD   +  + EQ R         + +  RWL  GD + +
Sbjct: 61  HIGATAELAALLSIPVIGPHQDDQFWIDAIPEQCRTFRFPAC-DSFTPSRWLSQGDIVKV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G  +  VFHCPGH+PGHV++V+     A +GD LF+ SIGRTD+  GD+  LI+SI N +
Sbjct: 120 GEEVLDVFHCPGHTPGHVVFVHRNTKLAIVGDVLFKGSIGRTDLPKGDFNTLIHSIKNNL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
            PLG++ +F+ GHGP ST G E R NPF+
Sbjct: 180 WPLGEQFTFIPGHGPMSTFGEEMRNNPFV 208


>gi|229093330|ref|ZP_04224439.1| Metallo-beta-lactamase [Bacillus cereus Rock3-42]
 gi|228690054|gb|EEL43853.1| Metallo-beta-lactamase [Bacillus cereus Rock3-42]
          Length = 221

 Score =  169 bits (427), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 62/210 (29%), Positives = 109/210 (51%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + +  + + P + N   L +++  E V+ DPG + + +   +Q        + +TH H D
Sbjct: 13  MKWIQMPLGPLQTNAYILKNDQ-NECVIFDPGHEGEKLVTYLQEEQLKPLAVLLTHAHFD 71

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G    ++E   + +    +++  +       +++  +  +     +D  +    TL +
Sbjct: 72  HIGAVDAVREAFHIPVYVHKEEEDWLGDATVNGSQIFMMNRSITAKPADHIIDAEGTLAI 131

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G+  F++F  PGHSPG + Y   E N    GD LF+ SIGRTD+  G + +LI SI  K+
Sbjct: 132 GSFNFEIFETPGHSPGSISYYCKEANAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKL 191

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
             L DE + +CGHGP ++IG E+  NPFL+
Sbjct: 192 FVLPDETAVLCGHGPETSIGFEKENNPFLQ 221


>gi|94495943|ref|ZP_01302522.1| beta-lactamase-like protein [Sphingomonas sp. SKA58]
 gi|94424635|gb|EAT09657.1| beta-lactamase-like protein [Sphingomonas sp. SKA58]
          Length = 219

 Score =  169 bits (427), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 88/215 (40%), Positives = 130/215 (60%), Gaps = 2/215 (0%)

Query: 2   SKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGH 61
             L   ++ VTP +QNCT  +  E++    VDPGGDL ++K   Q     ++++ ITHGH
Sbjct: 4   PPLKAALIPVTPLQQNCTLFWCTETMRGAFVDPGGDLPMLKKAAQQHGVTIEKLLITHGH 63

Query: 62  VDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
           +DH G A  L  DL + I GPH++D   + ++ +     ++     +   DRWL DGD +
Sbjct: 64  IDHCGQAGVLARDLGVPIEGPHEEDRFWIERLAQDGERWNV--PGESFEPDRWLADGDQV 121

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
            +G     V+HCPGH+PGHV++ +  +  A +GD LF+ +IGRTD   GD+QQLI++I  
Sbjct: 122 TVGHLTLDVYHCPGHTPGHVVFHHAPSKLAIVGDVLFQGAIGRTDFPRGDHQQLIDAITG 181

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           K+ PLG E +FV GHGP S    ERR NPF+  ++
Sbjct: 182 KLWPLGGETAFVPGHGPMSNFAHERRTNPFVADSV 216


>gi|332534265|ref|ZP_08410109.1| hypothetical metal-binding enzyme [Pseudoalteromonas haloplanktis
           ANT/505]
 gi|332036261|gb|EGI72733.1| hypothetical metal-binding enzyme [Pseudoalteromonas haloplanktis
           ANT/505]
          Length = 213

 Score =  169 bits (427), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 80/209 (38%), Positives = 118/209 (56%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +    + VT F QN   ++  E+  AVV+DPGGD D I   +      +  IW+THGH+D
Sbjct: 1   MEIITIPVTAFAQNSRIIWCSETKHAVVIDPGGDTDKIVAALNEHKLVLSAIWLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVGGA  L+   ++ IIGP KD+      +  QA++   +        D WL   DT+ +
Sbjct: 61  HVGGADILRNQFNVQIIGPQKDEYFWFENLSMQAQMFEFKP-IEPFYPDIWLNHNDTVSV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   F V HCPGH+PGH+++   +     +GD +F+ S+GRTD   G+ +QLI SI   I
Sbjct: 120 GKLSFLVKHCPGHTPGHIVFYQPDYECVIVGDVIFKGSVGRTDFPKGNSEQLIESIKAHI 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           L L D    + GHG ++T+G E++ NPF+
Sbjct: 180 LTLPDNTKILAGHGSDTTVGFEKKTNPFV 208


>gi|229146847|ref|ZP_04275212.1| Metallo-beta-lactamase [Bacillus cereus BDRD-ST24]
 gi|228636675|gb|EEK93140.1| Metallo-beta-lactamase [Bacillus cereus BDRD-ST24]
          Length = 239

 Score =  169 bits (427), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 60/210 (28%), Positives = 108/210 (51%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + +  + + P + N   L +++  E ++ DPG + + +   +Q        + +TH H D
Sbjct: 31  MKWIQMPLGPLQTNAYILMNDQ-KECIIFDPGHEGEKLVTYLQEEQLKPLAVLLTHAHFD 89

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G    +++   + +    ++   +       +++  +  +     +D  +    TL +
Sbjct: 90  HIGAVDAVRDAFHIPVYVHKEEADWLGDATVNGSQIFMMNRSITAKPADHIIDAEGTLTI 149

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   F++F  PGHSPG + Y + E N    GD LF+ SIGRTD+  G + +LI SI  K+
Sbjct: 150 GLFNFEIFETPGHSPGSISYYSKEANAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKL 209

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
             L DE + +CGHGP ++IG E+  NPFL+
Sbjct: 210 FVLPDETAVLCGHGPETSIGFEKENNPFLQ 239


>gi|229180539|ref|ZP_04307881.1| Metallo-beta-lactamase [Bacillus cereus 172560W]
 gi|228602963|gb|EEK60442.1| Metallo-beta-lactamase [Bacillus cereus 172560W]
          Length = 239

 Score =  169 bits (427), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 60/210 (28%), Positives = 108/210 (51%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + +  + + P + N   L  ++  E ++ DPG + + +   +Q        + +TH H D
Sbjct: 31  MKWIQMPLGPLQTNAYILMSDQ-KECIIFDPGHEGEKLVTYLQEEQLKPLAVLLTHAHFD 89

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G    +++   + +    ++   +       +++  +  +     +D  +    TL +
Sbjct: 90  HIGAVDAVRDTFHIPVYVHKEEADWLGDATVNGSQIFMMNRSITAKPADHIIDAEGTLTI 149

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G+  F++F  PGHSPG + Y + E N    GD LF+ SIGRTD+  G + +LI SI  K+
Sbjct: 150 GSFNFEIFETPGHSPGSISYYSKEANAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKL 209

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
             L DE + +CGHGP ++IG E+  NPFL+
Sbjct: 210 FVLPDETAVLCGHGPETSIGFEKENNPFLQ 239


>gi|152985724|ref|YP_001350032.1| hypothetical protein PSPA7_4688 [Pseudomonas aeruginosa PA7]
 gi|150960882|gb|ABR82907.1| conserved hypothetical protein [Pseudomonas aeruginosa PA7]
          Length = 207

 Score =  169 bits (427), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 73/211 (34%), Positives = 111/211 (52%), Gaps = 4/211 (1%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +      V P + NCT + D  + +A+VVDPGGD ++I   ++     V  I  TH H+D
Sbjct: 1   MIRETFPVGPLQCNCTIIGDPLTKKAIVVDPGGDHELILQRLERLGLQVVSIVHTHAHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H   + +LK+    ++   HKDD  +   ++ Q +L  +  N   A  DRWL D + L  
Sbjct: 61  HFLASGELKKRTGASLH-LHKDDQFLWDNLEMQCQLFGVPYNPVPA-PDRWLADDEELAC 118

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G       H PGH+PG + +   +      GDTLFR  IGRTD+  GD   +  SI  ++
Sbjct: 119 GC--GVALHTPGHTPGSMSFWFPQAKLLVAGDTLFRRGIGRTDLWGGDSAAIQRSIKQRL 176

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
             L ++ + V GHGP++T+G E R NPF++ 
Sbjct: 177 YRLDEDATVVAGHGPDTTLGEEMRENPFVRG 207


>gi|229140997|ref|ZP_04269540.1| Metallo-beta-lactamase [Bacillus cereus BDRD-ST26]
 gi|229198389|ref|ZP_04325095.1| Metallo-beta-lactamase [Bacillus cereus m1293]
 gi|228585089|gb|EEK43201.1| Metallo-beta-lactamase [Bacillus cereus m1293]
 gi|228642430|gb|EEK98718.1| Metallo-beta-lactamase [Bacillus cereus BDRD-ST26]
          Length = 239

 Score =  169 bits (427), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 60/210 (28%), Positives = 107/210 (50%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + +  + + P + N   L +E+  E ++ DPG + + +   +Q        + +TH H D
Sbjct: 31  MKWIQMPLGPLQTNAYILTNEQ-NECIIFDPGHEGEKLVTYLQEEQLKPLAVLLTHAHFD 89

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G    +++   + +    ++   +       +++  +  +     +D  +     L +
Sbjct: 90  HIGAVDAVRDAFHIPVYVHKEEADWLGDATVNGSQIFMMNRSITAKPADHIIDAEGALAI 149

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G+  F++F  PGHSPG + Y   E N    GD LF+ SIGRTD+  G + +LI SI  K+
Sbjct: 150 GSFNFEIFETPGHSPGSISYYCKEANAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKL 209

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
             L DE + +CGHGP ++IG E+  NPFL+
Sbjct: 210 FVLPDETAVLCGHGPETSIGFEKENNPFLQ 239


>gi|229081520|ref|ZP_04214019.1| Metallo-beta-lactamase [Bacillus cereus Rock4-2]
 gi|228701827|gb|EEL54314.1| Metallo-beta-lactamase [Bacillus cereus Rock4-2]
          Length = 239

 Score =  168 bits (426), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 60/210 (28%), Positives = 109/210 (51%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + +  + + P + N   L +++  E ++ DPG + + +   +Q        + +TH H D
Sbjct: 31  MKWIQMPLGPLQTNAYILMNDQ-KECIIFDPGHEGEKLVTYLQEEQLKPLAVLLTHAHFD 89

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G    +++   + +    ++   +       +++  +  +     +D  +    TL +
Sbjct: 90  HIGAVDAVRDTFHIPVYVHKEEADWLGDATVNGSQIFMMNRSITAKPADHIIDAEGTLTI 149

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G+  F++F  PGHSPG + Y + E N    GD LF+ SIGRTD+  G + +LI SI  K+
Sbjct: 150 GSFNFEIFETPGHSPGSISYYSKEANAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKL 209

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
             L DE + +CGHGP ++IG E+  NPFL+
Sbjct: 210 FVLPDETAVLCGHGPETSIGFEKENNPFLQ 239


>gi|229123800|ref|ZP_04252994.1| Metallo-beta-lactamase [Bacillus cereus 95/8201]
 gi|228659621|gb|EEL15267.1| Metallo-beta-lactamase [Bacillus cereus 95/8201]
          Length = 221

 Score =  168 bits (426), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 60/210 (28%), Positives = 109/210 (51%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + +  + + P + N   L +++  E V+ DPG + + +   +Q        + +TH H D
Sbjct: 13  MKWIQMPLGPLQTNAYILKNDK-NECVIFDPGHEGEKLVTYLQEEQLKPLAVLLTHAHFD 71

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G    +++   + +    +++  +       +++  +  +     +D  +    TL +
Sbjct: 72  HIGAVDAVRDAFHIPVYVHKEEEDWLGDATVNGSQIFMMNRSITAKPADHIIDAEGTLAI 131

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G+  F++F  PGHSPG + Y   E +    GD LF+ SIGRTD+  G + +LI SI  K+
Sbjct: 132 GSFNFEIFETPGHSPGSISYYCKEASAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKL 191

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
             L DE + +CGHGP ++IG E+  NPFL+
Sbjct: 192 FVLPDETAVLCGHGPETSIGFEKENNPFLQ 221


>gi|229186502|ref|ZP_04313664.1| Metallo-beta-lactamase [Bacillus cereus BGSC 6E1]
 gi|228596933|gb|EEK54591.1| Metallo-beta-lactamase [Bacillus cereus BGSC 6E1]
          Length = 221

 Score =  168 bits (426), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 61/210 (29%), Positives = 108/210 (51%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + +  + + P + N   L +++  E V+ DPG + + +   +Q        + +TH H D
Sbjct: 13  MKWIQMPLGPLQTNAYILKNDQ-NECVIFDPGHEGEKLVTYLQEEQLKPLAVLLTHAHFD 71

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G    ++E   + +    +++  +       +++  +  +     +D  +     L +
Sbjct: 72  HIGAVDAVREAFHIPVYVHKEEEDWLGDATVNGSQIFMMNRSITAKPADHIIDAEGKLAI 131

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G+  F++F  PGHSPG + Y   E N    GD LF+ SIGRTD+  G + +LI SI  K+
Sbjct: 132 GSFNFEIFETPGHSPGSISYYCKEANAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKL 191

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
             L DE + +CGHGP ++IG E+  NPFL+
Sbjct: 192 FVLPDETAVLCGHGPETSIGFEKENNPFLQ 221


>gi|313667623|ref|YP_004047907.1| hydrolase [Neisseria lactamica ST-640]
 gi|313005085|emb|CBN86517.1| putative hydrolase [Neisseria lactamica 020-06]
          Length = 210

 Score =  168 bits (426), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 82/209 (39%), Positives = 127/209 (60%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L + I  VTPF+QNCT ++D+ES EAV+ D GGD+  +   + +R   +  IW+THGH+D
Sbjct: 3   LRYEIFPVTPFRQNCTLIWDDESGEAVLTDVGGDVPFLLQELANRKLTLTAIWLTHGHLD 62

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GG  ++ +   + ++GPH++D  ++  +  Q         +   S +RWL++ +TL +
Sbjct: 63  HAGGVVEMLKTHKVPVLGPHREDEFLLQSLP-QTTAQYGFPVSPAFSPNRWLEEDETLAV 121

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G + F+V H PGH+PGHV++   E      GD LF  +IGRTD   G++  LIN+I NK+
Sbjct: 122 GRYAFQVLHIPGHTPGHVVFYCAEAELLIAGDVLFYETIGRTDFPRGNHADLINNIRNKL 181

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
             L + +  V GHG  ++IG E+R NPF 
Sbjct: 182 FALPETVQVVAGHGRMTSIGHEKRHNPFF 210


>gi|228987509|ref|ZP_04147628.1| Metallo-beta-lactamase [Bacillus thuringiensis serovar tochigiensis
           BGSC 4Y1]
 gi|228772241|gb|EEM20688.1| Metallo-beta-lactamase [Bacillus thuringiensis serovar tochigiensis
           BGSC 4Y1]
          Length = 239

 Score =  168 bits (426), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 59/210 (28%), Positives = 108/210 (51%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + +  + + P + N   L +++  E ++ DPG + +     +Q        + +TH H D
Sbjct: 31  MKWIQMPLGPLQTNAYILTNDQ-NECIIFDPGHEGEKFVTYLQEEQLKPLAVLLTHAHFD 89

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G    +++   + +    +++  +       +++  +  +     +D  +    TL +
Sbjct: 90  HIGAVDAVRDAFHIPVYVHKEEEDWLGDATVNGSQIFMMNRSITAKPADHIIDAEGTLAI 149

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G+  F++F  PGHSPG + Y   E +    GD LF+ SIGRTD+  G + +LI SI  K+
Sbjct: 150 GSFNFEIFETPGHSPGSISYYCKEASAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKL 209

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
             L DE + +CGHGP ++IG E+  NPFL+
Sbjct: 210 FVLPDETAVLCGHGPETSIGFEKENNPFLQ 239


>gi|52141236|ref|YP_085592.1| metallo-beta-lactamase family protein [Bacillus cereus E33L]
 gi|51974705|gb|AAU16255.1| metallo-beta-lactamase family protein [Bacillus cereus E33L]
          Length = 209

 Score =  168 bits (426), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 60/210 (28%), Positives = 109/210 (51%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + +  + + P + N   L +++  E V+ DPG + + +   +Q        + +TH H D
Sbjct: 1   MKWIQMPLGPLQTNAYILKNDQ-NECVIFDPGHEGEKLVTYLQEEQLKPLAVLLTHAHFD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G    +++   + +    +++  +       +++  +  +     +D  +    TL +
Sbjct: 60  HIGAVDTVRDAFHIPVYVHKEEEDWLGDATVNGSQIFMMNRSITAKPADHIIDAEGTLAI 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G+  F++F  PGHSPG + Y   E +    GD LF+ SIGRTD+  G + +LI SI  K+
Sbjct: 120 GSFNFEIFETPGHSPGSISYYCKEASAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
             L DE + +CGHGP ++IG E+  NPFL+
Sbjct: 180 FVLPDETAVLCGHGPETSIGFEKENNPFLQ 209


>gi|261378660|ref|ZP_05983233.1| metallo-beta-lactamase domain protein [Neisseria cinerea ATCC
           14685]
 gi|269145003|gb|EEZ71421.1| metallo-beta-lactamase domain protein [Neisseria cinerea ATCC
           14685]
          Length = 210

 Score =  168 bits (426), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 84/209 (40%), Positives = 129/209 (61%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L + I+ VTPF+QNCT ++D+ES EAV+ D GGD+  +   + +R   +  IW+THGH+D
Sbjct: 3   LRYEILSVTPFRQNCTLIWDDESGEAVLTDVGGDVPFLLQELANRKLTLTAIWLTHGHLD 62

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GG  ++ +  ++ ++GPH DD  ++  +  Q         +   S +RWL++G+TL +
Sbjct: 63  HAGGVVEMLKTRNVPVLGPHPDDEFLLQSLP-QTTAQYGFPVSPAFSPNRWLEEGETLTV 121

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G + F+V H PGH+PGHV++   E      GD LF  +IGRTD   G++  LIN+I NK+
Sbjct: 122 GRYAFQVLHIPGHTPGHVVFYCAEAELLIAGDVLFYETIGRTDFPRGNHADLINNIRNKL 181

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
             L + +  V GHG  ++IG E+R NPF 
Sbjct: 182 FALPETVQVVAGHGRMTSIGHEKRHNPFF 210


>gi|241758936|ref|ZP_04757048.1| hydroxyacylglutathione hydrolase [Neisseria flavescens SK114]
 gi|241320757|gb|EER56990.1| hydroxyacylglutathione hydrolase [Neisseria flavescens SK114]
          Length = 212

 Score =  168 bits (426), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 85/209 (40%), Positives = 130/209 (62%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L F I  VTPF+QNCT ++D+E+ EAV+ D GGD+  +   +Q++   +  IW+THGH+D
Sbjct: 3   LQFEINAVTPFRQNCTLIWDDETKEAVLTDVGGDVPYLLQQVQNKGLKLTAIWLTHGHLD 62

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GG  +L +   + ++GPHKDD  ++  +  Q         + + +  RWL++G++L +
Sbjct: 63  HAGGVVELLKTCDIPVLGPHKDDEFLLQALP-QTTAQYGFPVSPSFTPTRWLEEGESLKV 121

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G H F+V H PGH+PG V++ N EN     GD LF  ++GRTD   G++  LIN+I  K+
Sbjct: 122 GNHSFQVLHIPGHTPGQVVFYNAENGLLVAGDVLFYETVGRTDFPRGNHDDLINNICAKL 181

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           L L +    + GHG  ++IG E+R NPFL
Sbjct: 182 LTLPETTQVIAGHGRMTSIGHEKRYNPFL 210


>gi|296314833|ref|ZP_06864774.1| metallo-beta-lactamase domain protein [Neisseria polysaccharea ATCC
           43768]
 gi|296838386|gb|EFH22324.1| metallo-beta-lactamase domain protein [Neisseria polysaccharea ATCC
           43768]
          Length = 210

 Score =  168 bits (425), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 82/209 (39%), Positives = 129/209 (61%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L + I+ VTPF+QNCT ++D+ES EAV+ D GGD+  +   + +R   +  IW+THGH+D
Sbjct: 3   LRYEILSVTPFRQNCTLIWDDESGEAVLTDVGGDVPFLLQELANRKLTLTAIWLTHGHLD 62

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GG  ++ +  ++ ++GPH++D  ++  +  Q         +   +  RWL++G+TL +
Sbjct: 63  HAGGVVEMLKTRNVPVLGPHREDEFLLQSLP-QTTAQYGFPVSPAFAPTRWLEEGETLTV 121

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G + F+V H PGH+PGHV++   E      GD LF  +IGRTD   G++  LIN+I NK+
Sbjct: 122 GRYAFQVLHIPGHTPGHVVFYCAEAELLIAGDVLFYETIGRTDFPRGNHADLINNIRNKL 181

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
             L + +  V GHG  ++IG E+R NPF 
Sbjct: 182 FALPETVQVVAGHGRMTSIGHEKRHNPFF 210


>gi|228935582|ref|ZP_04098398.1| Metallo-beta-lactamase [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|228824120|gb|EEM69936.1| Metallo-beta-lactamase [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
          Length = 221

 Score =  168 bits (425), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 60/210 (28%), Positives = 109/210 (51%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + +  + + P + N   L +++  E V+ DPG + + +   +Q        + +TH H D
Sbjct: 13  MKWIQMPLGPLQTNAYILKNDQ-NECVIFDPGHEGEKLVTYLQEEQLKPLAVLLTHAHFD 71

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G    +++   + +    +++  +       +++  +  +     +D  +    TL +
Sbjct: 72  HIGAVDAVRDAFHIPVYVHKEEEDWLGDATVNGSQIFMMNRSITAKPADHIIDAEGTLAI 131

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G+  F++F  PGHSPG + Y   E +    GD LF+ SIGRTD+  G + +LI SI  K+
Sbjct: 132 GSFNFEIFETPGHSPGSISYYCKEASAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKL 191

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
             L DE + +CGHGP ++IG E+  NPFL+
Sbjct: 192 FVLPDETAVLCGHGPETSIGFEKENNPFLQ 221


>gi|229031910|ref|ZP_04187897.1| Metallo-beta-lactamase [Bacillus cereus AH1271]
 gi|228729374|gb|EEL80364.1| Metallo-beta-lactamase [Bacillus cereus AH1271]
          Length = 239

 Score =  168 bits (425), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 59/210 (28%), Positives = 107/210 (50%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + +  + + P + N   L +++  E ++ DPG + + +   +Q        + +TH H D
Sbjct: 31  MKWIQMPLGPLQTNAYILTNDQ-NECIIFDPGHEGEKLVTYLQEEQLKPLAVLLTHAHFD 89

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G    +++   + +    ++   +       +++  +  +     +D  +     L +
Sbjct: 90  HIGAVDAVRDAFHIPVYVHKEEADWLGDATVNGSQIFMMNRSITAKPADHIIDAEGALAI 149

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G+  F++F  PGHSPG + Y   E N    GD LF+ SIGRTD+  G + +LI SI  K+
Sbjct: 150 GSFNFEIFETPGHSPGSISYYCKEANAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKL 209

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
             L DE + +CGHGP ++IG E+  NPFL+
Sbjct: 210 FVLPDETAVLCGHGPETSIGFEKENNPFLQ 239


>gi|255065460|ref|ZP_05317315.1| metallo-beta-lactamase domain protein [Neisseria sicca ATCC 29256]
 gi|255050285|gb|EET45749.1| metallo-beta-lactamase domain protein [Neisseria sicca ATCC 29256]
          Length = 248

 Score =  168 bits (425), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 84/209 (40%), Positives = 126/209 (60%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L   I+ VTPF+QNCT L+D+E+ EAV+ D GGD+  +   + ++N  +  IW+THGH+D
Sbjct: 41  LQAEIIAVTPFRQNCTLLWDDETREAVLTDVGGDVPYLLQELDAKNLTLTAIWLTHGHLD 100

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GG  +L+E   + +IGPH DD  ++  + E        + +      RWL +G+TL +
Sbjct: 101 HAGGVVELREHRPVPVIGPHADDGFLLQALPETTAQYGFPV-SPAFEPTRWLTEGETLKV 159

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G+H F+V H PGH+PGHV++   E      GD LF  +IGRTD   G++  LI++I  K+
Sbjct: 160 GSHAFQVLHIPGHTPGHVVFYCAEAGLLIAGDVLFYETIGRTDFPRGNHADLIHNIRTKL 219

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
             L ++   + GHG  + IG E+R NPF 
Sbjct: 220 FVLPEDTRVIAGHGRMTDIGHEKRHNPFF 248


>gi|218893201|ref|YP_002442070.1| hypothetical protein PLES_44861 [Pseudomonas aeruginosa LESB58]
 gi|218773429|emb|CAW29241.1| conserved hypothetical protein [Pseudomonas aeruginosa LESB58]
          Length = 214

 Score =  168 bits (425), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 71/208 (34%), Positives = 107/208 (51%), Gaps = 4/208 (1%)

Query: 7   HIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVG 66
               V P + NCT + D  + +A+VVDPGGD ++I   +      V  I  TH H+DH  
Sbjct: 11  ETFPVGPLQCNCTIIGDPLTRKAIVVDPGGDHELILQRLDRLGLQVVSIIHTHAHLDHFL 70

Query: 67  GAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTH 126
            + ++K+    ++   HKDD  +   ++ Q +L  +      A  DRWL D + L  G  
Sbjct: 71  ASGEMKKRTGASLH-LHKDDQFLWDNLEMQCQLFGVPYTPVPA-PDRWLADDEELACGC- 127

Query: 127 IFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPL 186
                H PGH+PG + +          GDTLFR  IGRTD+  GD   +  SI  ++  L
Sbjct: 128 -GVALHTPGHTPGSMSFWFPRAKLLIAGDTLFRRGIGRTDLWGGDSAAIQRSIRQRLYSL 186

Query: 187 GDEISFVCGHGPNSTIGRERRLNPFLKS 214
            ++ + V GHGP++T+G E R NPF++ 
Sbjct: 187 DEDATVVAGHGPDTTLGEEMRENPFVRG 214


>gi|218767379|ref|YP_002341891.1| putative hydrolase [Neisseria meningitidis Z2491]
 gi|121051387|emb|CAM07679.1| putative hydrolase [Neisseria meningitidis Z2491]
 gi|254673753|emb|CBA09424.1| glyoxalase II family protein [Neisseria meningitidis alpha275]
 gi|319409640|emb|CBY89940.1| putative metallo-dependent hydrolase [Neisseria meningitidis WUE
           2594]
 gi|325133375|gb|EGC56040.1| metallo-beta-lactamase domain protein [Neisseria meningitidis
           M13399]
 gi|325206953|gb|ADZ02406.1| metallo-beta-lactamase domain protein [Neisseria meningitidis
           M04-240196]
          Length = 210

 Score =  168 bits (425), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 82/209 (39%), Positives = 128/209 (61%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L + I+ VTPF+QNCT ++D+ES EAV+ D GGD+  +   + +R   +  IW+THGH+D
Sbjct: 3   LRYEILSVTPFRQNCTLIWDDESGEAVLTDVGGDVPFLLQALANRKLTLTAIWLTHGHLD 62

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GG  ++ +   + ++GPH DD  ++  +  Q         +   + +RWL++G+TL +
Sbjct: 63  HAGGVVEMLKTHKVPVLGPHPDDEFLLQSLP-QTTAQYGFPVSPAFAPNRWLEEGETLTV 121

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G + F+V H PGH+PGH+++   E      GD LF  +IGRTD   G++  LIN+I NK+
Sbjct: 122 GRYAFQVLHIPGHTPGHIVFYCAEAELLIAGDVLFYETIGRTDFPRGNHADLINNIRNKL 181

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
             L + +  V GHG  ++IG E+R NPF 
Sbjct: 182 FALPETVQVVAGHGRMTSIGHEKRHNPFF 210


>gi|56964264|ref|YP_175995.1| hypothetical protein ABC2499 [Bacillus clausii KSM-K16]
 gi|56910507|dbj|BAD65034.1| conserved hypothetical protein [Bacillus clausii KSM-K16]
          Length = 209

 Score =  168 bits (425), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 71/209 (33%), Positives = 113/209 (54%), Gaps = 2/209 (0%)

Query: 6   FHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHV 65
           +  + + P + N   L++E+  EAV+ DPGGD     + I+ +    + I +TH H DH+
Sbjct: 2   YTQIPLGPLQTNAYVLYNEK-KEAVLFDPGGDGAAFVNWIREQKLTPQAILLTHAHFDHI 60

Query: 66  GGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGT 125
           G   ++++  +  +   H+ +   +    +       R   +   +D  L+D  TL +G+
Sbjct: 61  GALEEVRQAFACPVY-LHEAEKQWLLDPLKNGSARMGRQPIKTKPADHLLKDEGTLKVGS 119

Query: 126 HIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILP 185
             FK+FH PGHSPG V Y   + N    GD LF+  IGRTD+  G+++ L+ SI+NK+L 
Sbjct: 120 FSFKLFHTPGHSPGSVSYYVADENIVFSGDALFQQGIGRTDLFGGNHELLVQSIHNKLLT 179

Query: 186 LGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           L +E     GHGP +TIG+E   NPFL  
Sbjct: 180 LPEETIVASGHGPLTTIGQEMDHNPFLNG 208


>gi|15596029|ref|NP_249523.1| hypothetical protein PA0832 [Pseudomonas aeruginosa PAO1]
 gi|254239184|ref|ZP_04932507.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719]
 gi|254245119|ref|ZP_04938441.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192]
 gi|313105708|ref|ZP_07791971.1| hypothetical protein PA39016_000110005 [Pseudomonas aeruginosa
           39016]
 gi|9946727|gb|AAG04221.1|AE004518_2 conserved hypothetical protein [Pseudomonas aeruginosa PAO1]
 gi|126171115|gb|EAZ56626.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719]
 gi|126198497|gb|EAZ62560.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192]
 gi|310878473|gb|EFQ37067.1| hypothetical protein PA39016_000110005 [Pseudomonas aeruginosa
           39016]
          Length = 213

 Score =  168 bits (425), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 71/208 (34%), Positives = 107/208 (51%), Gaps = 4/208 (1%)

Query: 7   HIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVG 66
               V P + NCT + D  + +A+VVDPGGD ++I   +      V  I  TH H+DH  
Sbjct: 10  ETFPVGPLQCNCTIIGDPLTRKAIVVDPGGDHELILQRLDRLGLQVVSIIHTHAHLDHFL 69

Query: 67  GAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTH 126
            + ++K+    ++   HKDD  +   ++ Q +L  +      A  DRWL D + L  G  
Sbjct: 70  ASGEMKKRTGASLH-LHKDDQFLWDNLEMQCQLFGVPYTPVPA-PDRWLADDEELACGC- 126

Query: 127 IFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPL 186
                H PGH+PG + +          GDTLFR  IGRTD+  GD   +  SI  ++  L
Sbjct: 127 -GVALHTPGHTPGSMSFWFPRAKLLIAGDTLFRRGIGRTDLWGGDSAAIQRSIRQRLYSL 185

Query: 187 GDEISFVCGHGPNSTIGRERRLNPFLKS 214
            ++ + V GHGP++T+G E R NPF++ 
Sbjct: 186 DEDATVVAGHGPDTTLGEEMRENPFVRG 213


>gi|229111734|ref|ZP_04241282.1| Metallo-beta-lactamase [Bacillus cereus Rock1-15]
 gi|228671728|gb|EEL27024.1| Metallo-beta-lactamase [Bacillus cereus Rock1-15]
          Length = 209

 Score =  168 bits (425), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 61/210 (29%), Positives = 109/210 (51%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + +  + + P + N   L +++  E ++ DPG + + +   +Q        + +TH H D
Sbjct: 1   MKWIQMPLGPLQTNAYILMNDQ-KECIIFDPGHEGEKLVTYLQEEQLKPLAVLLTHAHFD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G    +++   + +    ++   +       +++  +  +     +D  +    TL +
Sbjct: 60  HIGAVDAVRDAFYIPVYVHKEEADWLGDATVNGSQIFMMNRSITAKPADHIIDAEGTLTI 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G+  F+VF  PGHSPG + Y + E N    GD LF+ SIGRTD+  G + +LI SI  K+
Sbjct: 120 GSFNFEVFETPGHSPGSISYYSKEANAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
             L DE + +CGHGP ++IG E+  NPFL+
Sbjct: 180 FVLPDETAVLCGHGPETSIGFEKENNPFLQ 209


>gi|229047979|ref|ZP_04193555.1| Metallo-beta-lactamase [Bacillus cereus AH676]
 gi|228723436|gb|EEL74805.1| Metallo-beta-lactamase [Bacillus cereus AH676]
          Length = 209

 Score =  168 bits (425), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 61/210 (29%), Positives = 110/210 (52%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + +  + + P + N   L +++  E ++ DPG + + +   +Q        + +TH H D
Sbjct: 1   MKWIQMPLGPLQTNAYILMNDQ-KECIIFDPGHEGEKLVTYLQEEQLKPLAVLLTHAHFD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G    +++   + +    ++   +       +++  +  +     +D  +    TL +
Sbjct: 60  HIGAVDAVRDAFYIPVYVHKEEADWLGDATVNGSQIFMMNRSITAKPADHIIDAEGTLTI 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G+  F+VF  PGHSPG + Y + E N    GD LF++SIGRTD+  G + +LI SI  K+
Sbjct: 120 GSFNFEVFETPGHSPGSISYYSKEANAVFSGDVLFQTSIGRTDLPGGSFAELIGSIEEKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
             L DE + +CGHGP ++IG E+  NPFL+
Sbjct: 180 FVLPDETAVLCGHGPETSIGFEKENNPFLQ 209


>gi|257465086|ref|ZP_05629457.1| glyoxalase II family protein [Actinobacillus minor 202]
 gi|257450746|gb|EEV24789.1| glyoxalase II family protein [Actinobacillus minor 202]
          Length = 209

 Score =  168 bits (425), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 71/209 (33%), Positives = 125/209 (59%), Gaps = 2/209 (0%)

Query: 5   SFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDH 64
           +  I+ V+PF+QNC+ ++D ++  A ++D G + + I   ++ +  +V+++ ITH H+DH
Sbjct: 3   NLQIIPVSPFQQNCSVIWD-DNKNAAIIDAGDNAERIIQFVEQQELNVEKLLITHAHLDH 61

Query: 65  VGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLG 124
           +     +++   + + G H  D  +  ++ +      +    +    D WL +GD + +G
Sbjct: 62  IMAVESVRDHFGVPVYGSHLADKPLFEQLPQMCEKFGLPP-VKGFLPDHWLTEGDEVTVG 120

Query: 125 THIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKIL 184
              F + H PGH+PGH+ + +FEN  A  GD LF+ SIGRTD+  G+++QLI++I  K+ 
Sbjct: 121 ALKFNIRHLPGHAPGHIGFFDFENKIAFSGDVLFKDSIGRTDLYLGNFEQLIDTIKTKMF 180

Query: 185 PLGDEISFVCGHGPNSTIGRERRLNPFLK 213
            L D+   + GHG ++TIGRE+  NPFLK
Sbjct: 181 DLEDDFIIIPGHGAHTTIGREKVHNPFLK 209


>gi|325135280|gb|EGC57901.1| metallo-beta-lactamase domain protein [Neisseria meningitidis
           M0579]
 gi|325143606|gb|EGC65926.1| metallo-beta-lactamase domain protein [Neisseria meningitidis
           M01-240013]
 gi|325201314|gb|ADY96768.1| metallo-beta-lactamase domain protein [Neisseria meningitidis
           M01-240149]
 gi|325208900|gb|ADZ04352.1| metallo-beta-lactamase domain protein [Neisseria meningitidis
           NZ-05/33]
          Length = 210

 Score =  168 bits (425), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 82/209 (39%), Positives = 127/209 (60%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L + I+ VTPF+QNCT ++D+ES EAV+ D GGD+  +   + +R   +  IW+THGH+D
Sbjct: 3   LRYEILSVTPFRQNCTLIWDDESGEAVLTDVGGDVPFLLQALANRKLTLTAIWLTHGHLD 62

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GG  ++ +   + ++GPH DD  ++  +  Q         +   + + WL++G+TL +
Sbjct: 63  HAGGVVEMLKTHKVPVLGPHPDDEFLLQSLP-QTTAQYGFPVSPAFAPNHWLEEGETLKV 121

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G + F+V H PGH+PGHV++   E      GD LF  +IGRTD   G++  LIN+I NK+
Sbjct: 122 GRYAFQVLHIPGHTPGHVVFYCAEAELLIAGDVLFYETIGRTDFPRGNHADLINNIRNKL 181

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
             L + +  V GHG  ++IG E+R NPF 
Sbjct: 182 FALPETVQVVAGHGRMTSIGHEKRHNPFF 210


>gi|110801728|ref|YP_699212.1| metallo-beta-lactamase family protein [Clostridium perfringens
           SM101]
 gi|110682229|gb|ABG85599.1| metallo-beta-lactamase family protein [Clostridium perfringens
           SM101]
          Length = 206

 Score =  168 bits (425), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 77/213 (36%), Positives = 116/213 (54%), Gaps = 12/213 (5%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +    + V  ++ NC  + DEE+ + ++VDPG +   I++VI+S +   K I +THGH D
Sbjct: 1   MLIKTIPVGMYQANCYVVIDEETKDCIIVDPGEEASRIENVIESLDAKPKMILLTHGHFD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG   +L E   +            + K DE     ++ +  +   +D +L+DGDTL  
Sbjct: 61  HVGAVQKLAEKYKIP---------FYIDKKDEDMIERNVDVFGKLPKADGYLKDGDTLKF 111

Query: 124 -GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
              +  K    PGH+P         +N    GDTLFR SIGR+D   G++  L+ SIN+K
Sbjct: 112 SDNYEIKCLETPGHTP--GGLCFLIDNCLFTGDTLFRESIGRSDFEGGNHATLLKSINDK 169

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFLKSN 215
           ++PLGD+I    GHGP+STI  ER+ NPFL  +
Sbjct: 170 LVPLGDDIVVYPGHGPSSTIKHERQRNPFLAGD 202


>gi|77360344|ref|YP_339919.1| metallo-hydrolase/oxidoreductase domain-containing protein
           [Pseudoalteromonas haloplanktis TAC125]
 gi|76875255|emb|CAI86476.1| putative enzyme with metallo-hydrolase/oxidoreductase domain
           [Pseudoalteromonas haloplanktis TAC125]
          Length = 213

 Score =  168 bits (425), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 82/209 (39%), Positives = 119/209 (56%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +    + VT F QNC  +   +S +AVVVDPGGD + I   ++  +  +  IW+THGH+D
Sbjct: 1   MHIITIPVTAFAQNCRIIACSQSKQAVVVDPGGDYNKIVAALKQHDLTLTAIWLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG A  L+   S+ IIGPHKD+      +  QA++            D WL   D + +
Sbjct: 61  HVGAADALRNTYSVKIIGPHKDEHFWFENLPMQAQMFGF-AAVTAFYPDEWLAHDDIIRV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   F V HCPGH+PGHV++   +     +GD +F+ S+GRTD   GD QQLI SI  +I
Sbjct: 120 GELSFIVRHCPGHTPGHVVFYQPQQQCVIVGDVIFKGSVGRTDFPKGDAQQLITSIKTQI 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           + L D    + GHG ++ +G E++ NPF+
Sbjct: 180 MTLPDNTRILAGHGSDTNVGYEKQNNPFI 208


>gi|30022341|ref|NP_833972.1| hydroxyacylglutathione hydrolase [Bacillus cereus ATCC 14579]
 gi|29897898|gb|AAP11173.1| Hydroxyacylglutathione hydrolase [Bacillus cereus ATCC 14579]
          Length = 209

 Score =  168 bits (425), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 60/210 (28%), Positives = 109/210 (51%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + +  + + P + N   L +++  E ++ DPG + + +   +Q +      + +TH H D
Sbjct: 1   MKWIQMPLGPLQTNAYILMNDQ-KECIIFDPGHEGEKLVTYLQEKQLKPLAVLLTHAHFD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G    +++   + +    ++   +       +++  +  +     +D  +    TL +
Sbjct: 60  HIGAVDAVRDAFHIPVYVHKEEADWLGDATVNGSQIFMMNRSITAKPADHIIDAEGTLTI 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G+  F++F  PGHSPG + Y   E N    GD LF+ SIGRTD+  G + +LI SI  K+
Sbjct: 120 GSFNFEIFETPGHSPGSISYYTKEANAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
             L DE + +CGHGP ++IG E+  NPFL+
Sbjct: 180 FVLPDETAVLCGHGPETSIGFEKENNPFLQ 209


>gi|188997639|ref|YP_001931890.1| beta-lactamase domain protein [Sulfurihydrogenibium sp. YO3AOP1]
 gi|188932706|gb|ACD67336.1| beta-lactamase domain protein [Sulfurihydrogenibium sp. YO3AOP1]
          Length = 212

 Score =  167 bits (424), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 75/209 (35%), Positives = 116/209 (55%), Gaps = 5/209 (2%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +    + V P  +NC  +FD  S +AVV+DPG D + I + ++  + +VK I  THGH+D
Sbjct: 1   MKVKTLTVGPLAENCFIVFDGNSKDAVVIDPGADGEFILNELK--DLNVKAILATHGHLD 58

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G    LKE L++      KD+  +  ++        I    +  S D  ++DGD L  
Sbjct: 59  HIGQVGYLKEKLNVPFYMNKKDEFLINNEIFPNFA--YIIKAVKCPSPDFDVKDGDVLKF 116

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   F+V   PGH+PG V + N +     +GDTLF+ S+GRTD+  G+ + L  S+  K+
Sbjct: 117 GNLEFQVIETPGHTPGSVCFFNEKEKIIFVGDTLFKGSVGRTDLPGGNGKMLEESLK-KL 175

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           + L ++     GHGP +TIG E+R NPF+
Sbjct: 176 MELPEDTVVYSGHGPKTTIGIEKRTNPFI 204


>gi|65321639|ref|ZP_00394598.1| COG0491: Zn-dependent hydrolases, including glyoxylases [Bacillus
           anthracis str. A2012]
          Length = 238

 Score =  167 bits (424), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 62/210 (29%), Positives = 109/210 (51%), Gaps = 2/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + +  + + P + N   L +++  E V+ DPG + + +   +Q        + +TH H D
Sbjct: 31  MKWIQMPLGPLQTNAYILKNDK-NECVIFDPGHEGEKLVTYLQEEQLKPLAVLLTHAHFD 89

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G     ++   + +   HK++  +       +++  +  +     +D  +    TL +
Sbjct: 90  HIGAVDAXRDAFHIPVY-VHKEEDWLGDXXVNGSQIFMMNRSITAKPADHIIDAEGTLAI 148

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G+  F++F  PGHSPG + Y   E +    GD LF+ SIGRTD+  G + +LI SI  K+
Sbjct: 149 GSFNFEIFETPGHSPGSISYYCKEASAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKL 208

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
             L DE + +CGHGP ++IG E+  NPFL+
Sbjct: 209 FVLPDETAVLCGHGPETSIGFEKENNPFLQ 238


>gi|228980949|ref|ZP_04141252.1| Metallo-beta-lactamase [Bacillus thuringiensis Bt407]
 gi|228778740|gb|EEM27004.1| Metallo-beta-lactamase [Bacillus thuringiensis Bt407]
          Length = 239

 Score =  167 bits (424), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 59/210 (28%), Positives = 109/210 (51%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + +  + + P + N   L +++  E ++ DPG + + +   +Q        + +TH H D
Sbjct: 31  MKWIQMPLGPLQTNAYILMNDQ-KECIIFDPGHEGEKLVTYLQEEQLKPLAVLLTHAHFD 89

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G    +++   + +    ++   +       +++  +  +     +D  +    TL +
Sbjct: 90  HIGAVDAVRDAFHIPVYVHKEEADWLGDATVNGSQIFMMNRSITAKPADHIIDAEGTLTI 149

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G+  F++F  PGHSPG + Y + E N    GD LF+ SIGRTD+  G + +LI SI  K+
Sbjct: 150 GSFNFEIFETPGHSPGSISYYSKEANAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKL 209

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
             L DE + +CGHGP ++IG E+  NPF++
Sbjct: 210 FVLPDETAVLCGHGPETSIGFEKENNPFVQ 239


>gi|218233520|ref|YP_002369066.1| metallo-beta-lactamase family protein [Bacillus cereus B4264]
 gi|218161477|gb|ACK61469.1| metallo-beta-lactamase family protein [Bacillus cereus B4264]
          Length = 209

 Score =  167 bits (424), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 60/210 (28%), Positives = 109/210 (51%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + +  + + P + N   L +++  E ++ DPG + + +   +Q        + +TH H D
Sbjct: 1   MKWIQMPLGPLQTNAYILMNDQ-KECIIFDPGHEGEKLVTYLQEEQLKPLAVLLTHAHFD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G    +++   + +    ++   +       +++  +  +     +D  +    TL +
Sbjct: 60  HIGAVDAVRDAFHIPVYVHKEEADWLGDATVNGSQIFMMNRSITAKPADHIIDAEGTLTI 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G+  F++F  PGHSPG + Y + E N    GD LF+ SIGRTD+  G + +LI SI  K+
Sbjct: 120 GSFNFEIFETPGHSPGSISYYSKEANAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
             L DE + +CGHGP ++IG E+  NPFL+
Sbjct: 180 FVLPDETAVLCGHGPETSIGFEKENNPFLQ 209


>gi|227824348|ref|ZP_03989180.1| beta-lactamase [Acidaminococcus sp. D21]
 gi|226904847|gb|EEH90765.1| beta-lactamase [Acidaminococcus sp. D21]
          Length = 207

 Score =  167 bits (424), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 62/211 (29%), Positives = 106/211 (50%), Gaps = 5/211 (2%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFH-VKQIWITHGHV 62
           +  + + V P ++NC  + +EE+ E +++DPG +   I + ++      +  I+ITHGH 
Sbjct: 1   MKLYRIVVGPIQENCYLIKNEETGEGIIIDPGDEALKIMEAVKKAGIKKITAIFITHGHG 60

Query: 63  DHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLL 122
           DH+    ++K+     +    +D   +  +V   +   S   +      D + +DG T+ 
Sbjct: 61  DHISALDEVKKLTGAKVYMSREDAPML--RVWNSSLSYSTDRDKTFDPPDVYFEDGMTVT 118

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
                F +   PGH+          +    +GDT+F  SIGRTD+  G Y  ++ SI  K
Sbjct: 119 EAGLTFTIAATPGHT--LGGVCIIGDGVVFVGDTIFLESIGRTDLPGGSYDDILTSIKTK 176

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           +L L D+     GHGP++T+G ERR NPFL+
Sbjct: 177 LLTLPDDYRLFPGHGPDTTVGWERRRNPFLQ 207


>gi|75763951|ref|ZP_00743580.1| Hydroxyacylglutathione hydrolase [Bacillus thuringiensis serovar
           israelensis ATCC 35646]
 gi|218899427|ref|YP_002447838.1| metallo-beta-lactamase family protein [Bacillus cereus G9842]
 gi|228902775|ref|ZP_04066921.1| Metallo-beta-lactamase [Bacillus thuringiensis IBL 4222]
 gi|74488563|gb|EAO52150.1| Hydroxyacylglutathione hydrolase [Bacillus thuringiensis serovar
           israelensis ATCC 35646]
 gi|218541364|gb|ACK93758.1| metallo-beta-lactamase family protein [Bacillus cereus G9842]
 gi|228856849|gb|EEN01363.1| Metallo-beta-lactamase [Bacillus thuringiensis IBL 4222]
          Length = 209

 Score =  167 bits (424), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 60/210 (28%), Positives = 109/210 (51%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + +  + + P + N   L +++  E ++ DPG + + +   +Q        + +TH H D
Sbjct: 1   MKWIQMPLGPLQTNAYILMNDQ-KECIIFDPGHEGEKLVTYLQEEQLKPLAVLLTHAHFD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G    +++   + +    ++   +       +++  +  +     +D  +    TL +
Sbjct: 60  HIGAVDAVRDAFYIPVYVHKEEADWLGDATVNGSQIFMMNRSITAKPADHIIDAEGTLTI 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G+  F++F  PGHSPG + Y + E N    GD LF+ SIGRTD+  G + +LI SI  K+
Sbjct: 120 GSFNFEIFETPGHSPGSISYYSKEANAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
             L DE + +CGHGP ++IG E+  NPFL+
Sbjct: 180 FVLPDETAVLCGHGPETSIGFEKENNPFLQ 209


>gi|229192471|ref|ZP_04319434.1| Metallo-beta-lactamase [Bacillus cereus ATCC 10876]
 gi|228591048|gb|EEK48904.1| Metallo-beta-lactamase [Bacillus cereus ATCC 10876]
          Length = 239

 Score =  167 bits (424), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 60/210 (28%), Positives = 109/210 (51%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + +  + + P + N   L +++  E ++ DPG + + +   +Q        + +TH H D
Sbjct: 31  MKWIQMPLGPLQTNAYILMNDQ-KECIIFDPGHEGEKLVTYVQEEQLKPLAVLLTHAHFD 89

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G    +++   + +    ++   +       +++  +  +     +D  +    TL +
Sbjct: 90  HIGAVDAVRDTFHIPVYVHKEEADWLGDATVNGSQIFMMNRSITAKPADHIIDAEGTLTI 149

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G+  F++F  PGHSPG + Y + E N    GD LF+ SIGRTD+  G + +LI SI  K+
Sbjct: 150 GSFNFEIFETPGHSPGSISYYSKEANAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKL 209

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
             L DE + +CGHGP ++IG E+  NPFL+
Sbjct: 210 FVLPDETAVLCGHGPETSIGFEKENNPFLQ 239


>gi|291535023|emb|CBL08135.1| Zn-dependent hydrolases, including glyoxylases [Roseburia
           intestinalis M50/1]
          Length = 209

 Score =  167 bits (424), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 70/212 (33%), Positives = 101/212 (47%), Gaps = 3/212 (1%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M+ L      V P + NC F  ++++ E +V+DPG   D +   I+        I +THG
Sbjct: 1   MAPLKVEQYVVGPVQTNCYFAINDDTKEVLVIDPGASADQLAKKIRQEKLTPIAILLTHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H DH GGA +L +   + I     +   +         L       +   +D +L++   
Sbjct: 61  HFDHAGGAEELAKHFDIKIYAEEHEKETL---DTPSLNLSGWEGVQKTYHADVFLKNEQE 117

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           + L     +VFH PGH+ G   Y     N    GDTLF +S+GRTD   G   Q+I SI 
Sbjct: 118 IDLAGFHIRVFHTPGHTVGGCCYYFPYQNVVFSGDTLFCTSVGRTDFPKGSAAQIIRSIK 177

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
            K+LPL DE +   GH   +TIG ER  NP+L
Sbjct: 178 EKLLPLPDETTVYTGHNDITTIGAERMYNPYL 209


>gi|212638742|ref|YP_002315262.1| Zn-dependent hydrolase [Anoxybacillus flavithermus WK1]
 gi|212560222|gb|ACJ33277.1| Zn-dependent hydrolase [Anoxybacillus flavithermus WK1]
          Length = 210

 Score =  167 bits (424), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 67/211 (31%), Positives = 104/211 (49%), Gaps = 2/211 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + +  + + P + N   L  E +   ++ DPG + + +   I++  +    + +TH H D
Sbjct: 1   MKWERIPLGPLQTNAYVLVHE-NGTCLIFDPGSEGEKLIHYIETNGWTPLAVLLTHAHFD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G    +K   S+ +   HK +   +    +   LL +        +D  L+   TL +
Sbjct: 60  HIGAVDDVKNKWSIPVY-VHKKEQHWLTDPMKNGSLLFMGEAITTNDADVLLEGEKTLTI 118

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +VF  PGHSPG V Y   +      GD LF  SIGRTD+  G Y+QL+ SI+ K+
Sbjct: 119 GDFSLQVFETPGHSPGSVSYYIEDAQVIVSGDVLFSGSIGRTDLPGGSYEQLLQSIHRKL 178

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           L L +E   +CGHGP +TI  E   NPFL  
Sbjct: 179 LVLPEETIVLCGHGPETTIEAEMNTNPFLNG 209


>gi|291522835|emb|CBK81128.1| Zn-dependent hydrolases, including glyoxylases [Coprococcus catus
           GD/7]
          Length = 209

 Score =  167 bits (424), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 60/212 (28%), Positives = 101/212 (47%), Gaps = 3/212 (1%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M ++    + +     NC  + ++E+ EA++VDP  +   I +VI+     +K I +THG
Sbjct: 1   MGQIEIKSMTLGMVATNCYLIINKENKEALLVDPADNALRISNVIEENGCTLKAILLTHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H DH+     LK+  ++ +    +++  +         L           +D +++DG+ 
Sbjct: 61  HFDHIMALNDLKKRYNVPVYAHEEEEDVLKQS---SLNLSGSIGQIYTTQADVYVKDGEH 117

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           L L      V + PGH+ G   Y   E      GDTLF  SIGRTD   G   QL+ S+ 
Sbjct: 118 LKLAGLDVIVLYTPGHTKGGACYYFPEEKVLMSGDTLFHCSIGRTDFPTGSMSQLVRSVK 177

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
            ++  L D++    GH   ++IG E++ NPF 
Sbjct: 178 EQLFVLPDDVQVYPGHDSVTSIGYEKQYNPFF 209


>gi|42783387|ref|NP_980634.1| metallo-beta-lactamase family protein [Bacillus cereus ATCC 10987]
 gi|206977971|ref|ZP_03238857.1| metallo-beta-lactamase family protein [Bacillus cereus H3081.97]
 gi|217961752|ref|YP_002340322.1| metallo-beta-lactamase family protein [Bacillus cereus AH187]
 gi|222097706|ref|YP_002531763.1| metallo-beta-lactamase family protein [Bacillus cereus Q1]
 gi|42739315|gb|AAS43242.1| metallo-beta-lactamase family protein [Bacillus cereus ATCC 10987]
 gi|206743771|gb|EDZ55192.1| metallo-beta-lactamase family protein [Bacillus cereus H3081.97]
 gi|217067370|gb|ACJ81620.1| metallo-beta-lactamase family protein [Bacillus cereus AH187]
 gi|221241765|gb|ACM14475.1| metallo-beta-lactamase family protein [Bacillus cereus Q1]
 gi|324328167|gb|ADY23427.1| metallo-beta-lactamase family protein [Bacillus thuringiensis
           serovar finitimus YBT-020]
          Length = 209

 Score =  167 bits (424), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 60/210 (28%), Positives = 107/210 (50%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + +  + + P + N   L +E+  E ++ DPG + + +   +Q        + +TH H D
Sbjct: 1   MKWIQMPLGPLQTNAYILTNEQ-NECIIFDPGHEGEKLVTYLQEEQLKPLAVLLTHAHFD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G    +++   + +    ++   +       +++  +  +     +D  +     L +
Sbjct: 60  HIGAVDAVRDAFHIPVYVHKEEADWLGDATVNGSQIFMMNRSITAKPADHIIDAEGALAI 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G+  F++F  PGHSPG + Y   E N    GD LF+ SIGRTD+  G + +LI SI  K+
Sbjct: 120 GSFNFEIFETPGHSPGSISYYCKEANAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
             L DE + +CGHGP ++IG E+  NPFL+
Sbjct: 180 FVLPDETAVLCGHGPETSIGFEKENNPFLQ 209


>gi|288819083|ref|YP_003433431.1| beta-lactamase family protein [Hydrogenobacter thermophilus TK-6]
 gi|288788483|dbj|BAI70230.1| beta-lactamase family protein [Hydrogenobacter thermophilus TK-6]
 gi|308752666|gb|ADO46149.1| conserved hypothetical protein [Hydrogenobacter thermophilus TK-6]
          Length = 210

 Score =  167 bits (423), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 66/211 (31%), Positives = 105/211 (49%), Gaps = 3/211 (1%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +   ++ V     NC+ + DEE  +AVV+DPG D + I++ +    F ++ I  THGH+D
Sbjct: 1   MMLKVIPVGILSVNCSVILDEEEGKAVVIDPGADAERIEEAMD--GFELQAIICTHGHID 58

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG    LKE   +     H+ D  ++           I         D +L+DG  + +
Sbjct: 59  HVGQVKTLKEKYRVP-FYMHRSDLFLINDPIWPGFEKQIGCALPCPEPDEFLEDGSEIKV 117

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G+   +V + PGH+PG       ++     GD LF+ S+GR D+  G+ + L  S+    
Sbjct: 118 GSISLEVLYTPGHTPGLCCLYMKDHGVLIAGDLLFKGSVGRWDLPGGNLEDLKKSLARVF 177

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
             L D+   +CGH   +TIG ER  NP+L+S
Sbjct: 178 KELPDDTLVICGHYEETTIGHERVFNPYLRS 208


>gi|240948091|ref|ZP_04752501.1| glyoxalase II family protein [Actinobacillus minor NM305]
 gi|240297571|gb|EER48063.1| glyoxalase II family protein [Actinobacillus minor NM305]
          Length = 209

 Score =  167 bits (423), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 74/209 (35%), Positives = 125/209 (59%), Gaps = 2/209 (0%)

Query: 5   SFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDH 64
           +  I+ V+PF+QNC+ ++D ++  A ++D G + D I   ++ +  HV+++ ITH H+DH
Sbjct: 3   NLQIIPVSPFQQNCSVIWD-DNKNAAIIDAGDNADRIIQFVEQQELHVEKLLITHAHLDH 61

Query: 65  VGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLG 124
           +     +++     + G H  D  +  ++ +      +    +    D WL +GD + +G
Sbjct: 62  IMAVETVRDHFGAQVYGSHLADKPLFEQLPQMCEKFGLPP-VQGFLPDHWLTEGDEVTVG 120

Query: 125 THIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKIL 184
           T  F + H PGH+PGH+ + +FEN  A  GD LF+ SIGRTD+  G+++QLI++I  K+ 
Sbjct: 121 TLKFNIRHLPGHAPGHIGFFDFENKIAFSGDVLFKDSIGRTDLYLGNFEQLIDTIKTKMF 180

Query: 185 PLGDEISFVCGHGPNSTIGRERRLNPFLK 213
            L D+   + GHG ++TIGRE+  NPFLK
Sbjct: 181 DLEDDFIIIPGHGAHTTIGREKAHNPFLK 209


>gi|228954545|ref|ZP_04116570.1| Metallo-beta-lactamase [Bacillus thuringiensis serovar kurstaki
           str. T03a001]
 gi|228805202|gb|EEM51796.1| Metallo-beta-lactamase [Bacillus thuringiensis serovar kurstaki
           str. T03a001]
          Length = 252

 Score =  167 bits (423), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 60/210 (28%), Positives = 109/210 (51%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + +  + + P + N   L +++  E ++ DPG + + +   +Q        + +TH H D
Sbjct: 44  MKWIQMPLGPLQTNAYILMNDQ-KECIIFDPGHEGEKLVTYLQEEQLKPLAVLLTHAHFD 102

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G    +++   + +    ++   +       +++  +  +     +D  +    TL +
Sbjct: 103 HIGAVDAVRDTFHIPVYVHKEEADWLGDATVNGSQIFMMNRSITAKPADHIIDAEGTLTI 162

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G+  F++F  PGHSPG + Y + E N    GD LF+ SIGRTD+  G + +LI SI  K+
Sbjct: 163 GSFNFEIFETPGHSPGSISYYSKEANAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKL 222

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
             L DE + +CGHGP ++IG E+  NPFL+
Sbjct: 223 FVLPDETAVLCGHGPETSIGFEKENNPFLQ 252


>gi|85858796|ref|YP_460998.1| hydroxyacylglutathione hydrolase W [Syntrophus aciditrophicus SB]
 gi|85721887|gb|ABC76830.1| hydroxyacylglutathione hydrolase W [Syntrophus aciditrophicus SB]
          Length = 257

 Score =  167 bits (423), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 73/216 (33%), Positives = 105/216 (48%), Gaps = 9/216 (4%)

Query: 2   SKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGH 61
             L    +QV         + D E+ +A+V+DP  ++D I    +  N  +K I  THGH
Sbjct: 47  PMLVIRQMQVGSMAVFAYLVGDSETGDALVIDPADNIDGILATAEKNNLRIKYIVNTHGH 106

Query: 62  VDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
           +DH+ G  ++K      I   H+ DA M+G       LL +     +  +D  ++DGDT+
Sbjct: 107 IDHISGNREMKSRTDAPI-IIHEGDARMLGNTSPM--LLHMFGAEDSPPADMTVKDGDTI 163

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
            +G    KV H PGHSP       +   F   GDTLF  S+GRTD+      Q+  SI  
Sbjct: 164 TVGKISLKVIHTPGHSP--GGMCLYIKGFVFTGDTLFVESVGRTDLNGSSASQMFRSIRE 221

Query: 182 KILPLGDEISFVCGHGP----NSTIGRERRLNPFLK 213
           K+L L D+   + GH       STIG E+  NPFL+
Sbjct: 222 KLLTLPDDTQVLPGHNYGRTSTSTIGHEKIYNPFLQ 257


>gi|296504758|ref|YP_003666458.1| hydroxyacylglutathione hydrolase [Bacillus thuringiensis BMB171]
 gi|296325810|gb|ADH08738.1| hydroxyacylglutathione hydrolase [Bacillus thuringiensis BMB171]
          Length = 209

 Score =  167 bits (423), Expect = 9e-40,   Method: Composition-based stats.
 Identities = 60/210 (28%), Positives = 108/210 (51%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + +  + + P + N   L +++  E ++ DPG + + +   +Q        + +TH H D
Sbjct: 1   MKWIQMPLGPLQTNAYILMNDQ-KECIIFDPGHEGEKLVTYLQEEQLKPLAVLLTHAHFD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G    +++   + +    ++   +       +++  +  +     +D  +    TL +
Sbjct: 60  HIGAVDAVRDAFHIPVYVHKEEADWLGDATVNGSQIFMMNRSITAKPADHIIDAEGTLTI 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   F++F  PGHSPG + Y + E N    GD LF+ SIGRTD+  G + +LI SI  K+
Sbjct: 120 GLFNFEIFETPGHSPGSISYYSKEANAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
             L DE + +CGHGP ++IG E+  NPFL+
Sbjct: 180 FVLPDETAVLCGHGPETSIGFEKENNPFLQ 209


>gi|91203527|emb|CAJ71180.1| similar to hydroxyacylglutathione hydrolase (glyoxalase II)
           [Candidatus Kuenenia stuttgartiensis]
          Length = 210

 Score =  167 bits (423), Expect = 9e-40,   Method: Composition-based stats.
 Identities = 70/211 (33%), Positives = 109/211 (51%), Gaps = 4/211 (1%)

Query: 2   SKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGH 61
             + F  ++V P   NC  +       A V+D GG++  I ++++ +N  +K I  TH H
Sbjct: 4   PDIIFETLEVGPLSVNCYIIGSRSDNTAAVIDAGGNVKEIVEILKKQNLTLKYIINTHAH 63

Query: 62  VDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
            DHVGG ++L           H+ D  ++  +DEQ+    +    +    DR+L D + L
Sbjct: 64  FDHVGGVSELHALTGAP-FLLHQGDVPLLDFLDEQSNYFGLPPIPK-PKVDRYLIDNEEL 121

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
            LG  + ++ H PGHSP         NN    GDTLF  S+GRTD+  G +  LINS+  
Sbjct: 122 PLGDEVIRIIHTPGHSP--GCVCFLFNNAIFAGDTLFAGSVGRTDLYGGSHDTLINSVKT 179

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           ++  L D +    GHGP +TIG+E++ NP+ 
Sbjct: 180 RLFTLEDHVLVYPGHGPVTTIGKEKKHNPYF 210


>gi|49475897|ref|YP_033938.1| hypothetical protein BH11740 [Bartonella henselae str. Houston-1]
 gi|49238705|emb|CAF27957.1| hypothetical protein BH11740 [Bartonella henselae str. Houston-1]
          Length = 216

 Score =  167 bits (423), Expect = 9e-40,   Method: Composition-based stats.
 Identities = 112/214 (52%), Positives = 141/214 (65%), Gaps = 1/214 (0%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M     HI+ VT F+QNCT LFD E    V+VDPGGD   I+DVI+     V+ IWITHG
Sbjct: 1   MVSFRTHIIPVTSFQQNCTLLFDNERKVGVLVDPGGDWLQIQDVIRKNGVIVEAIWITHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H DHVG A Q KE L++ IIG H+DD  +M  V E A    I   AR    D+WL+DGD+
Sbjct: 61  HFDHVGAAMQAKEALNVKIIGSHRDDKPVMDAVRESAESYGITD-ARICVPDQWLEDGDS 119

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           +    H+F+V+H PGHSPGHVIY N +  FA LGD LFR SIGRTD     ++ L+ S+ 
Sbjct: 120 VHFAGHVFRVYHTPGHSPGHVIYFNEKERFALLGDVLFRGSIGRTDFPFCSHKDLMKSLR 179

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
            K+LPLGD++ F+CGHGP S +G ER+ NPFL+ 
Sbjct: 180 EKVLPLGDDVRFICGHGPGSYLGYERQWNPFLQG 213


>gi|256831173|ref|YP_003159901.1| beta-lactamase domain-containing protein [Desulfomicrobium
           baculatum DSM 4028]
 gi|256580349|gb|ACU91485.1| beta-lactamase domain protein [Desulfomicrobium baculatum DSM 4028]
          Length = 209

 Score =  167 bits (423), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 66/213 (30%), Positives = 99/213 (46%), Gaps = 6/213 (2%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L   ++ + P   NC  +  +   EAVV+DPGG+   I   + S   ++  I  TH H D
Sbjct: 2   LKVTVMPLGPLDTNCYVVHSD--REAVVIDPGGEAQEILSFLASEKLNLTAILNTHLHFD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+ G A L     LT++   KD   +  ++        +        S   L++G  L L
Sbjct: 60  HIQGNADLVAATGLTVMASAKDGFLLENELG---GGGMMGFPRTPPFSYSPLEEG-ELPL 115

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
                +V   PGHSPG + +   E     +GD LF  S+GRTD      ++LI S+ + I
Sbjct: 116 LGTTCRVLATPGHSPGSLSFYFQELGAVFVGDLLFYRSVGRTDFPGSSERELIRSVRSAI 175

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
             L +E     GHGP +T+G+E+  NPF    I
Sbjct: 176 FTLPEETVVYPGHGPETTVGQEKLNNPFFTEFI 208


>gi|237808753|ref|YP_002893193.1| beta-lactamase domain-containing protein [Tolumonas auensis DSM
           9187]
 gi|237501014|gb|ACQ93607.1| beta-lactamase domain protein [Tolumonas auensis DSM 9187]
          Length = 214

 Score =  167 bits (423), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 88/209 (42%), Positives = 137/209 (65%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L + I+ VT F+QNCT L+ +E+ +A ++DPGGD++ +   ++  N  + ++ +THGH+D
Sbjct: 2   LQYQIIPVTAFQQNCTLLWCDETHQAALIDPGGDIEKLLQAVEKNNLTLTKLLLTHGHLD 61

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVGGA +L++     IIGPH+ DA  +  +  Q+ +     +    + D WL + DT+ +
Sbjct: 62  HVGGADKLRKRTGCPIIGPHQADAFWLNALPAQSEMFGF-AHTDVFTPDNWLTETDTVTV 120

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGHV++ + ++  A +GD LF  SIGRTD   G++  LIN+I  K+
Sbjct: 121 GNLELQVLHCPGHTPGHVVFYHADSQLAIVGDVLFNGSIGRTDFPQGNHTDLINAITQKL 180

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           LPLGD++ F+ GHGP ST+G ER  NP+L
Sbjct: 181 LPLGDDVKFIPGHGPMSTLGHERVSNPYL 209


>gi|289207721|ref|YP_003459787.1| beta-lactamase [Thioalkalivibrio sp. K90mix]
 gi|288943352|gb|ADC71051.1| beta-lactamase domain protein [Thioalkalivibrio sp. K90mix]
          Length = 226

 Score =  167 bits (422), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 83/203 (40%), Positives = 122/203 (60%), Gaps = 1/203 (0%)

Query: 10  QVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAA 69
            VT   QN T ++ +++  A  VDPG + D +  + + ++  +  I +THGH+DHVG AA
Sbjct: 8   PVTALAQNATLIWCDQTRVAAWVDPGAEPDTLIAIARQQDVRLDCILLTHGHLDHVGAAA 67

Query: 70  QLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFK 129
           ++     + I+GP  +DA  + ++  Q ++            DRWLQDG+ L LG    +
Sbjct: 68  EMARRCDIPILGPQVEDAFWLDQLPMQCQMFGFPELPALV-PDRWLQDGEQLPLGKVTLE 126

Query: 130 VFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDE 189
           V HCPGH+PGHV + + E+  A +GD LF  +IGR+D   G+  QLI SI  ++ PLGD+
Sbjct: 127 VLHCPGHTPGHVAFFDRESRLALVGDVLFHGAIGRSDFPRGNGPQLIESITRRLWPLGDD 186

Query: 190 ISFVCGHGPNSTIGRERRLNPFL 212
           + FV GHGP ST G ERR NPF+
Sbjct: 187 VRFVPGHGPESTFGEERRSNPFV 209


>gi|229071764|ref|ZP_04204979.1| Metallo-beta-lactamase [Bacillus cereus F65185]
 gi|228711359|gb|EEL63319.1| Metallo-beta-lactamase [Bacillus cereus F65185]
          Length = 209

 Score =  167 bits (422), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 60/210 (28%), Positives = 109/210 (51%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + +  + + P + N   L +++  E ++ DPG + + +   +Q        + +TH H D
Sbjct: 1   MKWIQMPLGPLQTNAYILMNDQ-KECIIFDPGHEGEKLVTYLQEEQLKPLAVLLTHAHFD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G    +++   + +    ++   +       +++  +  +     +D  +    TL +
Sbjct: 60  HIGAVDAVRDTFHIPVYVHKEEADWLGDATVNGSQIFMMNRSITAKPADHIIDAEGTLTI 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G+  F++F  PGHSPG + Y + E N    GD LF+ SIGRTD+  G + +LI SI  K+
Sbjct: 120 GSFNFEIFETPGHSPGSISYYSKEANAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
             L DE + +CGHGP ++IG E+  NPFL+
Sbjct: 180 FVLPDETAVLCGHGPETSIGFEKENNPFLQ 209


>gi|168204881|ref|ZP_02630886.1| metallo-beta-lactamase family protein [Clostridium perfringens E
           str. JGS1987]
 gi|170663698|gb|EDT16381.1| metallo-beta-lactamase family protein [Clostridium perfringens E
           str. JGS1987]
          Length = 206

 Score =  167 bits (422), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 77/213 (36%), Positives = 116/213 (54%), Gaps = 12/213 (5%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +    + V  ++ NC  + DEE+ + ++VDPG +   I+ VI+S +   K I +THGH D
Sbjct: 1   MLIKTIPVGMYQANCYVVIDEETKDCIIVDPGEEASRIESVIESLDAKPKMILLTHGHFD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG   +L E   +            + K DE     ++ +  +   +D +L+DGDTL  
Sbjct: 61  HVGAVQKLAEKYKIP---------FYIDKKDEDMIERNVDVFGKLPKADGYLKDGDTLKF 111

Query: 124 -GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
              +  K    PGH+P         +N    GDTLFR SIGR+D   G++  L+ SIN+K
Sbjct: 112 SDNYEIKCLETPGHTP--GGLCFLIDNCLFTGDTLFRESIGRSDFEGGNHATLLKSINDK 169

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFLKSN 215
           ++PLGD+I+   GHGP+STI  ER+ NPFL  +
Sbjct: 170 LVPLGDDIAVYPGHGPSSTIKHERQRNPFLAGD 202


>gi|158320741|ref|YP_001513248.1| beta-lactamase domain-containing protein [Alkaliphilus oremlandii
           OhILAs]
 gi|158140940|gb|ABW19252.1| beta-lactamase domain protein [Alkaliphilus oremlandii OhILAs]
          Length = 206

 Score =  167 bits (422), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 71/210 (33%), Positives = 113/210 (53%), Gaps = 4/210 (1%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +    V    +  NC  + DE++ +A VVDPGGD+D I  V+++ +  +K I +TH H D
Sbjct: 1   MFLEKVPAGVYAVNCYVIGDEQTNKAAVVDPGGDVDKIIKVLENNDLELKYILLTHAHGD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+GG  +L+E     +   H++D  M+             +     ++D +L DGD L L
Sbjct: 61  HIGGLVELRERTGAPVY-IHQEDLYMLQNSSVNYSQAISGVKIET-NADGFLNDGDRLEL 118

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     + H PGHS           N    GDTLF +SIGR+D+  G+ ++LI SI NK+
Sbjct: 119 GDLTLSIIHTPGHS--KGGICIAVGNVLLTGDTLFANSIGRSDLYGGNQEELIQSIKNKL 176

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
             L ++++ + GHGP +TI  E+  NP+++
Sbjct: 177 FTLDEDLTVLPGHGPATTIRIEKITNPYVR 206


>gi|307249327|ref|ZP_07531321.1| hypothetical protein appser4_1410 [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
 gi|306858621|gb|EFM90683.1| hypothetical protein appser4_1410 [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
          Length = 219

 Score =  167 bits (422), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 77/209 (36%), Positives = 127/209 (60%), Gaps = 2/209 (0%)

Query: 5   SFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDH 64
           +  I+ V+ F+QNC+ ++D ++  A ++D G D D I   ++S+N  V+++ +THGH+DH
Sbjct: 13  NLQIIPVSAFQQNCSVIWD-DNKNAAIIDAGDDADKIIQFVESQNLKVQKLLLTHGHLDH 71

Query: 65  VGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLG 124
           +    ++++   + + G H DD  +  ++ +   +  I    +    D WL + D + +G
Sbjct: 72  IMAVEKVRDHFGVEVYGSHIDDKPLFEQLPQMCEMFGIPP-VKAFLPDHWLSENDRVEVG 130

Query: 125 THIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKIL 184
              F V H PGH+PGH+ + +FEN  A  GD LF+ SIGRTD+  G+   L+N+I  K+ 
Sbjct: 131 ALRFSVRHLPGHAPGHIGFFDFENKIAFSGDVLFKDSIGRTDLYLGNLDVLLNTIRTKMF 190

Query: 185 PLGDEISFVCGHGPNSTIGRERRLNPFLK 213
            L D+   V GHGP++TIGRE++ NPFLK
Sbjct: 191 DLDDDFIVVAGHGPHTTIGREKQHNPFLK 219


>gi|206971234|ref|ZP_03232185.1| metallo-beta-lactamase family protein [Bacillus cereus AH1134]
 gi|206734006|gb|EDZ51177.1| metallo-beta-lactamase family protein [Bacillus cereus AH1134]
          Length = 209

 Score =  167 bits (422), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 60/210 (28%), Positives = 109/210 (51%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + +  + + P + N   L +++  E ++ DPG + + +   +Q        + +TH H D
Sbjct: 1   MKWIQMPLGPLQTNAYILMNDQ-KECIIFDPGHEGEKLVTYVQEEQLKPLAVLLTHAHFD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G    +++   + +    ++   +       +++  +  +     +D  +    TL +
Sbjct: 60  HIGAVDAVRDAFHIPVYVHKEEADWLGDATVNGSQIFMMNRSITAKPADHIIDAEGTLTI 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G+  F++F  PGHSPG + Y + E N    GD LF+ SIGRTD+  G + +LI SI  K+
Sbjct: 120 GSFNFEIFETPGHSPGSISYYSKEANAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
             L DE + +CGHGP ++IG E+  NPFL+
Sbjct: 180 FVLPDETAVLCGHGPETSIGFEKENNPFLQ 209


>gi|229543853|ref|ZP_04432912.1| beta-lactamase domain protein [Bacillus coagulans 36D1]
 gi|229324992|gb|EEN90668.1| beta-lactamase domain protein [Bacillus coagulans 36D1]
          Length = 209

 Score =  167 bits (422), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 61/209 (29%), Positives = 100/209 (47%), Gaps = 2/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + +  + V P + NC  L+++E  + ++ DPG +   +   I         + +TH H D
Sbjct: 1   MKWKQLPVGPIQTNCYILWNDE-KDCLIFDPGAEFHRLHAFIGENGLKPHAVLLTHAHFD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G    +++   +     H+ +   +G   +               +++ +   D L +
Sbjct: 60  HIGALDAVRDAYKIP-AYVHQKEEMWLGDPGQNGSYFFGMGEISARGAEKLITGEDILKI 118

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V   PGHSPG V Y   E+N    GD LF  SIGRTD+  G++  L+ SI+ K+
Sbjct: 119 GAFSLHVLETPGHSPGSVSYWLPEHNIVFSGDALFSGSIGRTDLPGGNHGVLLESIHTKL 178

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           L L  +   + GHGP +TIG E+  NPFL
Sbjct: 179 LVLHPDTIVLPGHGPQTTIGAEKDSNPFL 207


>gi|169829077|ref|YP_001699235.1| hypothetical protein Bsph_3619 [Lysinibacillus sphaericus C3-41]
 gi|168993565|gb|ACA41105.1| Hypothetical yqgX protein [Lysinibacillus sphaericus C3-41]
          Length = 214

 Score =  167 bits (422), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 57/214 (26%), Positives = 106/214 (49%), Gaps = 5/214 (2%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           ++     + P + NC  + +++  E +V DPG + + +   I+S       I++TH H D
Sbjct: 2   MNVRSFSLGPVQTNCYIVSNKD-KECIVFDPGEEAERLLKTIRSNGLKPLAIFLTHAHFD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLS---IRMNARNASSDRWLQDGDT 120
           H+G    ++E  ++ +   H+ + + +G  ++                 + D  ++    
Sbjct: 61  HIGAVDAVREAFNIPVW-IHEKEVSWLGDPEKNGSSKYAALPDYRVAAPAQDTIIKKEQQ 119

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
             +   +F+    PGHSPG + YV  ++ FA +GDTLF   +GRTD++ G  + L+ SI+
Sbjct: 120 FEISNFVFQAVFTPGHSPGSISYVFEKDGFAIVGDTLFEQGVGRTDLIGGSTKILLASIH 179

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           +K+L L ++     GHG  +T+  E   NPFL  
Sbjct: 180 DKLLTLPEDTIIYPGHGNYTTVSAEMETNPFLNG 213


>gi|59802341|ref|YP_209053.1| putative hydrolase [Neisseria gonorrhoeae FA 1090]
 gi|59719236|gb|AAW90641.1| putative hydrolase [Neisseria gonorrhoeae FA 1090]
          Length = 210

 Score =  167 bits (422), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 81/209 (38%), Positives = 127/209 (60%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L + I+ VTPF+QNCT ++D+ES EAV+ D GGD+  +   + +R   +  IW+THGH+D
Sbjct: 3   LRYEILPVTPFRQNCTLIWDDESGEAVLTDVGGDVPFLLQALANRKLTLTAIWLTHGHLD 62

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GG  ++ E   + ++GPH++D  ++  +  Q         +   + +RWL++G+TL +
Sbjct: 63  HAGGVVEMLETHKVPVLGPHREDEFLLQSLP-QTTAQYGFPVSPAFAPNRWLEEGETLTV 121

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G + F+V H PGH+PGHV++   E      GD LF  +IGRTD   G++  LIN+I NK+
Sbjct: 122 GRYAFQVLHIPGHTPGHVVFYCAEAELLIAGDVLFYETIGRTDFPRGNHADLINNIRNKL 181

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
               + +  V GH   ++IG E+R NPF 
Sbjct: 182 FAFPETVQVVAGHERMTSIGHEKRHNPFF 210


>gi|30264333|ref|NP_846710.1| metallo-beta-lactamase family protein [Bacillus anthracis str.
           Ames]
 gi|47529780|ref|YP_021129.1| metallo-beta-lactamase family protein [Bacillus anthracis str.
           'Ames Ancestor']
 gi|49187160|ref|YP_030412.1| metallo-beta-lactamase family protein [Bacillus anthracis str.
           Sterne]
 gi|165872070|ref|ZP_02216710.1| metallo-beta-lactamase family protein [Bacillus anthracis str.
           A0488]
 gi|167634677|ref|ZP_02392997.1| metallo-beta-lactamase family protein [Bacillus anthracis str.
           A0442]
 gi|167638646|ref|ZP_02396922.1| metallo-beta-lactamase family protein [Bacillus anthracis str.
           A0193]
 gi|170687412|ref|ZP_02878629.1| metallo-beta-lactamase family protein [Bacillus anthracis str.
           A0465]
 gi|170707422|ref|ZP_02897876.1| metallo-beta-lactamase family protein [Bacillus anthracis str.
           A0389]
 gi|177655038|ref|ZP_02936704.1| metallo-beta-lactamase family protein [Bacillus anthracis str.
           A0174]
 gi|190566061|ref|ZP_03018980.1| metallo-beta-lactamase family protein [Bacillus anthracis
           Tsiankovskii-I]
 gi|227817036|ref|YP_002817045.1| metallo-beta-lactamase family protein [Bacillus anthracis str. CDC
           684]
 gi|229603832|ref|YP_002868551.1| metallo-beta-lactamase family protein [Bacillus anthracis str.
           A0248]
 gi|254684020|ref|ZP_05147880.1| metallo-beta-lactamase family protein [Bacillus anthracis str.
           CNEVA-9066]
 gi|254736369|ref|ZP_05194075.1| metallo-beta-lactamase family protein [Bacillus anthracis str.
           Western North America USA6153]
 gi|254741406|ref|ZP_05199093.1| metallo-beta-lactamase family protein [Bacillus anthracis str.
           Kruger B]
 gi|254753958|ref|ZP_05205993.1| metallo-beta-lactamase family protein [Bacillus anthracis str.
           Vollum]
 gi|254757829|ref|ZP_05209856.1| metallo-beta-lactamase family protein [Bacillus anthracis str.
           Australia 94]
 gi|30258978|gb|AAP28196.1| metallo-beta-lactamase family protein [Bacillus anthracis str.
           Ames]
 gi|47504928|gb|AAT33604.1| metallo-beta-lactamase family protein [Bacillus anthracis str.
           'Ames Ancestor']
 gi|49181087|gb|AAT56463.1| metallo-beta-lactamase family protein [Bacillus anthracis str.
           Sterne]
 gi|164712201|gb|EDR17738.1| metallo-beta-lactamase family protein [Bacillus anthracis str.
           A0488]
 gi|167513494|gb|EDR88864.1| metallo-beta-lactamase family protein [Bacillus anthracis str.
           A0193]
 gi|167530129|gb|EDR92864.1| metallo-beta-lactamase family protein [Bacillus anthracis str.
           A0442]
 gi|170127666|gb|EDS96539.1| metallo-beta-lactamase family protein [Bacillus anthracis str.
           A0389]
 gi|170668607|gb|EDT19353.1| metallo-beta-lactamase family protein [Bacillus anthracis str.
           A0465]
 gi|172080299|gb|EDT65388.1| metallo-beta-lactamase family protein [Bacillus anthracis str.
           A0174]
 gi|190562980|gb|EDV16946.1| metallo-beta-lactamase family protein [Bacillus anthracis
           Tsiankovskii-I]
 gi|227007663|gb|ACP17406.1| metallo-beta-lactamase family protein [Bacillus anthracis str. CDC
           684]
 gi|229268240|gb|ACQ49877.1| metallo-beta-lactamase family protein [Bacillus anthracis str.
           A0248]
          Length = 208

 Score =  167 bits (422), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 62/210 (29%), Positives = 110/210 (52%), Gaps = 2/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + +  + + P + N   L +++  E V+ DPG + + +   +Q        + +TH H D
Sbjct: 1   MKWIQMPLGPLQTNAYILKNDK-NECVIFDPGHEGEKLVTYLQEEQLKPLAVLLTHAHFD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G    +++   + +   HK++  +       +++  +  +     +D  +    TL +
Sbjct: 60  HIGAVDAVRDAFHIPVY-VHKEEDWLGDATVNGSQIFMMNRSITAKPADHIIDAEGTLAI 118

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G+  F++F  PGHSPG + Y   E +    GD LF+ SIGRTD+  G + +LI SI  K+
Sbjct: 119 GSFNFEIFETPGHSPGSISYYCKEASAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKL 178

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
             L DE + +CGHGP ++IG E+  NPFL+
Sbjct: 179 FVLPDETAVLCGHGPETSIGFEKENNPFLQ 208


>gi|158522083|ref|YP_001529953.1| beta-lactamase domain-containing protein [Desulfococcus oleovorans
           Hxd3]
 gi|158510909|gb|ABW67876.1| beta-lactamase domain protein [Desulfococcus oleovorans Hxd3]
          Length = 210

 Score =  167 bits (422), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 81/210 (38%), Positives = 114/210 (54%), Gaps = 6/210 (2%)

Query: 4   LSF--HIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGH 61
           ++     ++V     NC  +  +++ +AVV+DPG + D I   +      VK I  THGH
Sbjct: 1   MNVILEKLEVGMIMANCFIVGCDQTKQAVVIDPGDEADRILYHLAENKLSVKYIINTHGH 60

Query: 62  VDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
            DHVG   +LK+     +   H  DA M+  + + A    I         DR +++GD +
Sbjct: 61  FDHVGANKELKKATGAEL-LIHAADAPMLSGLSQMASAFGIAAENSPP-PDRTVKEGDVI 118

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
             GT   KV H PGHSPG +      +  A +GDTLF  SIGRTD   GD+  LI++I  
Sbjct: 119 SFGTIEMKVLHTPGHSPGGISL--VTDKKAFVGDTLFAGSIGRTDFPGGDFDTLISAIQT 176

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPF 211
           K+ PLGD+++  CGHGP +TIG ERR NPF
Sbjct: 177 KLFPLGDDVTVYCGHGPETTIGMERRTNPF 206


>gi|256419464|ref|YP_003120117.1| beta-lactamase domain protein [Chitinophaga pinensis DSM 2588]
 gi|256034372|gb|ACU57916.1| beta-lactamase domain protein [Chitinophaga pinensis DSM 2588]
          Length = 212

 Score =  166 bits (421), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 66/214 (30%), Positives = 110/214 (51%), Gaps = 7/214 (3%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLD----IIKDVIQSRNFHVKQIWITH 59
           +        PF++N   L +E+  E +++DPG   +     +++ I+     V ++  TH
Sbjct: 2   MEIQHFTFNPFQENTYLLINEK-KECIIIDPGCYFEEERKQLQNYIEKEGLKVTRLLNTH 60

Query: 60  GHVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGD 119
            H+DH+ G   +     + +   H  D  ++ +  E  ++ +I     +    R+L+DG+
Sbjct: 61  CHIDHILGNKLVVTTYGVGLE-IHPLDKILLDRSPEIGKMYNIPF-DPSPEPVRFLEDGE 118

Query: 120 TLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSI 179
            +  G    +V   PGHSPG V + +    F   GD LF  SIGRTD+  G +Q L+NSI
Sbjct: 119 KITFGDDELEVLLTPGHSPGSVCFYSAAGKFVIGGDVLFFQSIGRTDLPGGSHQTLLNSI 178

Query: 180 NNKILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
             K+  L D++    GHG ++TIG E++ NPFLK
Sbjct: 179 QEKLFVLPDDVRVYPGHGQSTTIGYEKQHNPFLK 212


>gi|126653941|ref|ZP_01725780.1| YqgX [Bacillus sp. B14905]
 gi|126589544|gb|EAZ83685.1| YqgX [Bacillus sp. B14905]
          Length = 214

 Score =  166 bits (421), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 57/214 (26%), Positives = 104/214 (48%), Gaps = 5/214 (2%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           ++     + P + NC  + +++  E +V DPG + + +   I+S       I++TH H D
Sbjct: 2   MNVRSFSLGPVQTNCYIVSNKD-KECIVFDPGEEAERLIKTIRSNGLKPLAIFLTHAHFD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLS---IRMNARNASSDRWLQDGDT 120
           H+G    ++E  ++ +   H+ + + +G  ++                   D  ++    
Sbjct: 61  HIGAVDAVREAFNVPVW-IHEKEVSWLGDPEKNGSSKYAALPDYRVAAPDQDTIIKKEQQ 119

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
             +   +F+    PGHSPG + YV   + FA +GDTLF   +GRTD++ G  + L+ SI+
Sbjct: 120 FEISNFVFQAVFTPGHSPGSISYVFENDGFAIVGDTLFEQGVGRTDLIGGSTKILLASIH 179

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           +K+L L ++     GHG  +T+  E   NPFL  
Sbjct: 180 DKLLTLPEDTIIYPGHGNYTTVSAEMETNPFLNG 213


>gi|110800702|ref|YP_696615.1| metallo-beta-lactamase family protein [Clostridium perfringens ATCC
           13124]
 gi|110675349|gb|ABG84336.1| metallo-beta-lactamase family protein [Clostridium perfringens ATCC
           13124]
          Length = 206

 Score =  166 bits (421), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 77/213 (36%), Positives = 116/213 (54%), Gaps = 12/213 (5%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +    + V  ++ NC  + DEE+ + ++VDPG +   I+ VI+S +   K I +THGH D
Sbjct: 1   MLIKTIPVGMYQANCYVVIDEETKDCIIVDPGEEASRIESVIESLDAKPKMILLTHGHFD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG   +L E   +            + K DE     ++ +  +   +D +L+DGDTL  
Sbjct: 61  HVGAVQKLAEKYKIP---------FYIDKKDEDMIERNVDVFGKLPKADGYLKDGDTLKF 111

Query: 124 -GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
              +  K    PGH+P         +N    GDTLFR SIGR+D   G++  L+ SIN+K
Sbjct: 112 SDNYEIKCLETPGHTP--GGLCFLIDNCLFTGDTLFRESIGRSDFEGGNHSTLLKSINDK 169

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFLKSN 215
           ++PLGD+I+   GHGP+STI  ER+ NPFL  +
Sbjct: 170 LVPLGDDIAVYPGHGPSSTIKHERQRNPFLAGD 202


>gi|307247106|ref|ZP_07529158.1| hypothetical protein appser2_1050 [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
 gi|307251650|ref|ZP_07533555.1| hypothetical protein appser6_1720 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|307262710|ref|ZP_07544338.1| hypothetical protein appser13_1370 [Actinobacillus pleuropneumoniae
           serovar 13 str. N273]
 gi|306856355|gb|EFM88506.1| hypothetical protein appser2_1050 [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
 gi|306860847|gb|EFM92855.1| hypothetical protein appser6_1720 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|306871965|gb|EFN03681.1| hypothetical protein appser13_1370 [Actinobacillus pleuropneumoniae
           serovar 13 str. N273]
          Length = 219

 Score =  166 bits (421), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 77/209 (36%), Positives = 127/209 (60%), Gaps = 2/209 (0%)

Query: 5   SFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDH 64
           +  I+ V+ F+QNC+ ++D ++  A ++D G D D I   ++S+N  V+++ +THGH+DH
Sbjct: 13  NLQIIPVSAFQQNCSVIWD-DNKNAAIIDAGDDADKIIQFVESQNLKVQKLLLTHGHLDH 71

Query: 65  VGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLG 124
           +    ++++   + + G H DD  +  ++ +   +  I    +    D WL + D + +G
Sbjct: 72  IMAVEKVRDHFGVEVYGSHIDDKPLFEQLPQMCEMFGIPP-VKAFLPDHWLSEDDRVEVG 130

Query: 125 THIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKIL 184
              F V H PGH+PGH+ + +FEN  A  GD LF+ SIGRTD+  G+   L+N+I  K+ 
Sbjct: 131 ALRFSVRHLPGHAPGHIGFFDFENKIAFSGDVLFKDSIGRTDLYLGNLDVLLNTIRTKMF 190

Query: 185 PLGDEISFVCGHGPNSTIGRERRLNPFLK 213
            L D+   V GHGP++TIGRE++ NPFLK
Sbjct: 191 DLDDDFIVVAGHGPHTTIGREKQHNPFLK 219


>gi|229163206|ref|ZP_04291161.1| Metallo-beta-lactamase [Bacillus cereus R309803]
 gi|228620269|gb|EEK77140.1| Metallo-beta-lactamase [Bacillus cereus R309803]
          Length = 209

 Score =  166 bits (421), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 59/210 (28%), Positives = 106/210 (50%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + +  + + P + N   L +++  E ++ DPG +   +   +Q        + +TH H D
Sbjct: 1   MKWTQMPLGPLQTNAYILMNDQ-NECIIFDPGHEGSKLVTYLQEEQLKPLAVLLTHAHFD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G    +++   + +    ++   +       +++  +  +     +D  +     L +
Sbjct: 60  HIGAVDAVRDAFHIPVYVHKEEADWLGDATVNGSQIFMMNRSITAKPADHIIDAEGALTI 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G+  F++F  PGHSPG + Y   E N    GD LF+ SIGRTD+  G + +LI SI  K+
Sbjct: 120 GSFNFEIFETPGHSPGSISYYCKEANAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
             L DE + +CGHGP ++IG E+  NPFL+
Sbjct: 180 FVLPDETAVLCGHGPETSIGFEKENNPFLQ 209


>gi|225386907|ref|ZP_03756671.1| hypothetical protein CLOSTASPAR_00655 [Clostridium asparagiforme
           DSM 15981]
 gi|225046919|gb|EEG57165.1| hypothetical protein CLOSTASPAR_00655 [Clostridium asparagiforme
           DSM 15981]
          Length = 217

 Score =  166 bits (421), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 61/210 (29%), Positives = 93/210 (44%), Gaps = 2/210 (0%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           MS L      +     NC  L++  S EAV+VDPG +   I +  +  +     + +THG
Sbjct: 1   MSDLRIKTCVLGAVSTNCYILYNCTSKEAVIVDPGDNAPYIMNKCRELDVKPVAVALTHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H DH+    +L     + +     +DA +       +          +  +D  L+DG  
Sbjct: 61  HFDHILAVPELSRSFHVPVYASAVEDAMLADTSLNLSGTCDSE--PTSFHADELLRDGQE 118

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
             L    +K+   PGH+ G   Y          GDTLF  S GRTD+  G   QL+ SI 
Sbjct: 119 FTLLGLNWKLIATPGHTAGSACYYIAGEGVLLAGDTLFADSYGRTDLPTGSSAQLVESIL 178

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNP 210
           +K+  L ++     GHG  +TIG E++ NP
Sbjct: 179 DKLFVLPEDTMVYPGHGDPTTIGHEKQYNP 208


>gi|323142305|ref|ZP_08077137.1| metallo-beta-lactamase domain protein [Phascolarctobacterium sp.
           YIT 12067]
 gi|322413189|gb|EFY04076.1| metallo-beta-lactamase domain protein [Phascolarctobacterium sp.
           YIT 12067]
          Length = 208

 Score =  166 bits (421), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 75/210 (35%), Positives = 108/210 (51%), Gaps = 2/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +  + V+      NC F  +E   E V+ DPGGD   I  +I+     V  I +THGH D
Sbjct: 1   MKIYHVEAGMLATNCYFAVNEAIGEGVIFDPGGDCPTILRMIEQAKAKVVAIVLTHGHSD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G  A+L++     +    +DDA  + + +       I    +N  +D  + DGD L L
Sbjct: 61  HIGALAELRKATGAPVY-IGEDDADCLTQPNRNLSFF-IGEELKNEPADHLVHDGDVLEL 118

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
               F+ F  PGH+ G   Y          GDT+F  SIGRTD+  G Y+ LI SI  K+
Sbjct: 119 AGMKFEAFATPGHTKGGFCYYYAPGKVVFAGDTIFCESIGRTDLPGGSYRALIQSIKTKL 178

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           + L D++  + GHGP +T+G ERR NPFL+
Sbjct: 179 MVLDDDVKLLPGHGPTTTVGWERRRNPFLQ 208


>gi|228941425|ref|ZP_04103976.1| Metallo-beta-lactamase [Bacillus thuringiensis serovar berliner
           ATCC 10792]
 gi|228974356|ref|ZP_04134925.1| Metallo-beta-lactamase [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228785406|gb|EEM33416.1| Metallo-beta-lactamase [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228818206|gb|EEM64280.1| Metallo-beta-lactamase [Bacillus thuringiensis serovar berliner
           ATCC 10792]
 gi|326942043|gb|AEA17939.1| hydroxyacylglutathione hydrolase [Bacillus thuringiensis serovar
           chinensis CT-43]
          Length = 209

 Score =  166 bits (421), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 59/210 (28%), Positives = 109/210 (51%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + +  + + P + N   L +++  E ++ DPG + + +   +Q        + +TH H D
Sbjct: 1   MKWIQMPLGPLQTNAYILMNDQ-KECIIFDPGHEGEKLVTYLQEEQLKPLAVLLTHAHFD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G    +++   + +    ++   +       +++  +  +     +D  +    TL +
Sbjct: 60  HIGAVDAVRDAFHIPVYVHKEEADWLGDATVNGSQIFMMNRSITAKPADHIIDAEGTLTI 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G+  F++F  PGHSPG + Y + E N    GD LF+ SIGRTD+  G + +LI SI  K+
Sbjct: 120 GSFNFEIFETPGHSPGSISYYSKEANAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
             L DE + +CGHGP ++IG E+  NPF++
Sbjct: 180 FVLPDETAVLCGHGPETSIGFEKENNPFVQ 209


>gi|332968630|gb|EGK07684.1| metallo-beta-lactamase domain protein [Kingella kingae ATCC 23330]
          Length = 212

 Score =  166 bits (420), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 77/211 (36%), Positives = 126/211 (59%), Gaps = 1/211 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L + I  VTPF+QNCT L+D+++ +A + D GGD D +   +Q R+  +++IW+THGH+D
Sbjct: 3   LQYQIFPVTPFRQNCTLLWDDQTGDAALTDVGGDTDYLIHALQQRDLTLREIWLTHGHLD 62

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GG   L +  ++ ++GPH DD  ++  + +        +     +  RWL + D++ +
Sbjct: 63  HAGGVPFLLQTHNVPVLGPHADDEFLLQSLPDTTASYGFPVC-PAFTPTRWLNEDDSVNV 121

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G + F+V H  GH+PGHV++   +      GD LF  SIGRTD   G++Q L+N+I  K+
Sbjct: 122 GAYTFQVLHIDGHTPGHVVFYCEQAKLLIAGDVLFYESIGRTDFPRGNHQALLNNIAQKL 181

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
             L D+   + GH   +TIG E++ NPF++ 
Sbjct: 182 YVLPDDTLVIAGHARTTTIGHEKQYNPFVRG 212


>gi|332187046|ref|ZP_08388787.1| metallo-beta-lactamase superfamily protein [Sphingomonas sp. S17]
 gi|332013056|gb|EGI55120.1| metallo-beta-lactamase superfamily protein [Sphingomonas sp. S17]
          Length = 247

 Score =  166 bits (420), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 87/215 (40%), Positives = 131/215 (60%), Gaps = 2/215 (0%)

Query: 2   SKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGH 61
             L   IV VTP +QNC+ ++   +++A VVDPGGDL  I+D I      V++I +THGH
Sbjct: 31  PPLRAAIVPVTPLQQNCSIVWCTATMKAAVVDPGGDLPRIQDAITKTGVTVEKILLTHGH 90

Query: 62  VDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
           +DH GGA  L + L + + GP ++D   + ++DE  +   I   A+     RWL +GD +
Sbjct: 91  IDHAGGAKALSDALRVPVEGPQEEDRFWLARLDEDGQAYGI--PAQVLEPTRWLSEGDRV 148

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
            +G     V+  PGH+ GHVI+ +  ++FA +GD LF+ S+GR+D+  GD+  LI SI  
Sbjct: 149 TIGELTLDVYETPGHTRGHVIFHHAPSHFALVGDVLFQGSVGRSDLPGGDHDTLIRSIVE 208

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           K+ PLG+E +F+ GHG  ST G ER+ N F+   +
Sbjct: 209 KLWPLGNETAFIPGHGQPSTFGHERQSNAFVADRV 243


>gi|51246786|ref|YP_066670.1| hypothetical protein DP2934 [Desulfotalea psychrophila LSv54]
 gi|50877823|emb|CAG37663.1| conserved hypothetical protein [Desulfotalea psychrophila LSv54]
          Length = 217

 Score =  166 bits (420), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 70/215 (32%), Positives = 106/215 (49%), Gaps = 7/215 (3%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +    + V      C  +  E++ +A ++D GGD D +   I+     ++ I  THGH D
Sbjct: 5   MKIEQITVGTMGVCCYLVSCEKTKKAALIDVGGDEDRVLAAIEKAGLDLQYIIATHGHPD 64

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HV G  +++E     II  H  DA    K + +     + +          + DGDT+ +
Sbjct: 65  HVCGNRRIQEATGAKIIM-HALDAEFFAKAEVKDHFSHLGLEFSPPVD-ITVVDGDTINI 122

Query: 124 GTHIFKVFHCPGHSP--GHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
           G  + KV H PGH+P    +   +  +     GDTLF +++GRTD + G++Q L+NSI  
Sbjct: 123 GEVVLKVLHTPGHTPGGMCLYNNDGPDGDLFTGDTLFVTAVGRTDFMGGNHQDLLNSIRT 182

Query: 182 KILPLGDEISFVCGHGPN---STIGRERRLNPFLK 213
           K+  L DE     GHG     S IG E+R NPFLK
Sbjct: 183 KLFVLPDETIVWPGHGYGGDRSHIGFEKRANPFLK 217


>gi|261365036|ref|ZP_05977919.1| metallo-beta-lactamase domain protein [Neisseria mucosa ATCC 25996]
 gi|288566626|gb|EFC88186.1| metallo-beta-lactamase domain protein [Neisseria mucosa ATCC 25996]
          Length = 210

 Score =  166 bits (420), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 84/209 (40%), Positives = 125/209 (59%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L   I+ VTPF+QNCT L+D+E+ EAV+ D GGD+  +   + ++N  +  IW+THGH+D
Sbjct: 3   LQAEIIAVTPFRQNCTLLWDDETREAVLTDVGGDVSFLLQELDAKNLTLTAIWLTHGHLD 62

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GG  +L+E   + +IGPH DD  ++  + E        + +      RWL +G+TL +
Sbjct: 63  HAGGVVELREHRPVPVIGPHADDEFLLQALPETTAQYGFPV-SPAFEPTRWLTEGETLKV 121

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G H F+V H PGH+PGHV++   E      GD LF  +IGRTD   G++  LI++I  K+
Sbjct: 122 GNHAFQVLHIPGHTPGHVVFYCAEAGLLIAGDVLFYETIGRTDFPRGNHADLIHNIRTKL 181

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
             L ++   + GHG  + IG E+R NPF 
Sbjct: 182 FVLPEDTRVIAGHGRMTDIGHEKRHNPFF 210


>gi|304408481|ref|ZP_07390124.1| beta-lactamase domain protein [Paenibacillus curdlanolyticus YK9]
 gi|304342540|gb|EFM08391.1| beta-lactamase domain protein [Paenibacillus curdlanolyticus YK9]
          Length = 213

 Score =  166 bits (420), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 69/213 (32%), Positives = 109/213 (51%), Gaps = 5/213 (2%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M+KL+    Q+ P + NC  L DE     +++DPG     + + I   N  ++ I +TH 
Sbjct: 1   MAKLNIQTFQLGPLQTNCYLLTDEAGERGIIIDPGMQPKRLLERIA--NIEIEAIVLTHA 58

Query: 61  HVDHVGGAAQLKEDLSLTIIGPH-KDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGD 119
           H DH+GG  ++++     +     + D     +++   R   +        ++  L +G 
Sbjct: 59  HFDHMGGVDEVRKAKGCPVYIHDLEADWLTNAQLNGSGRWKDVTPPLTTDPAEYALDEGQ 118

Query: 120 TLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSI 179
           TL    H F V H PGHSPG V  +   + F   GD LFRSS+GRTD+  G  + L +SI
Sbjct: 119 TLSFIGHQFSVMHTPGHSPGSVSLLCGSDLF--SGDVLFRSSVGRTDLPGGRERDLYDSI 176

Query: 180 NNKILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
             K+  L D+++   GHGP +TIG E+  NP++
Sbjct: 177 QLKLFKLADDVTVYSGHGPKTTIGYEKANNPYV 209


>gi|188585916|ref|YP_001917461.1| beta-lactamase domain protein [Natranaerobius thermophilus
           JW/NM-WN-LF]
 gi|179350603|gb|ACB84873.1| beta-lactamase domain protein [Natranaerobius thermophilus
           JW/NM-WN-LF]
          Length = 206

 Score =  166 bits (420), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 68/210 (32%), Positives = 107/210 (50%), Gaps = 4/210 (1%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +    + V     NC  +  +E+ EAV++DPGG+ + I   I+  +     I  THGHVD
Sbjct: 1   MIIEQLVVGELGANCYIVGCQETGEAVIIDPGGNGEKIHQQIKELDMTPSMIINTHGHVD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G  + LKE     + G H  DA M+        + + +     ++    L DGD++ +
Sbjct: 61  HIGANSYLKEHTDAEL-GIHPKDAPMLTDPKLNLSMFTGKEIISPSADIH-LNDGDSIKV 118

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    ++ + PGH+PG        +N    GDTLF   IGR D+  G+  +L+ SI  ++
Sbjct: 119 GNLKGEIINTPGHTPGG--ICIKIDNNLFSGDTLFTEGIGRCDLPGGNQDELLKSIREQL 176

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
             L D++    GHG ++TI  E+R NPFLK
Sbjct: 177 FTLSDDLVVYPGHGGSTTIAHEKRKNPFLK 206


>gi|296114658|ref|ZP_06833311.1| Beta-lactamase-like protein [Gluconacetobacter hansenii ATCC 23769]
 gi|295979014|gb|EFG85739.1| Beta-lactamase-like protein [Gluconacetobacter hansenii ATCC 23769]
          Length = 222

 Score =  166 bits (420), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 95/219 (43%), Positives = 136/219 (62%), Gaps = 8/219 (3%)

Query: 2   SKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGH 61
             L+  +V VT F QNC+ L+D  S  AVVVDPGGD+  +  VI  +N  V  I +THGH
Sbjct: 5   PSLALEVVAVTAFAQNCSILWDRRSRHAVVVDPGGDVPRLLQVIADKNLTVDAIILTHGH 64

Query: 62  VDHVGGAAQLKEDLS-------LTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRW 114
           +DH GGA  L++ L+       + +IGP   D  ++  + +QA    +     +A  DR+
Sbjct: 65  LDHAGGADALRDALTTRQDGVTVPLIGPDARDQFLLESITQQAARFGVDGMH-DAHVDRF 123

Query: 115 LQDGDTLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQ 174
           + DG+ L L  H F+V H PGH+PGHV+Y N +  FA +GDTLF+ S+GRTD  +GD   
Sbjct: 124 VTDGERLDLLGHEFQVLHVPGHTPGHVVYFNPQTRFAFVGDTLFQGSVGRTDFAYGDADV 183

Query: 175 LINSINNKILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           L  +I  ++LPLGD+++ + GHGP +TIG ER+ N FL+
Sbjct: 184 LKEAIVRQLLPLGDDVTILPGHGPTTTIGAERQGNLFLR 222


>gi|16273550|ref|NP_439805.1| hypothetical protein HI1663 [Haemophilus influenzae Rd KW20]
 gi|260581258|ref|ZP_05849076.1| Zn-dependent hydrolase [Haemophilus influenzae RdAW]
 gi|2494857|sp|Q57544|Y1663_HAEIN RecName: Full=Uncharacterized protein HI_1663
 gi|1574513|gb|AAC23309.1| conserved hypothetical protein [Haemophilus influenzae Rd KW20]
 gi|260092085|gb|EEW76030.1| Zn-dependent hydrolase [Haemophilus influenzae RdAW]
          Length = 212

 Score =  166 bits (420), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 83/211 (39%), Positives = 129/211 (61%), Gaps = 1/211 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           ++  I+ VT F+QNC+ ++D+E   A ++DPGG+ + +   I+  + ++K + +THGH+D
Sbjct: 1   MNIEIIPVTAFQQNCSLIWDDE-KNAAIIDPGGEAERLIQRIEELDLNLKVLLLTHGHLD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG A QLK+   + I G ++ D  +   + EQA+   +           + Q+G+ L L
Sbjct: 60  HVGAAMQLKQHFGVEIWGSNEKDKFLFESLPEQAQRFGLPNIDAFLPDRWFNQEGEILKL 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
               F++ H PGH+PGH+ ++  E   A  GD LF+  IGRTD   GDY+ LI+SI  K+
Sbjct: 120 DGFNFEILHLPGHTPGHIGFIEHEKKVAFTGDVLFQGGIGRTDFPRGDYETLISSIRTKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           LPL D+I  + GHG  +TIG+E+R NPFL S
Sbjct: 180 LPLNDDIIIIAGHGSYTTIGQEKRSNPFLNS 210


>gi|229174936|ref|ZP_04302456.1| Metallo-beta-lactamase [Bacillus cereus MM3]
 gi|228608604|gb|EEK65906.1| Metallo-beta-lactamase [Bacillus cereus MM3]
          Length = 221

 Score =  166 bits (419), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 59/210 (28%), Positives = 107/210 (50%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + +  + + P + N   L +++  E ++ DPG + + +   +Q        + +TH H D
Sbjct: 13  MKWIQMPLGPLQTNAYILTNDQ-NECIIFDPGHEGEKLVTYLQEEQLKPLAVLLTHAHFD 71

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G    +++   + +    ++   +       +++  +  +     +D  +     L +
Sbjct: 72  HIGAVDAVRDAFHIPVYVHKEEADWLGDATVNGSQIFMMNRSITAKPADHIINAEGALAI 131

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G+  F++F  PGHSPG + Y   E N    GD LF+ SIGRTD+  G + +LI SI  K+
Sbjct: 132 GSFNFEIFETPGHSPGSISYYCKEANAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKL 191

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
             L DE + +CGHGP ++IG E+  NPFL+
Sbjct: 192 FVLPDETAVLCGHGPETSIGFEKENNPFLQ 221


>gi|18310918|ref|NP_562852.1| metallo-beta-lactamase family protein [Clostridium perfringens str.
           13]
 gi|18145600|dbj|BAB81642.1| conserved hypothetical protein [Clostridium perfringens str. 13]
          Length = 206

 Score =  166 bits (419), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 77/213 (36%), Positives = 116/213 (54%), Gaps = 12/213 (5%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +    + V  ++ NC  + DEE+ + ++VDPG +   I++VI+S +   K I +THGH D
Sbjct: 1   MLIKTIPVGMYQANCYVVIDEETKDCIMVDPGEEASRIENVIESLDAKPKMILLTHGHFD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG   +L E   +            + K DE     ++ +  +   +D +L+DGDTL  
Sbjct: 61  HVGAVQKLAEKYKIP---------FYIDKKDEDMIERNVDVFGKLPKADGYLKDGDTLKF 111

Query: 124 -GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
              +  K    PGH+P         +N    GDTLFR SIGR+D   G++  L+ SIN+K
Sbjct: 112 SDNYEIKCLETPGHTP--GGLCFLIDNCLFTGDTLFRESIGRSDFEGGNHATLLKSINDK 169

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFLKSN 215
           ++PLGD+I    GHGP+STI  ER+ NPFL  +
Sbjct: 170 LVPLGDDIVVYPGHGPSSTIKHERQRNPFLAGD 202


>gi|70732414|ref|YP_262170.1| metallo-beta-lactamase family protein [Pseudomonas fluorescens
           Pf-5]
 gi|68346713|gb|AAY94319.1| metallo-beta-lactamase family protein [Pseudomonas fluorescens
           Pf-5]
          Length = 214

 Score =  166 bits (419), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 71/208 (34%), Positives = 110/208 (52%), Gaps = 4/208 (1%)

Query: 7   HIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVG 66
               V P + NCT + D  + +A+VVDPGG+ D+I   + +    V  I  TH H+DH  
Sbjct: 11  ETFPVGPLQCNCTIIGDPLTKKAIVVDPGGNPDLIMARLDALGLKVVSIIHTHAHLDHFL 70

Query: 67  GAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTH 126
            + Q+KE    T+   HKDD  +   ++ Q  +  +      +  DRWL D + L  G  
Sbjct: 71  ASGQMKEKTGATLH-LHKDDQFLWDNLEMQCSMFGVPYTPVPS-PDRWLGDDEELACGC- 127

Query: 127 IFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPL 186
                H PGH+PG + +   E     +GDTLF+  +GRTD+  GD   L+ SI  ++  L
Sbjct: 128 -GVALHTPGHTPGSMSFWFSEAKLLIVGDTLFKRGVGRTDLWGGDQATLVRSIKQRLYTL 186

Query: 187 GDEISFVCGHGPNSTIGRERRLNPFLKS 214
            ++ + V GHGP++ +G E R NPF+++
Sbjct: 187 DEDATVVAGHGPDTRLGDEMRQNPFVRA 214


>gi|116048754|ref|YP_792446.1| hypothetical protein PA14_53510 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|115583975|gb|ABJ09990.1| conserved hypothetical protein [Pseudomonas aeruginosa UCBPP-PA14]
          Length = 213

 Score =  166 bits (419), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 71/208 (34%), Positives = 107/208 (51%), Gaps = 4/208 (1%)

Query: 7   HIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVG 66
               V P + NCT + D  + +A+VVDPGGD ++I   +      V  I  TH H+DH  
Sbjct: 10  ETFPVGPLQCNCTIIGDPLTRKAIVVDPGGDHELILQRLDRLGLQVVSIIHTHAHLDHFL 69

Query: 67  GAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTH 126
            + ++K+    ++   HKDD  +   ++ Q +L  +      A  DRWL D + L  G  
Sbjct: 70  ASGEMKKRTGASLH-LHKDDQFLWDNLEMQCQLFGVPYTPVPA-PDRWLADDEELACGC- 126

Query: 127 IFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPL 186
                H PGH+PG + +          GDTLFR  IGRTD+  GD   +  SI  ++  L
Sbjct: 127 -GVALHTPGHTPGSMSFWFPRAKLLIAGDTLFRRGIGRTDLWGGDSAAIQRSIRLRLYSL 185

Query: 187 GDEISFVCGHGPNSTIGRERRLNPFLKS 214
            ++ + V GHGP++T+G E R NPF++ 
Sbjct: 186 DEDATVVAGHGPDTTLGEEMRENPFVRG 213


>gi|168214144|ref|ZP_02639769.1| metallo-beta-lactamase family protein [Clostridium perfringens CPE
           str. F4969]
 gi|168215561|ref|ZP_02641186.1| metallo-beta-lactamase family protein [Clostridium perfringens NCTC
           8239]
 gi|170714347|gb|EDT26529.1| metallo-beta-lactamase family protein [Clostridium perfringens CPE
           str. F4969]
 gi|182382085|gb|EDT79564.1| metallo-beta-lactamase family protein [Clostridium perfringens NCTC
           8239]
          Length = 206

 Score =  166 bits (419), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 76/213 (35%), Positives = 115/213 (53%), Gaps = 12/213 (5%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +    + V  ++ NC  + DEE+ + ++VDPG +   I+ VI+S +   K I +THGH D
Sbjct: 1   MLIKTIPVGMYQANCYVVIDEETKDCIIVDPGEEASRIESVIESLDAKPKMILLTHGHFD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG   +L E   +            + K DE     ++ +  +   +D +L+DGD L  
Sbjct: 61  HVGAVQKLSEKYKIP---------FYIDKKDEDMIERNVDVFGKLPKADGYLKDGDMLKF 111

Query: 124 -GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
              +  K    PGH+P         +N    GDTLFR SIGR+D   G++  L+ SIN+K
Sbjct: 112 SDNYEIKCLETPGHTP--GGVCFLIDNCLFTGDTLFRESIGRSDFEGGNHATLLKSINDK 169

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFLKSN 215
           ++PLGD+I+   GHGP+STI  ER+ NPFL  +
Sbjct: 170 LVPLGDDIAVYPGHGPSSTIKHERQRNPFLAGD 202


>gi|327479682|gb|AEA82992.1| metallo-beta-lactamase family protein [Pseudomonas stutzeri DSM
           4166]
          Length = 214

 Score =  166 bits (419), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 74/208 (35%), Positives = 110/208 (52%), Gaps = 4/208 (1%)

Query: 7   HIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVG 66
               V P + NCT + D  S +A+VVDPGGD ++I   +++    V  I  TH H+DH  
Sbjct: 11  ETFPVGPLQCNCTIIGDPLSKKAIVVDPGGDPELIMARLEAHGLKVVSIIHTHAHLDHFL 70

Query: 67  GAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTH 126
            + ++KE    T+   HK D  +   ++ Q RL  +      A  DRWL D + L  G  
Sbjct: 71  ASGKMKERTGATLH-LHKADQFLWDNLEMQCRLFGVPYTPVPA-PDRWLADDEELACGC- 127

Query: 127 IFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPL 186
                H PGH+PG + +   +      GDTLFR  IGRTD+  GDY  +  SI  ++  L
Sbjct: 128 -GVALHTPGHTPGSMSFWFADAKLLIAGDTLFRRGIGRTDLWGGDYASIERSIRQRLYAL 186

Query: 187 GDEISFVCGHGPNSTIGRERRLNPFLKS 214
            ++ + V GHGP++ +G E R NPF+++
Sbjct: 187 DEDATVVTGHGPDTRLGDEMRANPFVRA 214


>gi|182624403|ref|ZP_02952187.1| metallo-beta-lactamase family protein [Clostridium perfringens D
           str. JGS1721]
 gi|177910406|gb|EDT72783.1| metallo-beta-lactamase family protein [Clostridium perfringens D
           str. JGS1721]
          Length = 206

 Score =  166 bits (419), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 76/213 (35%), Positives = 115/213 (53%), Gaps = 12/213 (5%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +    + V  ++ NC  + DEE+ + ++VDPG +   I+ VI+S +   K I +THGH D
Sbjct: 1   MLIKTIPVGMYQANCYVVIDEETKDCIIVDPGEEASRIESVIESLDAKPKMILLTHGHFD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG   +L E   +            + K DE     ++ +  +   +D +L+DGD L  
Sbjct: 61  HVGAVQKLSEKYKIP---------FYIDKKDEDMIERNVDVFGKLPKADGYLKDGDMLKF 111

Query: 124 -GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
              +  K    PGH+P         +N    GDTLFR SIGR+D   G++  L+ SIN+K
Sbjct: 112 SDNYEIKCLETPGHTP--GGLCFLIDNCLFTGDTLFRESIGRSDFEGGNHATLLKSINDK 169

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFLKSN 215
           ++PLGD+I+   GHGP+STI  ER+ NPFL  +
Sbjct: 170 LVPLGDDIAVYPGHGPSSTIKHERQRNPFLAGD 202


>gi|114327594|ref|YP_744751.1| zinc-dependent hydrolase [Granulibacter bethesdensis CGDNIH1]
 gi|114315768|gb|ABI61828.1| Zn-dependent hydrolase, glyoxalase II family [Granulibacter
           bethesdensis CGDNIH1]
          Length = 225

 Score =  166 bits (419), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 101/216 (46%), Positives = 145/216 (67%), Gaps = 8/216 (3%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L   ++ VTPF+QNCT L+DEE+   VV+DPGGD+  I   I      V+ IW+THGH+D
Sbjct: 12  LRLAVIPVTPFEQNCTLLWDEETNRGVVIDPGGDVASIMAAIDHHGVLVEGIWLTHGHLD 71

Query: 64  HVGGAAQLKEDLS------LTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQD 117
           H GG  +LK  L       + + GP + D  +M  +  Q+    I    +NA+SDRWL++
Sbjct: 72  HAGGVEELKTALQDRSGLAVPVSGPDRRDQFLMDDIARQSAAYGIPGM-KNATSDRWLEE 130

Query: 118 GDTLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLIN 177
           GDTL +G H+F+V HCPGH+PGH++ ++  +    +GD LF+ S+GRTD  +G+  +L+N
Sbjct: 131 GDTLSIGRHVFQVLHCPGHTPGHIVLIHPAHFAI-VGDVLFQGSVGRTDFPYGNTDELLN 189

Query: 178 SINNKILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           SI+ K+LPLGDE++F+CGHGP ST G ER+ NPFL+
Sbjct: 190 SIHTKLLPLGDEVAFLCGHGPGSTFGAERKSNPFLQ 225


>gi|256375835|ref|YP_003099495.1| beta-lactamase domain protein [Actinosynnema mirum DSM 43827]
 gi|255920138|gb|ACU35649.1| beta-lactamase domain protein [Actinosynnema mirum DSM 43827]
          Length = 234

 Score =  165 bits (418), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 71/218 (32%), Positives = 99/218 (45%), Gaps = 10/218 (4%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDL-DIIKDVIQSRNFHVKQIWITHGHV 62
           +          + NC  +  E     VVVDPG D  + I + ++        + +THGH 
Sbjct: 1   MLVIGFPTGALQANCYLVASEAGGACVVVDPGQDALEPIAEAVREHRLSPVAVLLTHGHF 60

Query: 63  DHVGGAAQLKEDLSLTIIGPHKDDAAMMGKV-----DEQARLLSIRMNARNASSDRWLQD 117
           DH    A + +   +     H  D AM+         E       R+  R     R L D
Sbjct: 61  DHSYSVAPVCDGDDIPAW-VHPADRAMLSDPLSGVSAETRAFFGGRLEMREPREVRELSD 119

Query: 118 GDTLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAH---LGDTLFRSSIGRTDILHGDYQQ 174
           G  L L    F V H PGH+ G V++ +           GDTLF  SIGRTD+  GD+  
Sbjct: 120 GAELDLAGLRFTVDHTPGHTGGSVMFRSGVEEGGRLVLSGDTLFAGSIGRTDLPGGDHGA 179

Query: 175 LINSINNKILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           ++ S+  K+L L D++  + GHGP +TIGRER  NPFL
Sbjct: 180 MLGSLRRKVLTLDDDVVVLPGHGPTTTIGRERASNPFL 217


>gi|297622654|ref|YP_003704088.1| beta-lactamase-like protein [Truepera radiovictrix DSM 17093]
 gi|297163834|gb|ADI13545.1| beta-lactamase-like protein [Truepera radiovictrix DSM 17093]
          Length = 210

 Score =  165 bits (418), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 74/204 (36%), Positives = 109/204 (53%), Gaps = 4/204 (1%)

Query: 11  VTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQ 70
           V P ++N   L D E+LEAV+VDPG + + +   +    F +  IW+TH H DHVG  A 
Sbjct: 9   VGPLQENTYLLADTETLEAVLVDPGDEAERLLAALA--GFKLTAIWLTHAHFDHVGALAA 66

Query: 71  LKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFKV 130
           + E   + +   H  D  ++ +    A L  + +  +       L     L +G +  + 
Sbjct: 67  VHEAHPVPVY-LHPADRPLLAQAAASAALFGLPLR-QPELPTLPLAHAQQLQVGAYRARC 124

Query: 131 FHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEI 190
            H PGH+PGHV +   E      GD LFR SIGRTD+  GD + L+ S+ +++L L DE 
Sbjct: 125 LHTPGHAPGHVAFYLAEAGVLLAGDALFRGSIGRTDLPGGDLETLLRSLRDEVLTLPDET 184

Query: 191 SFVCGHGPNSTIGRERRLNPFLKS 214
             + GHGP +T+G ERR NPFL+ 
Sbjct: 185 RVLPGHGPETTVGSERRRNPFLQG 208


>gi|20807652|ref|NP_622823.1| Zn-dependent hydrolase, including glyoxylases [Thermoanaerobacter
           tengcongensis MB4]
 gi|20516197|gb|AAM24427.1| Zn-dependent hydrolases, including glyoxylases [Thermoanaerobacter
           tengcongensis MB4]
          Length = 214

 Score =  165 bits (418), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 69/211 (32%), Positives = 104/211 (49%), Gaps = 4/211 (1%)

Query: 3   KLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHV 62
            +      V P+  N   ++D ++ E +++DPG   D IK+ I+     VK I +THGH 
Sbjct: 5   SMEVKRYVVGPYGANLYVVWDRDTREGIIIDPGEVYDEIKNYIKENGIKVKHILLTHGHF 64

Query: 63  DHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLL 122
           DH+GG  +++      +    +D   ++     Q     +      + +D  L+D D L 
Sbjct: 65  DHIGGVEEIRAFTGGKVAISEEDAPMLLD--PSQNLSEMVFKKVICSPADIILKDKDVLG 122

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
            G +  +V   PGH+           +    GDTLFR SIGR D   G+++ L+ SI  +
Sbjct: 123 FGNYYVEVISTPGHT--KGSVCFKIGDVYFTGDTLFRGSIGRHDFPGGNFETLMASIKER 180

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           +L L DE     GHG  STIGRE+RLN FLK
Sbjct: 181 LLTLKDETVIYPGHGDFSTIGREKRLNMFLK 211


>gi|167031826|ref|YP_001667057.1| beta-lactamase domain-containing protein [Pseudomonas putida GB-1]
 gi|166858314|gb|ABY96721.1| beta-lactamase domain protein [Pseudomonas putida GB-1]
          Length = 214

 Score =  165 bits (418), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 74/208 (35%), Positives = 109/208 (52%), Gaps = 4/208 (1%)

Query: 7   HIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVG 66
               V P + NCT + D  + +A+VVDPGGD D I   +Q+    +  I  TH H DH  
Sbjct: 11  ETFPVGPLQCNCTLIGDPLTKKAIVVDPGGDPDKILARLQAHGLTLVSIIHTHAHFDHFL 70

Query: 67  GAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTH 126
            + +LKE    T+   HKDD A+   ++ Q ++  +         DRWL D + L  G  
Sbjct: 71  ASGKLKELTGATLH-LHKDDQALWDNLEMQCQMFGVPYTPVPP-PDRWLGDDEELACGC- 127

Query: 127 IFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPL 186
                H PGH+PG + +   +      GDTLFR  IGRTD+  GD + ++ SI  ++  L
Sbjct: 128 -GVALHTPGHTPGSMSFWFADAKLLIAGDTLFRRGIGRTDLWGGDQRAIVRSIKERLYRL 186

Query: 187 GDEISFVCGHGPNSTIGRERRLNPFLKS 214
            +E   V GHGP++ +G E R NPF+++
Sbjct: 187 DEEAIVVTGHGPDTRLGDEMRENPFVRA 214


>gi|254479347|ref|ZP_05092684.1| metallo-beta-lactamase domain protein, putative [Carboxydibrachium
           pacificum DSM 12653]
 gi|214034713|gb|EEB75450.1| metallo-beta-lactamase domain protein, putative [Carboxydibrachium
           pacificum DSM 12653]
          Length = 209

 Score =  165 bits (418), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 69/210 (32%), Positives = 104/210 (49%), Gaps = 4/210 (1%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +      V P+  N   ++D ++ E +++DPG   D IK+ I+     VK I +THGH D
Sbjct: 1   MEVKRYVVGPYGANLYVVWDRDTREGIIIDPGEVYDEIKNYIKENGIKVKHILLTHGHFD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+GG  +++      +    +D   ++     Q     +      + +D  L+D D L  
Sbjct: 61  HIGGVEEIRAFTGGKVAISEEDAPMLLD--PSQNLSEMVFKKVICSPADIILKDKDVLGF 118

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G +  +V   PGH+           +    GDTLFR SIGR D   G+++ L+ SI  ++
Sbjct: 119 GNYSLEVISTPGHT--KGSVCFKIGDVYFTGDTLFRGSIGRHDFPGGNFETLMASIKERL 176

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           L L DE     GHG  STIGRE+RLN FLK
Sbjct: 177 LTLKDETVIYPGHGDFSTIGREKRLNMFLK 206


>gi|32034590|ref|ZP_00134746.1| COG0491: Zn-dependent hydrolases, including glyoxylases
           [Actinobacillus pleuropneumoniae serovar 1 str. 4074]
 gi|126207611|ref|YP_001052836.1| glyoxalase II family protein [Actinobacillus pleuropneumoniae L20]
 gi|190149394|ref|YP_001967919.1| glyoxalase II family protein [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
 gi|303249827|ref|ZP_07336031.1| glyoxalase II family protein [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|303251947|ref|ZP_07338118.1| glyoxalase II family protein [Actinobacillus pleuropneumoniae
           serovar 2 str. 4226]
 gi|307244931|ref|ZP_07527028.1| hypothetical protein appser1_1430 [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|307253885|ref|ZP_07535737.1| hypothetical protein appser9_1430 [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|307256148|ref|ZP_07537935.1| hypothetical protein appser10_1530 [Actinobacillus pleuropneumoniae
           serovar 10 str. D13039]
 gi|307258339|ref|ZP_07540080.1| hypothetical protein appser11_1420 [Actinobacillus pleuropneumoniae
           serovar 11 str. 56153]
 gi|307260580|ref|ZP_07542272.1| hypothetical protein appser12_1550 [Actinobacillus pleuropneumoniae
           serovar 12 str. 1096]
 gi|126096403|gb|ABN73231.1| glyoxalase II family protein [Actinobacillus pleuropneumoniae
           serovar 5b str. L20]
 gi|189914525|gb|ACE60777.1| glyoxalase II family protein [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
 gi|302649377|gb|EFL79562.1| glyoxalase II family protein [Actinobacillus pleuropneumoniae
           serovar 2 str. 4226]
 gi|302651394|gb|EFL81546.1| glyoxalase II family protein [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|306854096|gb|EFM86304.1| hypothetical protein appser1_1430 [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|306863089|gb|EFM95031.1| hypothetical protein appser9_1430 [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|306865329|gb|EFM97225.1| hypothetical protein appser10_1530 [Actinobacillus pleuropneumoniae
           serovar 10 str. D13039]
 gi|306867523|gb|EFM99370.1| hypothetical protein appser11_1420 [Actinobacillus pleuropneumoniae
           serovar 11 str. 56153]
 gi|306869657|gb|EFN01442.1| hypothetical protein appser12_1550 [Actinobacillus pleuropneumoniae
           serovar 12 str. 1096]
          Length = 209

 Score =  165 bits (417), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 77/209 (36%), Positives = 127/209 (60%), Gaps = 2/209 (0%)

Query: 5   SFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDH 64
           +  I+ V+ F+QNC+ ++D ++  A ++D G D D I   ++S+N  V+++ +THGH+DH
Sbjct: 3   NLQIIPVSAFQQNCSVIWD-DNKNAAIIDAGDDADKIIQFVESQNLKVQKLLLTHGHLDH 61

Query: 65  VGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLG 124
           +    ++++   + + G H DD  +  ++ +   +  I    +    D WL + D + +G
Sbjct: 62  IMAVEKVRDHFGVEVYGSHIDDKPLFEQLPQMCEMFGIPP-VKAFLPDHWLSEDDRVEVG 120

Query: 125 THIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKIL 184
              F V H PGH+PGH+ + +FEN  A  GD LF+ SIGRTD+  G+   L+N+I  K+ 
Sbjct: 121 ALRFSVRHLPGHAPGHIGFFDFENKIAFSGDVLFKDSIGRTDLYLGNLDVLLNTIRTKMF 180

Query: 185 PLGDEISFVCGHGPNSTIGRERRLNPFLK 213
            L D+   V GHGP++TIGRE++ NPFLK
Sbjct: 181 DLDDDFIVVAGHGPHTTIGREKQHNPFLK 209


>gi|304388674|ref|ZP_07370734.1| metallo-beta-lactamase domain protein [Neisseria meningitidis ATCC
           13091]
 gi|304337341|gb|EFM03515.1| metallo-beta-lactamase domain protein [Neisseria meningitidis ATCC
           13091]
          Length = 210

 Score =  165 bits (417), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 81/209 (38%), Positives = 127/209 (60%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L + I+ VTPF+QNCT ++D+ES EAV+ D GGD+  +   + +R   +  IW+THGH+D
Sbjct: 3   LRYEILSVTPFRQNCTLIWDDESGEAVLTDVGGDVPFLLQALANRKLTLTAIWLTHGHLD 62

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GG  ++ +   + ++GPH DD  ++  +  Q         +   + +RWL++G+TL +
Sbjct: 63  HAGGVVEMLKTHKVPVLGPHPDDEFLLQSLP-QTTAQYGFPVSPAFAPNRWLEEGETLTV 121

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G + F+V H PGH+PGH+++   E      GD LF  +IGRTD   G++  LIN+I NK+
Sbjct: 122 GRYAFQVLHIPGHTPGHIVFYCAEAELLIAGDVLFYETIGRTDFPRGNHADLINNIRNKL 181

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
             L + +  V GHG  ++I  E+R NPF 
Sbjct: 182 FTLPETVQVVAGHGRMTSIRHEKRHNPFF 210


>gi|297616956|ref|YP_003702115.1| beta-lactamase [Syntrophothermus lipocalidus DSM 12680]
 gi|297144793|gb|ADI01550.1| beta-lactamase-like protein [Syntrophothermus lipocalidus DSM
           12680]
          Length = 206

 Score =  165 bits (417), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 77/210 (36%), Positives = 109/210 (51%), Gaps = 5/210 (2%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +    ++V     NC  +  EE+ E  V+DPGG+   I  VI+S    +K I  THGH+D
Sbjct: 1   MILKWLEVGSIGANCYIIGCEETREGAVIDPGGNGPSIVQVIESLKLKIKYIINTHGHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G   Q+KE     I   H++DA M+        +   R       +DR+++DGD + +
Sbjct: 61  HIGANRQVKEATGAEI-LIHEEDAGMLTNPVSNFSMFMGRNITSPP-ADRFIKDGDIIKI 118

Query: 124 -GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
             T   +V H PGH+           +    GDTLF  SIGRTD   G ++ LI SINNK
Sbjct: 119 GNTIELEVIHTPGHT--RGGVCLKTGDIIFAGDTLFAGSIGRTDFPGGSFKTLIESINNK 176

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           I+   D +    GHGP +T+G ER+ NPFL
Sbjct: 177 IMCYEDHVKVYPGHGPATTVGFERKHNPFL 206


>gi|169343636|ref|ZP_02864635.1| metallo-beta-lactamase family protein [Clostridium perfringens C
           str. JGS1495]
 gi|169298196|gb|EDS80286.1| metallo-beta-lactamase family protein [Clostridium perfringens C
           str. JGS1495]
          Length = 206

 Score =  165 bits (417), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 77/213 (36%), Positives = 117/213 (54%), Gaps = 12/213 (5%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +    + V  ++ NC  + DEE+ + ++VDPG +   I++VI+S +   K I +THGH D
Sbjct: 1   MLIKTIPVGMYQANCYVVIDEETKDCIMVDPGEEASRIENVIESLDAKPKMILLTHGHFD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG   +L E   +            + K DE     ++ +  +   +D +L+DGDTL  
Sbjct: 61  HVGAVQKLAEKYKIP---------FYIDKKDEDMIERNVDVFGKLPKADGYLKDGDTLKF 111

Query: 124 -GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
              +  K    PGH+P         +N    GDTLFR SIGR+D   G++  L+ SIN+K
Sbjct: 112 SDNYEIKCLETPGHTP--GGLCFLIDNCLFTGDTLFRESIGRSDFEGGNHATLLKSINDK 169

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFLKSN 215
           ++PLGD+I+   GHGP+STI  ER+ NPFL  +
Sbjct: 170 LVPLGDDIAVYPGHGPSSTIKHERQRNPFLAGD 202


>gi|319898505|ref|YP_004158598.1| hydrolase [Bartonella clarridgeiae 73]
 gi|319402469|emb|CBI76012.1| putative hydrolase [Bartonella clarridgeiae 73]
          Length = 214

 Score =  165 bits (417), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 114/214 (53%), Positives = 149/214 (69%), Gaps = 1/214 (0%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M+ LS +I+ VTPF+QNCT LFD E+   V+VDPGGD   I+  IQ +   V+ IWITHG
Sbjct: 1   MNDLSAYIIPVTPFQQNCTLLFDNENKRGVLVDPGGDWPKIQQTIQDKGVIVESIWITHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DHVG A Q KE L + IIG H++D ++M  V E+A++     +AR    D+WL+DGD+
Sbjct: 61  HIDHVGAAMQAKEALDIQIIGSHRNDTSVMDDVSERAKIYH-MPDARVCIPDQWLEDGDS 119

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           +    H+F VFH PGHSPGHVIY N +  FA LGD LFR SIGRTD     Y++L+ SI 
Sbjct: 120 VDCAGHVFTVFHTPGHSPGHVIYFNEKKRFALLGDVLFRGSIGRTDFPLCSYEELMKSIK 179

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
            K+LPLGD+++F+CGHGP S IG ER+ N FL+ 
Sbjct: 180 EKVLPLGDDVNFICGHGPGSQIGYERQHNFFLQE 213


>gi|146281505|ref|YP_001171658.1| metallo-beta-lactamase family protein [Pseudomonas stutzeri A1501]
 gi|145569710|gb|ABP78816.1| metallo-beta-lactamase family protein [Pseudomonas stutzeri A1501]
          Length = 214

 Score =  165 bits (417), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 73/208 (35%), Positives = 110/208 (52%), Gaps = 4/208 (1%)

Query: 7   HIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVG 66
               V P + NCT + D  S +A+VVDPGGD ++I   +++    V  I  TH H+DH  
Sbjct: 11  ETFPVGPLQCNCTIIGDPLSKKAIVVDPGGDPELIMARLEAHGLKVVSIIHTHAHLDHFL 70

Query: 67  GAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTH 126
            + ++KE    T+   HK D  +   ++ Q R+  +      A  DRWL D + L  G  
Sbjct: 71  ASGKMKERTGATLH-LHKADQFLWDNLEMQCRMFGVPYTPVPA-PDRWLADDEELACGC- 127

Query: 127 IFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPL 186
                H PGH+PG + +   +      GDTLFR  IGRTD+  GDY  +  SI  ++  L
Sbjct: 128 -GVALHTPGHTPGSMSFWFADAKLLIAGDTLFRRGIGRTDLWGGDYASIERSIRQRLYAL 186

Query: 187 GDEISFVCGHGPNSTIGRERRLNPFLKS 214
            ++ + V GHGP++ +G E R NPF+++
Sbjct: 187 DEDATVVTGHGPDTRLGDEMRENPFVRA 214


>gi|229013481|ref|ZP_04170618.1| Metallo-beta-lactamase [Bacillus mycoides DSM 2048]
 gi|228747893|gb|EEL97759.1| Metallo-beta-lactamase [Bacillus mycoides DSM 2048]
          Length = 209

 Score =  165 bits (417), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 58/210 (27%), Positives = 107/210 (50%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + +  + + P + N   L +++  E ++ DPG + + +   +Q        + +TH H D
Sbjct: 1   MKWIQMPLGPLQTNAYILTNDQ-NECIIFDPGHEGEKLVTYLQEAQLKPLAVLLTHAHFD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G    +++   + +    ++   +       +++  +  +     +D  +    TL +
Sbjct: 60  HIGAVDAVRDAFHIPVYVHKEEADWLGDATVNGSQIFMMNRSITAKPADHIIDAEGTLTI 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G+  F++F  PGHSPG + Y +   N    GD LF+ SIGRTD+  G + +LI SI  K+
Sbjct: 120 GSFSFEIFETPGHSPGSISYYSKAANAVFSGDVLFQMSIGRTDLPGGSFAELIGSIEEKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
             L DE + +CGHGP ++I  E+  NPFL+
Sbjct: 180 FVLPDETAVLCGHGPETSIRFEKENNPFLQ 209


>gi|188590675|ref|YP_001920362.1| metallo-beta-lactamase family protein [Clostridium botulinum E3
           str. Alaska E43]
 gi|188500956|gb|ACD54092.1| metallo-beta-lactamase family protein [Clostridium botulinum E3
           str. Alaska E43]
          Length = 200

 Score =  165 bits (417), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 78/209 (37%), Positives = 114/209 (54%), Gaps = 11/209 (5%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +    +    ++ NC  + DE + E  ++DPGGD + +K +I S N  VK I +THGH+D
Sbjct: 1   MIIKTIPAGMYEANCYLVIDENTKECGIIDPGGDAERLKSIIDSLNVDVKYILLTHGHMD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVGG  +L E   +            + K+DE+       +      +  +LQ+GDT+ L
Sbjct: 61  HVGGVVELSEAFKIP---------FYINKIDEEYMEKDNFVFGTLPKASGYLQEGDTIKL 111

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   FKV   PGH+        F  +    GDTLF++SIGRTD   G+++++I SI  K+
Sbjct: 112 GNKEFKVIETPGHT--KGGLCFFIEDKLFTGDTLFQASIGRTDFAGGNFEEIIKSIKEKL 169

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           L LGD+I    GHGP STIG E++ N FL
Sbjct: 170 LILGDDIEVYPGHGPMSTIGYEKKRNSFL 198


>gi|170723578|ref|YP_001751266.1| beta-lactamase domain-containing protein [Pseudomonas putida W619]
 gi|169761581|gb|ACA74897.1| beta-lactamase domain protein [Pseudomonas putida W619]
          Length = 214

 Score =  165 bits (417), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 72/208 (34%), Positives = 109/208 (52%), Gaps = 4/208 (1%)

Query: 7   HIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVG 66
               V P + NCT + D  + +A+VVDPGGD D I   +Q+    +  I  TH H DH  
Sbjct: 11  ETFPVGPLQCNCTLIGDPLTKKAIVVDPGGDPDKILARLQAHGLTLVSIIHTHAHFDHFL 70

Query: 67  GAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTH 126
            + +LKE    T+   HKDD  +   ++ Q ++  +      +  DRWL D + L  G  
Sbjct: 71  ASGKLKELTGATLH-LHKDDQVLWDNLEMQCQMFGVPYTPVPS-PDRWLGDDEALACGC- 127

Query: 127 IFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPL 186
                H PGH+PG + +   +      GDTLFR  IGRTD+  GD + ++ SI  ++  L
Sbjct: 128 -GVALHTPGHTPGSMSFWFADAKLLVAGDTLFRRGIGRTDLWGGDQRAIVRSIKERLYRL 186

Query: 187 GDEISFVCGHGPNSTIGRERRLNPFLKS 214
            ++   V GHGP++ +G E R NPF+++
Sbjct: 187 DEDAIVVTGHGPDTRLGDEMRENPFVRA 214


>gi|94676554|ref|YP_588849.1| metallo-beta-lactamase superfamily protein [Baumannia
           cicadellinicola str. Hc (Homalodisca coagulata)]
 gi|94219704|gb|ABF13863.1| metallo-beta-lactamase superfamily protein [Baumannia
           cicadellinicola str. Hc (Homalodisca coagulata)]
          Length = 209

 Score =  164 bits (416), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 85/203 (41%), Positives = 127/203 (62%), Gaps = 1/203 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + +HI+ VT F QNC+ ++ +++ +A ++DPGGD   +   I   N  + QI +THGH D
Sbjct: 1   MKYHIIPVTIFNQNCSLIWCDQTKDAALIDPGGDASRLCFEIDKFNVTITQILLTHGHFD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG   +L     + IIGPH DD  ++  + EQ ++  +     +   DRWL +GD +++
Sbjct: 61  HVGAVKKLARYYDVPIIGPHSDDKILLENLSEQCKIFGV-PPVDSFLPDRWLVNGDIIIV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   + V HCPGHSPGH++  N  + F H+GD LF+ +IGRTD+  G+   L+ SIN K+
Sbjct: 120 GLEKYYVLHCPGHSPGHIVLWNKVHRFIHMGDVLFKGAIGRTDLPGGNLTLLLRSINEKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRER 206
             L D+I+F+ GHGP STIG ER
Sbjct: 180 FSLEDDITFLPGHGPMSTIGNER 202


>gi|332976211|gb|EGK13075.1| metallo-beta-lactamase [Desmospora sp. 8437]
          Length = 228

 Score =  164 bits (416), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 62/213 (29%), Positives = 107/213 (50%), Gaps = 3/213 (1%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +      + P   NC  ++ E+    +V+DPG   + + + I+  +  ++ I +TH H D
Sbjct: 18  MQVESFVLGPVMTNCYLVYKEKGGAGLVIDPGTGPEEVVERIRDLDLKIEAILLTHAHFD 77

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+GG  +++      +   H+++A  + + +     L          +++ ++ G+ L L
Sbjct: 78  HIGGVEEVRAATGAPVY-IHQEEAEWLLQPELNGSTLFPVEEVSCRPAEKIVEGGEQLTL 136

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
               F V H PGHSPG V Y     +    GD LF  SIGRTD   GDY+ L+ +I+  +
Sbjct: 137 LGETFAVLHTPGHSPGSVSY--RTGSVIFSGDVLFSGSIGRTDFPGGDYKTLMQTIHQVM 194

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           + L +E     GHGP +TIGRE+  NP++   +
Sbjct: 195 MELPEETVVYSGHGPVTTIGREQDTNPYVTGGL 227


>gi|240143889|ref|ZP_04742490.1| metallo-beta-lactamase family protein [Roseburia intestinalis
           L1-82]
 gi|257204081|gb|EEV02366.1| metallo-beta-lactamase family protein [Roseburia intestinalis
           L1-82]
          Length = 209

 Score =  164 bits (416), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 70/212 (33%), Positives = 101/212 (47%), Gaps = 3/212 (1%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M+ L      V P + NC F  ++++ E +V+DPG   D +   I+        I +THG
Sbjct: 1   MAPLKVEQYVVGPVQTNCYFAINDDTKEVLVIDPGASADQLAKKIRQEKLIPIAILLTHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H DH GGA +L +   + I     +   +         L       +   +D +L++   
Sbjct: 61  HFDHAGGAEELAKHFDIKIYAEEHEKETL---DTPSLNLSGWEGVQKTYHADVFLKNEQE 117

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           + L     +VFH PGH+ G   Y     N    GDTLF +S+GRTD   G   Q+I SI 
Sbjct: 118 IDLAGFHIRVFHTPGHTVGGCCYYFPYQNVVFSGDTLFCTSVGRTDFPKGSAAQIIRSIK 177

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
            K+LPL DE +   GH   +TIG ER  NP+L
Sbjct: 178 EKLLPLPDETTVYTGHNDITTIGTERMYNPYL 209


>gi|325272912|ref|ZP_08139239.1| beta-lactamase domain-containing protein [Pseudomonas sp. TJI-51]
 gi|324101956|gb|EGB99475.1| beta-lactamase domain-containing protein [Pseudomonas sp. TJI-51]
          Length = 237

 Score =  164 bits (416), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 73/208 (35%), Positives = 109/208 (52%), Gaps = 4/208 (1%)

Query: 7   HIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVG 66
               V P + NCT + D  S +A+VVDPGGD D I   +Q+    +  I  TH H DH  
Sbjct: 34  ETFPVGPLQCNCTLIGDPLSKKAIVVDPGGDPDKILARLQAHGLTLVSIIHTHAHFDHFL 93

Query: 67  GAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTH 126
            + +LK     T+   HK D A+   ++ Q ++  +      +  DRWL D + L  G  
Sbjct: 94  ASGKLKALTGATLH-LHKADQALWDNLEMQCQMFGVPYTPVPS-PDRWLADDEELACGC- 150

Query: 127 IFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPL 186
                H PGH+PG + +   +      GDTLFR  IGRTD+  GD + ++ SI  ++  L
Sbjct: 151 -GVALHTPGHTPGSMSFWFADAKLLIAGDTLFRRGIGRTDLWGGDQRAIVRSIKERLYRL 209

Query: 187 GDEISFVCGHGPNSTIGRERRLNPFLKS 214
            +E + V GHGP++ +G E R NPF+++
Sbjct: 210 DEEATVVTGHGPDTRLGDEMRENPFVRA 237


>gi|154505865|ref|ZP_02042603.1| hypothetical protein RUMGNA_03407 [Ruminococcus gnavus ATCC 29149]
 gi|153793883|gb|EDN76303.1| hypothetical protein RUMGNA_03407 [Ruminococcus gnavus ATCC 29149]
          Length = 206

 Score =  164 bits (416), Expect = 7e-39,   Method: Composition-based stats.
 Identities = 58/209 (27%), Positives = 95/209 (45%), Gaps = 3/209 (1%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +      +     NC  +++E + E  VVDP      + + IQ+    ++ I +THGH D
Sbjct: 1   MRIKKFVIGMVGTNCYVVYNENTKECFVVDPAAPSAPLVEFIQTEGLQLQGILLTHGHFD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+ G   L+ + S+ +     +   +    D    L          +  ++L+DG +L L
Sbjct: 61  HIMGIDTLRREWSVPVYASALEQKVL---TDANVNLSVAYGAGYVFADAKFLEDGASLAL 117

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
             +  ++   PGH+ G   Y   E      GDTLF  S+GRTD   G    L+ S+  ++
Sbjct: 118 AGYQIRMISTPGHTAGGCCYYIEEEEVLFSGDTLFAGSVGRTDFPTGSMSTLVRSVKERL 177

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           L L ++     GH   +TIG E+  NPFL
Sbjct: 178 LSLPEDTQVYPGHMEATTIGFEKENNPFL 206


>gi|299537708|ref|ZP_07050997.1| hypothetical protein BFZC1_16879 [Lysinibacillus fusiformis ZC1]
 gi|298726687|gb|EFI67273.1| hypothetical protein BFZC1_16879 [Lysinibacillus fusiformis ZC1]
          Length = 213

 Score =  164 bits (416), Expect = 7e-39,   Method: Composition-based stats.
 Identities = 58/213 (27%), Positives = 103/213 (48%), Gaps = 3/213 (1%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           ++     + P + NC  + ++E  E +V DPG + + +   I+S       I++TH H D
Sbjct: 1   MNVRSYSLGPVQTNCYIVSNKE-KECIVFDPGEEAERLIKTIRSNGLKPLAIFLTHAHFD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLS--IRMNARNASSDRWLQDGDTL 121
           H+G    ++E   + +    K+ + +       +              + D  ++    +
Sbjct: 60  HIGAVDAVREVFDVPVWIHEKEVSWLADPTKNGSSKYPALPDYRVAAPAQDTIIKKEQQI 119

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
            +   +F+    PGHSPG + Y+   + FA +GDTLF   +GRTD+L G  + L+ SI++
Sbjct: 120 EMSNFVFQAVFTPGHSPGSISYIFENDGFAIVGDTLFEQGVGRTDLLGGSTKILLESIHH 179

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           K+L L ++     GHG  +T+G E   NPFL  
Sbjct: 180 KLLTLPEDTIIYPGHGNYTTVGAEMETNPFLNG 212


>gi|327399418|ref|YP_004340287.1| beta-lactamase domain-containing protein [Hippea maritima DSM
           10411]
 gi|327182047|gb|AEA34228.1| beta-lactamase domain protein [Hippea maritima DSM 10411]
          Length = 209

 Score =  164 bits (415), Expect = 7e-39,   Method: Composition-based stats.
 Identities = 69/209 (33%), Positives = 114/209 (54%), Gaps = 3/209 (1%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +   +V V   ++NC  +FDE S E  ++DPG + + I  VI+        I  TH H D
Sbjct: 1   MVVKVV-VGELEENCYLVFDESSKECTIIDPGDEPEKIIGVIEKYALTPTIILNTHYHFD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG  A LK+  ++ +   H++D +++ K    A++  ++    +   D  L+DGD + +
Sbjct: 60  HVGANAFLKKRYNIKL-AIHENDLSLLKKAHIDAKIFLLKDQEPSPEPDILLKDGDIVDV 118

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G+  F+V H PGH+PG V +      +   GDTLF  S+GR D   G    L++S+  ++
Sbjct: 119 GSLSFEVLHTPGHTPGSVCFYEKNKKWLFSGDTLFFESVGRWDFPSGSKNDLLDSLK-RL 177

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           + L D++    GHG  +TI  ER+LNP++
Sbjct: 178 IKLPDDVLVYPGHGEPTTIEHERKLNPYI 206


>gi|77460925|ref|YP_350432.1| Beta-lactamase-like [Pseudomonas fluorescens Pf0-1]
 gi|77384928|gb|ABA76441.1| putative metallo-beta-lactamase family protein [Pseudomonas
           fluorescens Pf0-1]
          Length = 214

 Score =  164 bits (415), Expect = 7e-39,   Method: Composition-based stats.
 Identities = 70/208 (33%), Positives = 110/208 (52%), Gaps = 4/208 (1%)

Query: 7   HIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVG 66
               V P + NCT + D  + +A+VVDPGG+ D+I   + +    V  I  TH H+DH  
Sbjct: 11  ETFPVGPLQCNCTIIGDPITKKAIVVDPGGNSDLIMARLDALGLKVVSIIHTHAHLDHFL 70

Query: 67  GAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTH 126
            + Q+KE    T+   HK+D  +   ++ Q ++  +      +  DRWL D + L  G  
Sbjct: 71  ASGQMKEKTGATLH-LHKEDQFLWDNLEMQCQMFGVPYTPVPS-PDRWLSDDEELACGC- 127

Query: 127 IFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPL 186
                H PGH+PG + +   E      GDTLFR  +GRTD+  GD   ++ SI  ++  L
Sbjct: 128 -GVALHTPGHTPGSMSFWFSEAKLLIAGDTLFRRGVGRTDLWGGDQATIVRSIKQRLYTL 186

Query: 187 GDEISFVCGHGPNSTIGRERRLNPFLKS 214
            ++ + V GHGP++ +G E R NPF+++
Sbjct: 187 DEDATVVAGHGPDTRLGDEMRENPFVRA 214


>gi|253577655|ref|ZP_04854963.1| beta-lactamase domain-containing protein [Paenibacillus sp. oral
           taxon 786 str. D14]
 gi|251842947|gb|EES70987.1| beta-lactamase domain-containing protein [Paenibacillus sp. oral
           taxon 786 str. D14]
          Length = 236

 Score =  164 bits (415), Expect = 8e-39,   Method: Composition-based stats.
 Identities = 66/211 (31%), Positives = 103/211 (48%), Gaps = 7/211 (3%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L      + P + N   L  E+   A+++DPG +   +   I+     ++ I +TH H D
Sbjct: 30  LKIESFSLGPLQTNAYLLRGEDENRAIIIDPGSNPGPLLRRIE--GLEIEAILLTHAHFD 87

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQ--DGDTL 121
           H+GG  Q+++  +  +   H  ++  +        L+        ++        +G  L
Sbjct: 88  HIGGLDQIRKAKNCPVY-VHPLESDWLTTPKLNGSLMWPEAGPPISTDPAEFDLAEGQKL 146

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
            L  H F VFH PGHSPG V ++  ++ F   GD LFR  +GRTD+  G    L NSI  
Sbjct: 147 HLIGHEFTVFHTPGHSPGSVSFLCGDDLF--SGDVLFRLGVGRTDLPGGREADLFNSIRG 204

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           K+  L DE+    GHGP +TIG ER+ NP++
Sbjct: 205 KLFQLKDEVRVYPGHGPQTTIGYERQNNPYV 235


>gi|116626952|ref|YP_829108.1| beta-lactamase domain-containing protein [Candidatus Solibacter
           usitatus Ellin6076]
 gi|116230114|gb|ABJ88823.1| beta-lactamase domain protein [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 214

 Score =  164 bits (415), Expect = 8e-39,   Method: Composition-based stats.
 Identities = 76/211 (36%), Positives = 111/211 (52%), Gaps = 2/211 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +   I+ V   + NC+   DE + EA+VVDPG +++ I  ++      VK I ITH H+D
Sbjct: 1   MIHEILPVGMLQCNCSIFGDEGTREAIVVDPGDEIESILAIVTRHGLTVKAIVITHAHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+ GA QLK+     +     D    + ++ +           +    D   +DGDTLLL
Sbjct: 61  HIAGAQQLKKATGAPVYMNQNDTE--LQRMLDVQATWLGMPTPQAVEIDVAAKDGDTLLL 118

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G+    V H PGH+ G +            GDTLFR SIGRTD+  GD +Q++ SI++K+
Sbjct: 119 GSTELHVLHTPGHTQGSICLWMPGEGKLVAGDTLFRESIGRTDLPGGDGRQILQSIHDKL 178

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           LPL  E   + GHG  +T+  ER+ N FLK 
Sbjct: 179 LPLPGETEVIPGHGDLTTLAHERQFNYFLKG 209


>gi|228910095|ref|ZP_04073915.1| Metallo-beta-lactamase [Bacillus thuringiensis IBL 200]
 gi|228849612|gb|EEM94446.1| Metallo-beta-lactamase [Bacillus thuringiensis IBL 200]
          Length = 242

 Score =  164 bits (414), Expect = 9e-39,   Method: Composition-based stats.
 Identities = 60/213 (28%), Positives = 109/213 (51%), Gaps = 4/213 (1%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVK---QIWITHG 60
           + +  + + P + N   L +++  E ++ DPG + + +   +Q           + +TH 
Sbjct: 31  MKWIQMPLGPLQTNAYILMNDQ-KECIIFDPGHEGEKLVTYLQEEQLKPLKPLAVLLTHA 89

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H DH+G    +++   + +    ++   +       +++  +  +     +D  +    T
Sbjct: 90  HFDHIGAVDAVRDAFHIPVYVHKEEADWLGDATVNGSQIFMMNRSITAKPADHIIDAEGT 149

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           L +G+  F++F  PGHSPG + Y + E N    GD LF+ SIGRTD+  G + +LI SI 
Sbjct: 150 LTIGSFNFEIFETPGHSPGSISYYSKEANAVFSGDVLFQMSIGRTDLPGGSFAELIGSIE 209

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
            K+  L DE + +CGHGP ++IG E+  NPFL+
Sbjct: 210 EKLFVLPDETAVLCGHGPETSIGFEKENNPFLQ 242


>gi|330504867|ref|YP_004381736.1| beta-lactamase domain-containing protein [Pseudomonas mendocina
           NK-01]
 gi|328919153|gb|AEB59984.1| beta-lactamase domain-containing protein [Pseudomonas mendocina
           NK-01]
          Length = 215

 Score =  164 bits (414), Expect = 9e-39,   Method: Composition-based stats.
 Identities = 73/208 (35%), Positives = 109/208 (52%), Gaps = 4/208 (1%)

Query: 7   HIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVG 66
               V P + NCT + D  + +AVVVDPGG+ D+I   + +    V  I  TH H+DH  
Sbjct: 12  ETFPVGPLQCNCTIIGDPVTKKAVVVDPGGNPDLIMARLDAHGLKVVSIIHTHAHLDHFL 71

Query: 67  GAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTH 126
            + Q+KE    T+   HK+D  +   ++ Q  +  +      A  DRWL D + L  G  
Sbjct: 72  ASGQMKEKTGATLH-LHKEDQFLWDNLEMQCNMFGVPYTPVPA-PDRWLADDEELACGC- 128

Query: 127 IFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPL 186
                H PGH+PG + +   +      GDTLFR  IGRTD+  GDY  +  SI  ++  L
Sbjct: 129 -GVALHTPGHTPGSMSFWFEDAKLLIAGDTLFRRGIGRTDLWGGDYATIERSIRQRLYSL 187

Query: 187 GDEISFVCGHGPNSTIGRERRLNPFLKS 214
            ++ + V GHGP++ +G E R NPF+++
Sbjct: 188 DEDATVVTGHGPDTRLGDEMRENPFIRA 215


>gi|205374023|ref|ZP_03226823.1| YqgX [Bacillus coahuilensis m4-4]
          Length = 210

 Score =  164 bits (414), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 56/211 (26%), Positives = 100/211 (47%), Gaps = 2/211 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + +  + + P + NC  +++++  E V+ DPG +   +   I  +      I +TH H D
Sbjct: 1   MKWMKIPLGPLQTNCYIVYNDQ-KECVIFDPGEEAAKLMAKIDGQRLKPLAILLTHAHFD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G   +++    + +   HK +   +    +      ++ +   A+++  + +   L  
Sbjct: 60  HIGAVDKIRNQYKVPVY-IHKQEETWLSDGMKNGSQNFLQYSITAAAAEHVISEETQLTF 118

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
              +  V   PGHSPG V +   +      GD LF+ SIGRTD+  G   QL+ SI+ K+
Sbjct: 119 NDFVIHVMETPGHSPGSVSFYLEKEEIVVSGDALFQGSIGRTDLYKGSMDQLLKSIHTKL 178

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           L L +    + GHGP +TI  E   NP+L  
Sbjct: 179 LSLPERTIVLPGHGPTTTIEEEMVSNPYLNG 209


>gi|303256632|ref|ZP_07342646.1| metallo-beta-lactamase family protein [Burkholderiales bacterium
           1_1_47]
 gi|302860123|gb|EFL83200.1| metallo-beta-lactamase family protein [Burkholderiales bacterium
           1_1_47]
          Length = 208

 Score =  164 bits (414), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 65/209 (31%), Positives = 98/209 (46%), Gaps = 5/209 (2%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +S  +  + P + NC  + +E   +AV +D GGD   +   ++     +K I ITH H D
Sbjct: 5   MSVAVFPLGPLETNCYIVSNE--GQAVAIDVGGDPAPVSKYLKEHGLELKAICITHMHFD 62

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+ G A L  +   T+  P KD       +    +  S    A        ++ G+    
Sbjct: 63  HLYGVAALAAETHATVYTPEKDKVIASTVLG---QGGSSGFPAVPKFESVSIEPGNKTEF 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
                KV   PGH+PG V Y   +     +GDTLF  SIGRTD     ++QL+ SI +++
Sbjct: 120 AGLECKVLSVPGHTPGSVAYYFKKEKCVFVGDTLFLESIGRTDFPFSSHEQLVTSIRSEL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
             L D+     GHGP ++IG E+  N FL
Sbjct: 180 FSLPDDTIVYPGHGPETSIGYEKEHNAFL 208


>gi|224370205|ref|YP_002604369.1| putative metallo-beta-lactamase family protein [Desulfobacterium
           autotrophicum HRM2]
 gi|223692922|gb|ACN16205.1| putative metallo-beta-lactamase family protein [Desulfobacterium
           autotrophicum HRM2]
          Length = 208

 Score =  164 bits (414), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 75/209 (35%), Positives = 107/209 (51%), Gaps = 4/209 (1%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +    ++V P   NC  L  + + +AVV+DPG + D I   +      V+ I  THGH D
Sbjct: 1   MIIKKLEVGPIMANCYILGCDRTRKAVVIDPGDEADRILMALSELKLSVEYILNTHGHFD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG  A+LKE     ++  H+DDA M+  +   A    +     + + D +L DGD +  
Sbjct: 61  HVGANARLKEATGAKLM-IHQDDAPMLKDLTSAAATFGL-RAENSPAPDGYLADGDEVTF 118

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V H PGHS        +       GDTLF  SIGRTD+  G+Y  LI+SI  ++
Sbjct: 119 GDITLTVIHTPGHS--RGGISLYTKGVLFSGDTLFAGSIGRTDLPGGNYDTLIHSIKTRL 176

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           L L  +     GHGP ++I +E R+NPFL
Sbjct: 177 LCLDKKTIVYPGHGPETSILQEERMNPFL 205


>gi|291539587|emb|CBL12698.1| Zn-dependent hydrolases, including glyoxylases [Roseburia
           intestinalis XB6B4]
          Length = 209

 Score =  164 bits (414), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 70/212 (33%), Positives = 100/212 (47%), Gaps = 3/212 (1%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M+ L      V P + NC F  ++++ E +V+DPG   D +   I         I +THG
Sbjct: 1   MAPLKVEQYVVGPVQTNCYFAINDDTKEVLVIDPGASADQLAKKICQEKLTPIAILLTHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H DH GGA +L +   + I     +   +         L       +   +D +L++   
Sbjct: 61  HFDHAGGAEELAKHFDIKIYAEEHEKETL---DTPSLNLSGWEGVQKTYHADVFLKNEQE 117

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           + L     +VFH PGH+ G   Y     N    GDTLF +S+GRTD   G   Q+I SI 
Sbjct: 118 IDLAGFHIRVFHTPGHTVGGCCYYFPYQNVVFSGDTLFCTSVGRTDFPKGSAAQIIRSIK 177

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
            K+LPL DE +   GH   +TIG ER  NP+L
Sbjct: 178 EKLLPLPDETTVYTGHNDITTIGTERMYNPYL 209


>gi|326382137|ref|ZP_08203829.1| beta-lactamase domain-containing protein [Gordonia neofelifaecis
           NRRL B-59395]
 gi|326198867|gb|EGD56049.1| beta-lactamase domain-containing protein [Gordonia neofelifaecis
           NRRL B-59395]
          Length = 227

 Score =  164 bits (414), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 64/214 (29%), Positives = 102/214 (47%), Gaps = 6/214 (2%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDL-DIIKDVIQSRNFHVKQIWITHGHV 62
           +         F+ NC  + ++   +AV++DPG D    +++ +   +     +++THGH+
Sbjct: 1   MLIAGFPAGMFQTNCYLVAEDRGSDAVIIDPGQDAAPRVREALAEYDLTPVAVFLTHGHL 60

Query: 63  DHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDE----QARLLSIRMNARNASSDRWLQDG 118
           DH   A +L ++ S+ +   H DD  M+             +   M            DG
Sbjct: 61  DHTWNATELADEFSIPVY-IHADDRPMLTDPGMGLGSALSSMIGDMTFVEPEKVIEFVDG 119

Query: 119 DTLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINS 178
           + +      + V H PGHS G V+           GD LF  SIGRTD+  G +QQL++S
Sbjct: 120 EDVDAAGIRWAVDHAPGHSRGSVLLSPDAAEVCFSGDVLFNGSIGRTDLPGGSHQQLLDS 179

Query: 179 INNKILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           I  K++   D++  + GHGP +TIG ER  NPFL
Sbjct: 180 IAAKLMGRDDDLVILPGHGPQTTIGAERASNPFL 213


>gi|146308666|ref|YP_001189131.1| beta-lactamase domain-containing protein [Pseudomonas mendocina
           ymp]
 gi|145576867|gb|ABP86399.1| beta-lactamase domain protein [Pseudomonas mendocina ymp]
          Length = 215

 Score =  164 bits (414), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 73/208 (35%), Positives = 111/208 (53%), Gaps = 4/208 (1%)

Query: 7   HIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVG 66
               V P + NCT + D  + +A+VVDPGG+ D+I   +++    V  I  TH H+DH  
Sbjct: 12  ETFPVGPLQCNCTIIGDPLTKKAIVVDPGGNPDLIMARLEAHGLKVVSIIHTHAHLDHFL 71

Query: 67  GAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTH 126
            + Q+KE    T+   HK+D  +   ++ Q R+  +      A  DRWL D + L  G  
Sbjct: 72  ASGQMKEKTGATLH-LHKEDQFLWDNLEMQCRMFGVPYTPVPA-PDRWLADDEELACGC- 128

Query: 127 IFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPL 186
                H PGH+PG + +   +      GDTLFR  IGRTD+  GDY  +  SI  ++  L
Sbjct: 129 -GVALHTPGHTPGSMSFWFADAKLLIAGDTLFRRGIGRTDLWGGDYATIERSIRQRLYRL 187

Query: 187 GDEISFVCGHGPNSTIGRERRLNPFLKS 214
            ++ + V GHGP++ +G E R NPF+++
Sbjct: 188 DEDATVVTGHGPDTRLGDEMRENPFIRA 215


>gi|295399165|ref|ZP_06809147.1| beta-lactamase domain protein [Geobacillus thermoglucosidasius
           C56-YS93]
 gi|312110233|ref|YP_003988549.1| beta-lactamase [Geobacillus sp. Y4.1MC1]
 gi|294978631|gb|EFG54227.1| beta-lactamase domain protein [Geobacillus thermoglucosidasius
           C56-YS93]
 gi|311215334|gb|ADP73938.1| beta-lactamase domain protein [Geobacillus sp. Y4.1MC1]
          Length = 210

 Score =  163 bits (413), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 70/211 (33%), Positives = 101/211 (47%), Gaps = 2/211 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + +  + V P + N   L  E+    VV DPGG+ D I   I+ +      I +TH H D
Sbjct: 1   MKWERIPVGPIQANAYILSRED-GTCVVFDPGGEGDKIVRRIEEQQLTPLAILLTHAHFD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+GG  +LK+   L I   H+ +   +                        L+   TL +
Sbjct: 60  HIGGINELKQKWELPIY-IHEKEKEWLTDPALNGSAYFGIGQVAIHHEPTCLRGEQTLQI 118

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   F++   PGHSPG + Y   E      GD LF  SIGRTD+  G+++QL+ SI++K+
Sbjct: 119 GAFAFELLETPGHSPGSISYYCKEIEAVFSGDVLFLGSIGRTDLPGGNHEQLLRSIHDKL 178

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           L L +E   + GHG  +TIG E   NPFL  
Sbjct: 179 LTLPEETLVLSGHGSETTIGAEMDTNPFLHG 209


>gi|304316997|ref|YP_003852142.1| beta-lactamase [Thermoanaerobacterium thermosaccharolyticum DSM
           571]
 gi|302778499|gb|ADL69058.1| beta-lactamase domain protein [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
          Length = 210

 Score =  163 bits (413), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 66/211 (31%), Positives = 102/211 (48%), Gaps = 3/211 (1%)

Query: 2   SKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGH 61
           + ++     + PF+ NC  L  ++S E V+VDPG     I++ I+  N  +K I +THGH
Sbjct: 3   NDINIQRFVLGPFQSNCYVLSIKDSNECVMVDPGIPAKEIENYIEKNNLSLKYILVTHGH 62

Query: 62  VDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
            DH+GG    ++  +  +     DD+ ++         +S +      +      D    
Sbjct: 63  FDHIGGVDFFRDRFNAKVCIS-ADDSVLLSDTRLNLSEISFKKIVVKNADILLNDDDTLK 121

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
           L       V H PGH+P         +     GDTLF+ SIGRTD   G+Y ++I+SI N
Sbjct: 122 LNNDITISVIHTPGHTP--GGLCYKVDGVCFSGDTLFKGSIGRTDFPGGNYSEIIDSIKN 179

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           K+  L D++    GHG  +TI  E+  NPFL
Sbjct: 180 KLFVLDDDLLVYPGHGDITTIKEEKLHNPFL 210


>gi|153955743|ref|YP_001396508.1| hypothetical protein CKL_3129 [Clostridium kluyveri DSM 555]
 gi|219856112|ref|YP_002473234.1| hypothetical protein CKR_2769 [Clostridium kluyveri NBRC 12016]
 gi|146348601|gb|EDK35137.1| Conserved hypothetical protein [Clostridium kluyveri DSM 555]
 gi|219569836|dbj|BAH07820.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 199

 Score =  163 bits (413), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 68/209 (32%), Positives = 103/209 (49%), Gaps = 10/209 (4%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +    + V  +  NC  L DE SL+  V+DPGGD   I   ++     VK I +THGH+D
Sbjct: 1   MKIKSLVVGSYGTNCYILIDEGSLQCAVIDPGGDAPQIIKAVEDSKCKVKYILLTHGHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H G   +LK   +  +    KD   +         + +         +  +++D     +
Sbjct: 61  HTGAVVELKNKYNAPVAISEKDYKMVQQGAFVYGNIGNE--------APLYIKDNQIFEI 112

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    K  + PGH+PG V +    +     GDTLF+ SIGRTD   GD++ +I+SI  KI
Sbjct: 113 GDIKLKAIYTPGHTPGGVSF--LTDKVVFSGDTLFQGSIGRTDFPGGDFETIIDSIKTKI 170

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           + L +E   + GHGP + +G E+  NPFL
Sbjct: 171 IVLPNETVVLSGHGPKTFVGEEKMHNPFL 199


>gi|251778952|ref|ZP_04821872.1| metallo-beta-lactamase family protein [Clostridium botulinum E1
           str. 'BoNT E Beluga']
 gi|243083267|gb|EES49157.1| metallo-beta-lactamase family protein [Clostridium botulinum E1
           str. 'BoNT E Beluga']
          Length = 200

 Score =  163 bits (413), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 77/209 (36%), Positives = 113/209 (54%), Gaps = 11/209 (5%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +    +    ++ NC  + DE + E  ++DPGGD   +K +I S N  VK I +THGH+D
Sbjct: 1   MIIKTIPAGMYEANCYLVIDENTKECGIIDPGGDAKRLKSIIDSLNVDVKYILLTHGHMD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVGG  +L E   +            + K+DE+       +      +  +LQ+GDT+ L
Sbjct: 61  HVGGVVELSEAFKIP---------FYISKIDEEYMEKDNFVFGTLPKASGYLQEGDTIKL 111

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   FKV   PGH+           +    GDTLF++SIGRTD + G+++++I SI  K+
Sbjct: 112 GNKEFKVIETPGHT--KGGLCFLIEDKLFTGDTLFQASIGRTDFVGGNFEEIIKSIKEKL 169

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           L LGD+I    GHGP STIG E++ N FL
Sbjct: 170 LILGDDIEVYPGHGPMSTIGYEKKKNSFL 198


>gi|239624474|ref|ZP_04667505.1| beta-lactamase domain-containing protein [Clostridiales bacterium
           1_7_47_FAA]
 gi|239520860|gb|EEQ60726.1| beta-lactamase domain-containing protein [Clostridiales bacterium
           1_7_47FAA]
          Length = 213

 Score =  163 bits (412), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 63/210 (30%), Positives = 96/210 (45%), Gaps = 2/210 (0%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           MS +      +     NC  ++ + + EAV++DP  +   I +         + + +THG
Sbjct: 1   MSDMRVKTCVLGAVSTNCFLVYHDTTKEAVIIDPADNAHYILNKCSELGISPRAVLLTHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H DH+  A  L+    + I     +DA +       +          +  +D  L+DGD 
Sbjct: 61  HFDHIMAAEDLRRTFHIKIYASETEDAMLADGGLNMSGSWGGMQ--TSFHADVLLKDGDE 118

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           L L    +KV   PGH+ G V Y          GDTLF  S GRTD+  G   Q+++SI 
Sbjct: 119 LDLIGFCWKVIETPGHTSGSVCYYVPGEEVVFAGDTLFCESYGRTDLPTGSSSQIVDSII 178

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNP 210
           NK+  L D+     GHG  +TIG E++ NP
Sbjct: 179 NKVFHLPDDTMVYPGHGETTTIGHEKQSNP 208


>gi|165975579|ref|YP_001651172.1| glyoxalase II family protein [Actinobacillus pleuropneumoniae
           serovar 3 str. JL03]
 gi|165875680|gb|ABY68728.1| glyoxalase II family protein [Actinobacillus pleuropneumoniae
           serovar 3 str. JL03]
          Length = 209

 Score =  163 bits (412), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 77/209 (36%), Positives = 127/209 (60%), Gaps = 2/209 (0%)

Query: 5   SFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDH 64
           +  I+ V+ F+QNC+ ++D ++  A ++D G D D I   ++S+N  V+++ +THGH+DH
Sbjct: 3   NLQIIPVSAFQQNCSVIWD-DNKNAAIIDAGDDADKIIQFVESQNLKVQKLLLTHGHLDH 61

Query: 65  VGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLG 124
           +    ++++   + + G H DD  +  ++ +   +  I    +    D WL + D + +G
Sbjct: 62  IMAVEKVRDHFGVEVYGSHIDDKPLFEQLPQMCEMFGIPP-VKAFLPDHWLSEDDRVEVG 120

Query: 125 THIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKIL 184
              F V H PGH+PGH+ + +FEN  A  GD LF+ SIGRTD+  G+   L+N+I  K+ 
Sbjct: 121 ALRFSVRHLPGHAPGHIGFFDFENKIAFSGDVLFKDSIGRTDLYLGNLDVLLNTICTKMF 180

Query: 185 PLGDEISFVCGHGPNSTIGRERRLNPFLK 213
            L D+   V GHGP++TIGRE++ NPFLK
Sbjct: 181 DLDDDFIVVAGHGPHTTIGREKQHNPFLK 209


>gi|187934431|ref|YP_001885232.1| metallo-beta-lactamase family protein [Clostridium botulinum B str.
           Eklund 17B]
 gi|187722584|gb|ACD23805.1| metallo-beta-lactamase family protein [Clostridium botulinum B str.
           Eklund 17B]
          Length = 200

 Score =  163 bits (412), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 77/209 (36%), Positives = 112/209 (53%), Gaps = 11/209 (5%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +    +    ++ NC  + D+ + E  ++DPGGD + +K +I S    VK I +THGH+D
Sbjct: 1   MIIKTIPAGIYEANCYLVIDDNTKECGIIDPGGDAERLKSIINSLKVDVKYILLTHGHMD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVGG  +L E   +            + K+DE+       +      +  +LQ+GDT+ L
Sbjct: 61  HVGGVVELSEAFKVP---------FYINKIDEEYMEKDNFVFGTLPKASGYLQEGDTIKL 111

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   FKV   PGH+        F  +    GDTLF+ SIGRTD   G+++++I SI  K+
Sbjct: 112 GDKEFKVIETPGHT--KGGLCFFIEDKLFTGDTLFQGSIGRTDFAGGNFEEIIKSIKEKL 169

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           L LGD+I    GHGP STIG E+R N FL
Sbjct: 170 LILGDDIEVYPGHGPVSTIGYEKRKNSFL 198


>gi|239827714|ref|YP_002950338.1| beta-lactamase [Geobacillus sp. WCH70]
 gi|239808007|gb|ACS25072.1| beta-lactamase domain protein [Geobacillus sp. WCH70]
          Length = 210

 Score =  163 bits (412), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 66/211 (31%), Positives = 102/211 (48%), Gaps = 2/211 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + +  + V P + N   L  ++    V+ DPGG+ D I   I+ +      I +TH H D
Sbjct: 1   MEWKRIPVGPIQANAYILSHDD-GTCVIFDPGGEGDKIVRHIEEQGLTPLAILLTHAHFD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+GG  ++++   L I   H+++   +                        L+   TL +
Sbjct: 60  HIGGINEVRKKWELPIY-IHENEKEWLTDPALNGSAYFGIGQVVVHHEPTCLRGEQTLQI 118

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   F++   PGHSPG + Y   E      GD LF  SIGRTD+  G+++QL+ SI++K+
Sbjct: 119 GDFAFELLETPGHSPGSISYYCKEIEAVFSGDVLFLGSIGRTDLPGGNHEQLLRSIHDKL 178

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           L L +E   + GHG  +TIG E   NPFL  
Sbjct: 179 LTLPEETVVLSGHGRETTIGAEMDTNPFLHG 209


>gi|91202855|emb|CAJ72494.1| similar to hydroxyacylglutathione hydrolase [Candidatus Kuenenia
           stuttgartiensis]
          Length = 217

 Score =  163 bits (412), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 75/218 (34%), Positives = 113/218 (51%), Gaps = 9/218 (4%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +    + V P +  CT++  + S EA++VDPG D + I   I +     K + ITHGH D
Sbjct: 1   MIIRKITVGPLQV-CTYIVYDVSAEALIVDPGADPEKIIAFINALKLLPKHVVITHGHGD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARL---LSIRMNARNASSDRWLQDGDT 120
           H+G  A LKE      I  H+ D  M+    +   +          R+  +DR L++GDT
Sbjct: 60  HIGANASLKEAFPELQICVHEKDHDMLPYPAKNLSILAAFYGGATVRSPYADRTLKEGDT 119

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHL-----GDTLFRSSIGRTDILHGDYQQL 175
           +  G  IF+V H PGH+PG +     +           GD+LF++ IGRTD      + L
Sbjct: 120 ISAGKCIFEVIHTPGHTPGGICLYRKDPEKGQPPVLFSGDSLFKNGIGRTDFPGCSQETL 179

Query: 176 INSINNKILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           I SI NK+L L ++     GHGP++T+  E++ NPFL+
Sbjct: 180 IQSIKNKLLVLDEKTIIYPGHGPSTTLAEEKQHNPFLQ 217


>gi|294501241|ref|YP_003564941.1| metallo-beta-lactamase family protein [Bacillus megaterium QM
           B1551]
 gi|294351178|gb|ADE71507.1| metallo-beta-lactamase family protein [Bacillus megaterium QM
           B1551]
          Length = 210

 Score =  163 bits (412), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 64/211 (30%), Positives = 105/211 (49%), Gaps = 2/211 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++H + + P + NC  + +E+  E +V DPG     + + ++ + +    I +TH H D
Sbjct: 1   MNYHRIPLGPIQTNCYVVANEK-KECLVFDPGAQGKQLVEFLEKQTYKPLAILLTHAHFD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+GG  ++    S+ +   HK++   +   D                +   +     L +
Sbjct: 60  HIGGVDEVMNHYSIPLY-VHKNEKEWLHNSDLNGSKFFDLGEITAPDATDIISVEGNLTI 118

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G+  F+V+  PGHSPG V Y     NF   GD LF   IGRTD+  G+  QL+ SI +K+
Sbjct: 119 GSFQFEVYETPGHSPGSVSYYFKLGNFVVSGDALFAGGIGRTDLPGGNQAQLLESIESKL 178

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           L L ++   + GHGP +T+G E   NPFL  
Sbjct: 179 LSLPEDTLVLSGHGPETTVGHEMDQNPFLNG 209


>gi|289812172|ref|ZP_06542801.1| hypothetical protein Salmonellaentericaenterica_50992 [Salmonella
           enterica subsp. enterica serovar Typhi str. AG3]
          Length = 202

 Score =  163 bits (412), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 78/201 (38%), Positives = 129/201 (64%), Gaps = 1/201 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++ I+ VT   QNC+ ++ E++  A +VDP GD + IK  + +    + QI +THGH+D
Sbjct: 1   MNYRIIPVTASSQNCSLIWCEQTRLAALVDPDGDAEKIKQEVDASGVTLMQILLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG A++L +   + +IGP K+D   +  +  Q+R+  +    +  + DRWL DGD + +
Sbjct: 61  HVGAASELAQHYGVPVIGPEKEDEFWLQGLPAQSRMFGLDEC-QPLTPDRWLNDGDRVSV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V HCPGH+PGHV++ + ++     GD +F+  +GR+D   GD+ QLI++I  K+
Sbjct: 120 GNVTLQVLHCPGHTPGHVVFFDEQSQLLISGDVIFKGGVGRSDFPRGDHTQLIDAIKRKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGR 204
           LPLGD+++F+ GHGP ST+G 
Sbjct: 180 LPLGDDVTFIPGHGPLSTLGY 200


>gi|166031161|ref|ZP_02233990.1| hypothetical protein DORFOR_00847 [Dorea formicigenerans ATCC
           27755]
 gi|166029008|gb|EDR47765.1| hypothetical protein DORFOR_00847 [Dorea formicigenerans ATCC
           27755]
          Length = 223

 Score =  163 bits (412), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 58/212 (27%), Positives = 97/212 (45%), Gaps = 3/212 (1%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +      +     NC  L +EE+ + VVVDPGG        I+    ++  I +THGH D
Sbjct: 15  MKIEKFPLGILGANCYLLINEETKDTVVVDPGGHSKKFTAYIEEEKLNLVAILLTHGHFD 74

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+ G   + E+ ++ +    ++D  +M   +    L S   N  +    + L+DG  L L
Sbjct: 75  HIMGIDSILENWNIPVY-VEEEDLPIMTDPE--LNLSSSYTNGYSFDGAKPLKDGQKLEL 131

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
                +V H PGH+ G   Y     +    GDTLF+ S+GRTD  +     ++ S+  ++
Sbjct: 132 AGETIEVIHTPGHTMGGCCYYLPVEHAVFSGDTLFQRSVGRTDFPNSSQDAIVRSVRERL 191

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSN 215
             L D+     GH   + I  E+  NP+++  
Sbjct: 192 FALPDDTIVYPGHMGETKIEYEKLHNPYVQEG 223


>gi|297544509|ref|YP_003676811.1| beta-lactamase domain-containing protein [Thermoanaerobacter
           mathranii subsp. mathranii str. A3]
 gi|296842284|gb|ADH60800.1| beta-lactamase domain protein [Thermoanaerobacter mathranii subsp.
           mathranii str. A3]
          Length = 207

 Score =  162 bits (411), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 71/211 (33%), Positives = 109/211 (51%), Gaps = 4/211 (1%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +      V  +K NC  + DEE+ E +V+DPG     I+D I      VK I +THGH D
Sbjct: 1   MKIQRYVVGLYKANCYIVSDEETRETIVIDPGEYSSEIQDYIGINKLRVKYILLTHGHFD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+GG  +L++     +    +D   ++           +    + +++D  L  GD L  
Sbjct: 61  HIGGVEELRKVTQAEVAISKEDAPLLLD--PSLNLSKMVYKKIQCSAADILLNGGDILYF 118

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G +  +V H PGH+          +N    GDT+F+ SIGR D   GD+  L++SI NK+
Sbjct: 119 GKYTIEVLHTPGHT--KGGVCFKIDNVCFTGDTVFKGSIGRYDFPGGDFDTLMDSIKNKL 176

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           L L D++    GHG +STIG+E+R+N FL+ 
Sbjct: 177 LVLEDDVVIYPGHGESSTIGKEKRINLFLRE 207


>gi|295706588|ref|YP_003599663.1| metallo-beta-lactamase family protein [Bacillus megaterium DSM 319]
 gi|294804247|gb|ADF41313.1| metallo-beta-lactamase family protein [Bacillus megaterium DSM 319]
          Length = 210

 Score =  162 bits (411), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 64/211 (30%), Positives = 104/211 (49%), Gaps = 2/211 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++H + + P + NC  + +E+  E +V DPG     +   ++ + +    I +TH H D
Sbjct: 1   MNYHRIPLGPIQTNCYVVANEK-KECLVFDPGAQGKQLVQFLEKQTYKPLAILLTHAHFD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+GG  ++    S+ +   HK++   +   D                +   +     L +
Sbjct: 60  HIGGVDEVMNHYSIPLY-VHKNEKEWLHNSDLNGSKFFDLGEITAPDATDIISIEGNLTI 118

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G+  F+V+  PGHSPG V Y     NF   GD LF   IGRTD+  G+  QL+ SI +K+
Sbjct: 119 GSFQFEVYETPGHSPGSVSYYFKPGNFVVSGDALFAGGIGRTDLPGGNQAQLLESIESKL 178

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           L L ++   + GHGP +T+G E   NPFL  
Sbjct: 179 LSLPEDTLVLSGHGPETTVGHEMDQNPFLNG 209


>gi|291527557|emb|CBK93143.1| Zn-dependent hydrolases, including glyoxylases [Eubacterium rectale
           M104/1]
          Length = 209

 Score =  162 bits (411), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 59/212 (27%), Positives = 95/212 (44%), Gaps = 3/212 (1%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M  +      V P + NC F+ + ++ E +++DPG   + +   +         I +THG
Sbjct: 1   MVNMKIDHFVVGPVQTNCYFVTNIKTKEMIIIDPGACANQLAKKVDESGAKPVAILLTHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H DH   A  L +   + I   H+ D A +     Q  +  +   ++   +D +L+D   
Sbjct: 61  HFDHATDAKPLADRYGIKIY-IHEADKATLDDP--QLNVSYMMGQSKTFYADVFLKDKQE 117

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           + +      V H PGH+PG   Y     +    GD+LF  SIGRTD   G    L+ ++ 
Sbjct: 118 IDIAGFHIVVLHTPGHTPGGCCYYFPYEDVIFTGDSLFCGSIGRTDFKGGSMSDLVRTVK 177

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
            KI+ L +      GH   +TI  ER  NP+L
Sbjct: 178 EKIMTLPEHTEVYPGHNDTTTIENERMYNPYL 209


>gi|116749167|ref|YP_845854.1| beta-lactamase domain-containing protein [Syntrophobacter
           fumaroxidans MPOB]
 gi|116698231|gb|ABK17419.1| beta-lactamase domain protein [Syntrophobacter fumaroxidans MPOB]
          Length = 214

 Score =  162 bits (411), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 57/217 (26%), Positives = 98/217 (45%), Gaps = 8/217 (3%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +    + V   +  C  ++DE S E +++DP GD D +  +++ +   ++ +  THGH D
Sbjct: 1   MKILQIPVGFMQVFCYLVYDEVSGEGILIDPAGDEDGLIQLLKEKGVKLRYVVNTHGHPD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H  G  ++ +     ++    DD        E      +        +D  ++DGD L  
Sbjct: 61  HTCGNGKIIDATGAKVVMHTLDDQYFQR--PESKGFARMMGFQPAPPADVRVEDGDELTF 118

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    K  + PGH+PG        +     GDTLF  ++GRTD+  G + +LI S+  KI
Sbjct: 119 GNLTMKFINTPGHTPGS--CCVLIDGNLFTGDTLFVGAVGRTDLPGGSFGELIQSLKTKI 176

Query: 184 LPLGDEISFVCGHG----PNSTIGRERRLNPFLKSNI 216
           + L  +     GH     P ST+  E + NP++   +
Sbjct: 177 VTLPPDTVVWPGHDYGDRPFSTVKHEMKTNPYITDFM 213


>gi|288553364|ref|YP_003425299.1| metallo beta-lactamase [Bacillus pseudofirmus OF4]
 gi|288544524|gb|ADC48407.1| metallo beta-lactamase [Bacillus pseudofirmus OF4]
          Length = 211

 Score =  162 bits (411), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 64/209 (30%), Positives = 105/209 (50%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +++  + + P + N   L +E+  EAV+ DPGG+       +  +      I +TH H D
Sbjct: 1   MNWTQIPLGPLQTNAYVLMNEK-KEAVIFDPGGNGPEFIKWLNDQQISPIAILLTHAHFD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G   +++E  +  +     +   +       +       +    ++D  +Q+  T+ L
Sbjct: 60  HIGAVDEVREAFNCPVYIHEAEKDWLSDAAKNGSGRFLGNASITACAADEIIQEEKTIQL 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G+  F + + PGHSPG V Y +        GD LF+ SIGRTD+  GD+  L+ SI++K+
Sbjct: 120 GSFSFDILYTPGHSPGSVSYYSATEGVVFSGDALFKQSIGRTDLPGGDHNLLLKSIHSKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           L L +E     GHGP +TIG E   NPFL
Sbjct: 180 LELPEETIVASGHGPVTTIGEEMDGNPFL 208


>gi|312959041|ref|ZP_07773560.1| beta-lactamase-like protein [Pseudomonas fluorescens WH6]
 gi|311286811|gb|EFQ65373.1| beta-lactamase-like protein [Pseudomonas fluorescens WH6]
          Length = 214

 Score =  162 bits (411), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 70/208 (33%), Positives = 110/208 (52%), Gaps = 4/208 (1%)

Query: 7   HIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVG 66
               V P + NCT + D  + +A+VVDPGG+ ++I   + +    V  I  TH H+DH  
Sbjct: 11  ETFPVGPLQCNCTIIGDPITKKAIVVDPGGNHELILARLDALGLKVVSIIHTHAHLDHFL 70

Query: 67  GAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTH 126
            + QLKE    T+   HKDD  +   ++ Q ++  +      +  DRWL+D + L  G  
Sbjct: 71  ASGQLKEKTGATLH-LHKDDQFLWDNLEMQCQMFRVPYTPVPS-PDRWLEDDEELACGC- 127

Query: 127 IFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPL 186
                H PGH+PG + +   +      GDTLFR  +GRTD+  GD   ++ SI  ++  L
Sbjct: 128 -GVALHTPGHTPGSMSFWFADARLLIAGDTLFRRGVGRTDLWGGDQATIVRSIKQRLYTL 186

Query: 187 GDEISFVCGHGPNSTIGRERRLNPFLKS 214
            +  + V GHGP++ +G E R NPF+++
Sbjct: 187 DEGATVVTGHGPDTRLGDEMRENPFVRA 214


>gi|238925276|ref|YP_002938793.1| hydroxyacylglutathione hydrolase [Eubacterium rectale ATCC 33656]
 gi|238876952|gb|ACR76659.1| hydroxyacylglutathione hydrolase [Eubacterium rectale ATCC 33656]
 gi|291524425|emb|CBK90012.1| Zn-dependent hydrolases, including glyoxylases [Eubacterium rectale
           DSM 17629]
          Length = 209

 Score =  162 bits (411), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 60/212 (28%), Positives = 95/212 (44%), Gaps = 3/212 (1%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M  +      V P + NC F+ + ++ E +++DPG   + +   +         I +THG
Sbjct: 1   MVNMKIDHFVVGPVQTNCYFVTNIKTKEMIIIDPGACANQLAKKVDESGAKPVAILLTHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H DH   A  L +   + I   H+ D A +     Q  +  +   ++   +D +L+D   
Sbjct: 61  HFDHATDAKPLADRYGIKIY-IHEADKATLDDP--QLNVSYMMGQSKTFYADVFLKDKQE 117

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           L +      V H PGH+PG   Y     +    GD+LF  SIGRTD   G    L+ ++ 
Sbjct: 118 LDIAGFHIVVLHTPGHTPGGCCYYFPYEDVIFTGDSLFCGSIGRTDFKGGSMSDLVRTVK 177

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
            KI+ L +      GH   +TI  ER  NP+L
Sbjct: 178 EKIMTLPEHTEVYPGHNDTTTIENERMYNPYL 209


>gi|219872272|ref|YP_002476647.1| glyoxalase II family protein [Haemophilus parasuis SH0165]
 gi|219692476|gb|ACL33699.1| glyoxalase II family protein [Haemophilus parasuis SH0165]
          Length = 209

 Score =  162 bits (410), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 74/209 (35%), Positives = 128/209 (61%), Gaps = 2/209 (0%)

Query: 5   SFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDH 64
           +  I+ V+ F+QNC+ ++D E   AV++D G D D I   ++ +  +V+++ ITHGH+DH
Sbjct: 3   NLQIIPVSVFQQNCSVVWDNE-KNAVIIDAGDDADKIIRFVEEQQLNVQKLLITHGHLDH 61

Query: 65  VGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLG 124
           +    +L++  ++ + G H++D  +  ++    +   +   +     D WL  GD + +G
Sbjct: 62  IMAVDRLRKHFNVDVFGSHQNDQPLFEQLPNICQSYGLPA-SPAFLPDHWLNAGDKIQIG 120

Query: 125 THIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKIL 184
              F + + PGHSPGH+ + +FEN  A  GD LF+ SIGRTD+  G+++QLI +I  ++ 
Sbjct: 121 ALTFHIRYLPGHSPGHIGFFDFENKIAFSGDVLFKDSIGRTDLYQGNFEQLIYTIKTQLF 180

Query: 185 PLGDEISFVCGHGPNSTIGRERRLNPFLK 213
            L D+   + GHG ++T+GRE++ NPFLK
Sbjct: 181 DLEDDFIIIPGHGSHTTVGREKQHNPFLK 209


>gi|317052051|ref|YP_004113167.1| beta-lactamase domain-containing protein [Desulfurispirillum
           indicum S5]
 gi|316947135|gb|ADU66611.1| beta-lactamase domain protein [Desulfurispirillum indicum S5]
          Length = 244

 Score =  162 bits (410), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 79/210 (37%), Positives = 114/210 (54%), Gaps = 1/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L +H+  V P + NC  LF+  S +AVV+DPGGD + I   +   +   +    THGH D
Sbjct: 34  LQYHVFAVGPLEANCAVLFESPSGDAVVIDPGGDANTITRFLDEHHLTPRYFLHTHGHFD 93

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG  + LK+         H+ D  +    D+ A+L  ++     A+   +L    +L L
Sbjct: 94  HVGALSALKKKYPDATYLIHQQDETLAMHADKTAQLYGLQALPATAADA-YLSAETSLQL 152

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V   PGH+PG V +   E N    GDTLF+ SIGRTD+  G+Y QLI+SI  K+
Sbjct: 153 GASQITVIETPGHTPGGVCFYLNEENLLFSGDTLFQGSIGRTDLPGGNYDQLIHSIRTKL 212

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
             L DE+  + GHGP ++IG E++ NPF +
Sbjct: 213 FGLPDEVVVIPGHGPRTSIGAEKKHNPFFR 242


>gi|262202240|ref|YP_003273448.1| beta-lactamase [Gordonia bronchialis DSM 43247]
 gi|262085587|gb|ACY21555.1| beta-lactamase domain protein [Gordonia bronchialis DSM 43247]
          Length = 246

 Score =  162 bits (410), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 64/232 (27%), Positives = 98/232 (42%), Gaps = 21/232 (9%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDL-DIIKDVIQSRNFHVKQIWITH 59
           M  +         F+ NC  +      +AV++DPG D    +++++   +     + +TH
Sbjct: 1   MVGMLITGFAAGMFQTNCYIVASGAGSDAVIIDPGQDAAPRVRELLAEHDLTPVAVLLTH 60

Query: 60  GHVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRM----NARNASSDRWL 115
           GH+DH   A +L ++ S+     H  D  M+    +        M    + R        
Sbjct: 61  GHLDHTWNAQELCDEYSIP-AYIHTADRPMLADPAQGLGRALGPMLGDLSFREPEKVIDF 119

Query: 116 QDGDTLLLGTHIFKVFHCPGHSPGH---------------VIYVNFENNFAHLGDTLFRS 160
            DG+ + +    F V   PGH+ G                             GD LF  
Sbjct: 120 VDGEPVDVAGLRFTVDLAPGHTQGSVLLGLDVDIETPEAGSDGEPTTVPVCFSGDVLFAG 179

Query: 161 SIGRTDILHGDYQQLINSINNKILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           SIGRTD+  G ++QL+ SI  K+LPL D    + GHGP ++IG ER  NPFL
Sbjct: 180 SIGRTDLPGGSHEQLLESIAAKLLPLPDHTQVLPGHGPQTSIGAERATNPFL 231


>gi|167855602|ref|ZP_02478362.1| glyoxalase II family protein [Haemophilus parasuis 29755]
 gi|167853293|gb|EDS24547.1| glyoxalase II family protein [Haemophilus parasuis 29755]
          Length = 209

 Score =  162 bits (410), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 76/209 (36%), Positives = 128/209 (61%), Gaps = 2/209 (0%)

Query: 5   SFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDH 64
           +  I+ V+ F+QNC+ ++D E   AV++D G D D I   ++ +  +V+++ ITHGH+DH
Sbjct: 3   NLQIIPVSVFQQNCSVVWDNE-KNAVIIDAGDDADKIIRFVEEQQLNVQKLLITHGHLDH 61

Query: 65  VGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLG 124
           +    QL++  ++ + G H++D  +  ++    +   +   +     D WL  GD + +G
Sbjct: 62  IMAVDQLRKHFNVDVFGSHQNDQPLFEQLPNICQSYGLPA-SPAFLPDHWLNAGDKIQIG 120

Query: 125 THIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKIL 184
              F + H PGHSPGH+ + +FEN  A  GD LF+ SIGRTD+  G+++QLI +I  ++ 
Sbjct: 121 ALTFHIRHLPGHSPGHIGFFDFENKIAFSGDVLFKDSIGRTDLYQGNFEQLIYTIKTQLF 180

Query: 185 PLGDEISFVCGHGPNSTIGRERRLNPFLK 213
            L D+   + GHG ++T+GRE++ NPFLK
Sbjct: 181 DLEDDFIIIPGHGSHTTVGREKQHNPFLK 209


>gi|167037443|ref|YP_001665021.1| beta-lactamase domain-containing protein [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|320115856|ref|YP_004186015.1| beta-lactamase domain-containing protein [Thermoanaerobacter
           brockii subsp. finnii Ako-1]
 gi|166856277|gb|ABY94685.1| beta-lactamase domain protein [Thermoanaerobacter pseudethanolicus
           ATCC 33223]
 gi|319928947|gb|ADV79632.1| beta-lactamase domain-containing protein [Thermoanaerobacter
           brockii subsp. finnii Ako-1]
          Length = 207

 Score =  162 bits (410), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 72/211 (34%), Positives = 110/211 (52%), Gaps = 4/211 (1%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +      V  +K NC  + DEE+ E +V+DPG  L  I+D I      VK I +THGH D
Sbjct: 1   MKIQRYVVGLYKANCYIVSDEETRETIVIDPGEYLSEIQDYIGVNKLRVKYILLTHGHFD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+GG  +L++     +    +D   ++           +    + +++D  L  GD L  
Sbjct: 61  HIGGVEELRKVTQAEVAISKEDAPMLLD--PSLNLSKMVYKKIQCSAADILLNGGDILYF 118

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G +  +V H PGH+          +N    GDT+F+ SIGR D   GD+  L++SI NK+
Sbjct: 119 GKYAIEVLHTPGHT--KGGVCFKIDNVCFTGDTVFKGSIGRYDFPGGDFDTLMDSIKNKL 176

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           L L D++    GHG +STIG+E+R+N FL+ 
Sbjct: 177 LVLEDDVVIYPGHGESSTIGKEKRINLFLRE 207


>gi|289578228|ref|YP_003476855.1| beta-lactamase [Thermoanaerobacter italicus Ab9]
 gi|289527941|gb|ADD02293.1| beta-lactamase domain protein [Thermoanaerobacter italicus Ab9]
          Length = 207

 Score =  162 bits (410), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 71/211 (33%), Positives = 109/211 (51%), Gaps = 4/211 (1%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +      V  +K NC  + DEE+ E +V+DPG     I+D I      VK I +THGH D
Sbjct: 1   MKIQRYVVGLYKANCYIVSDEETRETIVIDPGEYSSEIQDYIGINKLRVKYILLTHGHFD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+GG  +L++     +    +D   ++           +    + +++D  L  GD L  
Sbjct: 61  HIGGVEELRKVTQAEVAISKEDAPMLLD--PSLNLSKMVYKKIQCSAADILLNGGDILYF 118

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G +  +V H PGH+          +N    GDT+F+ SIGR D   GD+  L++SI NK+
Sbjct: 119 GKYTIEVLHTPGHT--KGGVCFKIDNVCFTGDTVFKGSIGRYDFPGGDFDTLMDSIKNKL 176

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           L L D++    GHG +STIG+E+R+N FL+ 
Sbjct: 177 LVLEDDVVIYPGHGESSTIGKEKRINLFLRE 207


>gi|312898879|ref|ZP_07758267.1| metallo-beta-lactamase domain protein [Megasphaera micronuciformis
           F0359]
 gi|310620041|gb|EFQ03613.1| metallo-beta-lactamase domain protein [Megasphaera micronuciformis
           F0359]
          Length = 211

 Score =  162 bits (409), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 61/212 (28%), Positives = 102/212 (48%), Gaps = 4/212 (1%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + +  + + P + NC  ++D+   EA ++DP  D + I   +      ++ +++THGH D
Sbjct: 3   IQYKTLPLGPLETNCYIVYDDVEKEAFLIDPAWDYEQIDKALDVLGVTLRFVFLTHGHAD 62

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G   +++    + +    K D  ++        +  +       S +  + DG+ +  
Sbjct: 63  HIGALQEVRNHKDVPVY-IGKGDVDLIANSRNNLSMF-LGKEIVITSPEHIVTDGEVINF 120

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
               FKV   PGH+P       +       GDTLFR S+GRTD   GD   L++SI  K+
Sbjct: 121 AGVPFKVIETPGHTP--GGLCLYGAGLLFAGDTLFRCSVGRTDFYGGDSHVLVSSIEEKL 178

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSN 215
           + L D+   + GHGP + IG ERR NPFL   
Sbjct: 179 MKLPDDTVVLPGHGPATDIGYERRNNPFLGGG 210


>gi|296139657|ref|YP_003646900.1| beta-lactamase [Tsukamurella paurometabola DSM 20162]
 gi|296027791|gb|ADG78561.1| beta-lactamase domain protein [Tsukamurella paurometabola DSM
           20162]
          Length = 245

 Score =  162 bits (409), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 67/230 (29%), Positives = 103/230 (44%), Gaps = 20/230 (8%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDL-DIIKDVIQSRNFHVKQIWITHGHV 62
           +         F+ NC  L +    +AV+VDPG D  + +K ++     +   + +THGH+
Sbjct: 1   MLITGFPAGVFQTNCYVLAEGPGADAVIVDPGQDAVESVKALLAEHRLNPVAVLLTHGHL 60

Query: 63  DHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVD----EQARLLSIRMNARNASSDRWLQDG 118
           DH   A  L ++  + +   H  D  M+             +              L DG
Sbjct: 61  DHTWTAQPLADEFGIPVY-IHAADRPMLADPAVGIGPALGSMIGGQIFTEPEKVIELDDG 119

Query: 119 DTLLLGTHIFKVFHCPGHSPGHVIYVNFENNFA--------------HLGDTLFRSSIGR 164
           + + L    F V   PGH+ G +++                        GD LF+ SIGR
Sbjct: 120 EAVTLAGITFGVDLAPGHTRGSIVFTTEVPQIDEAGEPVGAEPVIVAFSGDVLFQGSIGR 179

Query: 165 TDILHGDYQQLINSINNKILPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           TD+  G ++QL++SI  K+LPL DE   + GHGP +TIG+ER  NPFL+ 
Sbjct: 180 TDLPGGSHEQLLDSIAAKLLPLPDETVVLPGHGPATTIGQERASNPFLQG 229


>gi|51893566|ref|YP_076257.1| putative Zn-dependent hydrolase [Symbiobacterium thermophilum IAM
           14863]
 gi|51857255|dbj|BAD41413.1| putative Zn-dependent hydrolase [Symbiobacterium thermophilum IAM
           14863]
          Length = 206

 Score =  162 bits (409), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 74/209 (35%), Positives = 107/209 (51%), Gaps = 4/209 (1%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +      +  F  NC  +   E+ +A+V+DPG     I+  +   +  V  I +THGH+D
Sbjct: 1   MQLWHRALGAFMANCYIVACGETRQALVIDPGVPDPWIQSCVMENDLTVVGIVLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+GG   +K      +   H+ DA  +        L    M  + + +DR L+DGD +  
Sbjct: 61  HIGGVDWVKGWSGAPV-AIHEADADCLTSPARNGSLY-FGMTVQASPADRLLRDGDEVEA 118

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   F+V H PGHSPG +      +     GDTLF  SIGRTD+  GDY  LI SI  ++
Sbjct: 119 GGLRFRVIHTPGHSPGGICLYRPGHLL--AGDTLFAGSIGRTDLPGGDYHTLIQSIKERL 176

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           L L  + +   GHGP++TIG E+  NPFL
Sbjct: 177 LTLPPDTAVYPGHGPSTTIGDEKAYNPFL 205


>gi|322515094|ref|ZP_08068101.1| metallo-beta-lactamase [Actinobacillus ureae ATCC 25976]
 gi|322118900|gb|EFX91082.1| metallo-beta-lactamase [Actinobacillus ureae ATCC 25976]
          Length = 209

 Score =  162 bits (409), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 74/209 (35%), Positives = 124/209 (59%), Gaps = 2/209 (0%)

Query: 5   SFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDH 64
           +  I+ V+ F+QNC+ ++D ++  A ++D G   D I   ++ +N  V+++ +THGH+DH
Sbjct: 3   NLQIIPVSAFQQNCSIIWD-DNKNAAIIDAGDSADKIIQFVELQNLKVRKLLLTHGHLDH 61

Query: 65  VGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLG 124
           +    ++++   + + G H DD  +  ++ +   +  +    +    D WL +GD + +G
Sbjct: 62  IMAVEKVRDHFGVEVYGSHIDDKPLFEQLPQMCEMFGLPP-VKAFLPDHWLNEGDVVEVG 120

Query: 125 THIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKIL 184
              F V H PGH+PGH+ + +FEN  A  GD LF+ SIGRTD+  G    L+++I  K+ 
Sbjct: 121 ALRFSVRHLPGHAPGHIGFFDFENKIAFSGDVLFKDSIGRTDLYLGSLDVLLDTIRTKMF 180

Query: 185 PLGDEISFVCGHGPNSTIGRERRLNPFLK 213
            L D+   V GHGP++TIGRE+  NPFLK
Sbjct: 181 DLYDDFIVVAGHGPHTTIGREKLHNPFLK 209


>gi|237710520|ref|ZP_04541001.1| conserved hypothetical protein [Bacteroides sp. 9_1_42FAA]
 gi|237727017|ref|ZP_04557498.1| conserved hypothetical protein [Bacteroides sp. D4]
 gi|265750296|ref|ZP_06086359.1| conserved hypothetical protein [Bacteroides sp. 3_1_33FAA]
 gi|229433873|gb|EEO43950.1| conserved hypothetical protein [Bacteroides dorei 5_1_36/D4]
 gi|229455242|gb|EEO60963.1| conserved hypothetical protein [Bacteroides sp. 9_1_42FAA]
 gi|263237192|gb|EEZ22642.1| conserved hypothetical protein [Bacteroides sp. 3_1_33FAA]
          Length = 212

 Score =  162 bits (409), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 63/214 (29%), Positives = 105/214 (49%), Gaps = 6/214 (2%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGG----DLDIIKDVIQSRNFHVKQIWITH 59
           +     +   F  NC  L DE + EAV++D G     +   +K  I S N  VK +  TH
Sbjct: 1   MKIKKFEFNMFPVNCYVLSDE-TKEAVIIDAGCFYEEEKQALKRYIDSNNLTVKHLLNTH 59

Query: 60  GHVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGD 119
            H+DH+ G   L ++  L     ++ D   + +   Q+R+   ++        +++ DGD
Sbjct: 60  LHLDHIFGNPFLLQEYGLKAEA-NQADEFWLEQAPAQSRMFGFQLPEAPVPLGKYIFDGD 118

Query: 120 TLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSI 179
            +  G    +  H PGHSPG ++Y   E++    GD LF+ SIGR D+  G++ +L   I
Sbjct: 119 IITFGNTQLEAIHVPGHSPGSIVYYCKEDHCIFSGDVLFQGSIGRADLTGGNFDELREHI 178

Query: 180 NNKILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
            +++  L  +     GHG  +T+G E+  NPF +
Sbjct: 179 CSRLFVLPPDTVVYPGHGDPTTVGAEKANNPFFR 212


>gi|209543246|ref|YP_002275475.1| beta-lactamase domain-containing protein [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209530923|gb|ACI50860.1| beta-lactamase domain protein [Gluconacetobacter diazotrophicus PAl
           5]
          Length = 226

 Score =  162 bits (409), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 96/215 (44%), Positives = 134/215 (62%), Gaps = 7/215 (3%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L   +V VT F QNC+ L+D  S  AVVVDPGGD+  +   + SR+  V  I +THGH+D
Sbjct: 12  LELVVVPVTAFGQNCSILWDPGSRHAVVVDPGGDVPRLLHELASRDLTVDAILLTHGHLD 71

Query: 64  HVGGAAQLKEDLS------LTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQD 117
           H GGA  L+ +LS      + +IGP   DA ++  +  QA    +    R+ + DR++ D
Sbjct: 72  HAGGADALRAELSGRQGAAVPVIGPDARDAFLLSDIAAQAARYGLEGM-RDVTVDRFVTD 130

Query: 118 GDTLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLIN 177
            + L L    F+V H PGH+PGHV++ +    FA +GDTLFR S+GRTD  +GD  QLI 
Sbjct: 131 NEILPLLGRSFEVRHVPGHTPGHVVFYDPRARFACVGDTLFRGSVGRTDFPYGDGPQLIK 190

Query: 178 SINNKILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           +I +++LPLGD++S + GHG  +TIG ER  NPFL
Sbjct: 191 AITDRLLPLGDDVSILPGHGGLTTIGAERHGNPFL 225


>gi|162146767|ref|YP_001601228.1| beta-lactamase-like protein [Gluconacetobacter diazotrophicus PAl
           5]
 gi|161785344|emb|CAP54891.1| Beta-lactamase-like protein [Gluconacetobacter diazotrophicus PAl
           5]
          Length = 231

 Score =  162 bits (409), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 96/215 (44%), Positives = 134/215 (62%), Gaps = 7/215 (3%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L   +V VT F QNC+ L+D  S  AVVVDPGGD+  +   + SR+  V  I +THGH+D
Sbjct: 17  LELVVVPVTAFGQNCSILWDPGSRHAVVVDPGGDVPRLLHELASRDLTVDAILLTHGHLD 76

Query: 64  HVGGAAQLKEDLS------LTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQD 117
           H GGA  L+ +LS      + +IGP   DA ++  +  QA    +    R+ + DR++ D
Sbjct: 77  HAGGADALRAELSGRQGAAVPVIGPDARDAFLLSDIAAQAARYGLEGM-RDVTVDRFVTD 135

Query: 118 GDTLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLIN 177
            + L L    F+V H PGH+PGHV++ +    FA +GDTLFR S+GRTD  +GD  QLI 
Sbjct: 136 NEILPLLGRSFEVRHVPGHTPGHVVFYDPRARFACVGDTLFRGSVGRTDFPYGDGPQLIK 195

Query: 178 SINNKILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           +I +++LPLGD++S + GHG  +TIG ER  NPFL
Sbjct: 196 AITDRLLPLGDDVSILPGHGGLTTIGAERHGNPFL 230


>gi|302391505|ref|YP_003827325.1| beta-lactamase [Acetohalobium arabaticum DSM 5501]
 gi|302203582|gb|ADL12260.1| beta-lactamase [Acetohalobium arabaticum DSM 5501]
          Length = 206

 Score =  162 bits (409), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 72/209 (34%), Positives = 105/209 (50%), Gaps = 3/209 (1%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +    + V     NC  L DEES +A+V+DPG +   I D++   +  +K I  THGH D
Sbjct: 1   MIVKKIPVGSLGANCYMLGDEESGKAIVIDPGAEGAKILDLVNELSLELKYIVNTHGHYD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G    L +     +   H+DD+  +    +    LSI        +DR L +GD +  
Sbjct: 61  HIGANQFLLQKSQSKL-LIHQDDSEFLVDPKKNLSSLSISGKIEGPKADRLLTEGDEISC 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V H PGH+PG +      N    +GDT+F   +GRTD  +G  + L+ SI  K+
Sbjct: 120 GKWELEVIHTPGHTPGGITL--LGNGKLFVGDTIFARGVGRTDFPYGSKEVLMESIQEKL 177

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           LPL DE+    GHGP   +G  +  NPFL
Sbjct: 178 LPLADELEVFPGHGPKGKLGEIKASNPFL 206


>gi|325662330|ref|ZP_08150939.1| hypothetical protein HMPREF0490_01678 [Lachnospiraceae bacterium
           4_1_37FAA]
 gi|331086133|ref|ZP_08335215.1| hypothetical protein HMPREF0987_01518 [Lachnospiraceae bacterium
           9_1_43BFAA]
 gi|325471332|gb|EGC74555.1| hypothetical protein HMPREF0490_01678 [Lachnospiraceae bacterium
           4_1_37FAA]
 gi|330406292|gb|EGG85806.1| hypothetical protein HMPREF0987_01518 [Lachnospiraceae bacterium
           9_1_43BFAA]
          Length = 207

 Score =  162 bits (409), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 58/209 (27%), Positives = 91/209 (43%), Gaps = 3/209 (1%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +            NC   ++E++ EAV+VDP      + + ++      + + +THGH D
Sbjct: 1   MKVERFLTGILSTNCYVAWNEQTKEAVIVDPAAYSKKLAEFLREEGLKPQAVLLTHGHFD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+ G   L E+  + +   H+ +  ++        L              ++ DG  +  
Sbjct: 61  HIMGLDALLEEYPVPVY-VHEAEKGLIADPKTNLSLTYTNGYV--FEDATYVTDGQKIAA 117

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
               F+V   PGH+ G   Y     N    GDTLFR S+GR+D+  GD   LI SI  K+
Sbjct: 118 AGVTFEVLFTPGHTSGGCCYYAETENMLFSGDTLFRCSVGRSDLPTGDETTLIRSIKEKL 177

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           L L +      GH   +TI  E+  NPFL
Sbjct: 178 LVLPENTVVYPGHMAATTIQTEKTANPFL 206


>gi|149182914|ref|ZP_01861372.1| hypothetical protein BSG1_07494 [Bacillus sp. SG-1]
 gi|148849363|gb|EDL63555.1| hypothetical protein BSG1_07494 [Bacillus sp. SG-1]
          Length = 211

 Score =  161 bits (408), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 63/211 (29%), Positives = 108/211 (51%), Gaps = 1/211 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + +  + + P + NC  +++E+  E V+ DPG +   +   +++       I +TH H D
Sbjct: 1   MKWKRLPLGPLQTNCYCVWNEK-KECVIFDPGEEAGKLIKWLRTNQLKPLAILLTHAHFD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G   +++E   + +    K+   +M      ++  ++    R   +D  L +  TL +
Sbjct: 60  HIGAVDKVREAFEIPLYVHEKEAKWLMDPSLNGSQFFAMSELVRMKPADYILTNEKTLSV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   F ++  PGHSPG + Y   E      GDTLF  SIGRTD+  G + +L+ SI++ +
Sbjct: 120 GDFTFDLYETPGHSPGSISYYYPEEQVVFSGDTLFMGSIGRTDLPGGHHDELLKSIHDHL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           L L ++   + GHGP +TIG E   NPFL  
Sbjct: 180 LNLPEDTIVLSGHGPETTIGNEMDSNPFLNG 210


>gi|254518563|ref|ZP_05130619.1| metallo-beta-lactamase [Clostridium sp. 7_2_43FAA]
 gi|226912312|gb|EEH97513.1| metallo-beta-lactamase [Clostridium sp. 7_2_43FAA]
          Length = 200

 Score =  161 bits (408), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 63/209 (30%), Positives = 100/209 (47%), Gaps = 10/209 (4%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +      +   + NC  + DE + +A V+DPG +   +   I++    ++ I +TH H D
Sbjct: 1   MIVKTYPLGSLQTNCYLVIDENTNKAAVIDPGAEASYLIKEIEALGIKIEVILLTHCHFD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H G   +LK+   + +     D+  M         + S  +  +  +  +++ +GD + +
Sbjct: 61  HNGAVEELKDKYKVDVYLNKADEEYM--------EMDSTGIFGKLPNIYKYINEGDEIKV 112

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   FK    PGH+           +    GDTLF  SIGRTD L G Y +LI SI  K+
Sbjct: 113 GKLTFKAIFTPGHT--KGGTCYLVEDKVFTGDTLFNGSIGRTDFLGGSYNELIESIETKL 170

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           + L +++    GHGP STI  ER  NPFL
Sbjct: 171 MVLDNDVEVYPGHGPKSTIIFERMRNPFL 199


>gi|168208636|ref|ZP_02634261.1| metallo-beta-lactamase family protein [Clostridium perfringens B
           str. ATCC 3626]
 gi|170713182|gb|EDT25364.1| metallo-beta-lactamase family protein [Clostridium perfringens B
           str. ATCC 3626]
          Length = 206

 Score =  161 bits (408), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 74/213 (34%), Positives = 115/213 (53%), Gaps = 12/213 (5%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +    + V  ++ NC  + DEE+ + ++VDPG +   I+ VI+S +   + + +THGH D
Sbjct: 1   MLIKTIPVGMYQANCYVVIDEETKDCIIVDPGEEASRIESVIESLDAKPRMVLLTHGHFD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG   +L E   +            + K DE     ++ +  +   +D +L+DGDTL  
Sbjct: 61  HVGAVQKLAEKYKIP---------FYIDKKDEDMIERNVDVFGKLPKADGYLKDGDTLKF 111

Query: 124 -GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
              +  K    PGH+P         +N    GDTLFR SIGR+D   G++  L+ SIN+K
Sbjct: 112 SDNYEIKCLETPGHTP--GGLCFLIDNCLFTGDTLFRESIGRSDFEGGNHATLLKSINDK 169

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFLKSN 215
           ++PLGD+I+   GHG +STI  ER+ NPFL  +
Sbjct: 170 LVPLGDDIAVYPGHGLSSTIKHERQRNPFLAGD 202


>gi|302038659|ref|YP_003798981.1| putative beta-lactamase-like hydrolase [Candidatus Nitrospira
           defluvii]
 gi|300606723|emb|CBK43056.1| putative Hydrolase, beta-lactamase-like [Candidatus Nitrospira
           defluvii]
          Length = 209

 Score =  161 bits (408), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 66/210 (31%), Positives = 102/210 (48%), Gaps = 2/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +      V P   NC+ + D  + +A+VVDPGG  + I   +++    V  I  TH H D
Sbjct: 1   MIRKTFSVPPLGCNCSIIGDPITKQAIVVDPGGAPERILQEVRAMGLTVVSIVHTHAHFD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H   +  +K+     +   H DD  +   ++ Q R+  +         D WL+D + L +
Sbjct: 61  HFLASGAMKQATGAALC-LHPDDFPLWDILEMQCRMFGVPYVPAPP-PDYWLKDEERLAI 118

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G       H PGH+PG + +          GDTLFR  IGRTD+  GD+  +  SI  ++
Sbjct: 119 GELEGIALHTPGHTPGSMCFHFPAAKVVLAGDTLFRGGIGRTDLWGGDFDAIEQSIRERL 178

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
             L ++ + V GHGP + IGRER  N F++
Sbjct: 179 YTLDEQTAVVTGHGPETEIGRERETNSFVR 208


>gi|212695074|ref|ZP_03303202.1| hypothetical protein BACDOR_04612 [Bacteroides dorei DSM 17855]
 gi|212662390|gb|EEB22964.1| hypothetical protein BACDOR_04612 [Bacteroides dorei DSM 17855]
          Length = 212

 Score =  161 bits (408), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 62/214 (28%), Positives = 104/214 (48%), Gaps = 6/214 (2%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGG----DLDIIKDVIQSRNFHVKQIWITH 59
           +     +   F  NC  L DE + EA ++D G     +   +K  I S N  VK +  TH
Sbjct: 1   MKIKKFEFNMFPVNCYVLSDE-TKEAAIIDAGCFYEEEKQALKRYIDSNNLTVKHLLNTH 59

Query: 60  GHVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGD 119
            H+DH+ G   L ++  L     ++ D   + +   Q+R+   ++        +++ DGD
Sbjct: 60  LHLDHIFGNPFLLQEYGLKAEA-NQADEFWLEQAPAQSRMFGFQLPEAPVPLGKYIFDGD 118

Query: 120 TLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSI 179
            +  G    +  H PGHSPG ++Y   E++    GD LF+ SIGR D+  G++ +L   I
Sbjct: 119 IITFGNTQLEAIHVPGHSPGSIVYYCKEDHCIFSGDVLFQGSIGRADLTGGNFDELREHI 178

Query: 180 NNKILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
            +++  L  +     GHG  +T+G E+  NPF +
Sbjct: 179 CSRLFVLPPDTVVYPGHGDPTTVGAEKANNPFFR 212


>gi|294788692|ref|ZP_06753934.1| metallo-beta-lactamase domain protein [Simonsiella muelleri ATCC
           29453]
 gi|294483569|gb|EFG31254.1| metallo-beta-lactamase domain protein [Simonsiella muelleri ATCC
           29453]
          Length = 216

 Score =  161 bits (408), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 82/213 (38%), Positives = 127/213 (59%), Gaps = 2/213 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L+  I+ VTP++QNCT L+D+E+ EAV+ D GG+   I  +IQ ++ ++K+IW+THGH+D
Sbjct: 3   LNIKIIPVTPYEQNCTLLWDDETNEAVLTDLGGNAAEIWHIIQKKHLNLKEIWLTHGHLD 62

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLL--SIRMNARNASSDRWLQDGDTL 121
           HVGG   ++E     +IGPH DD  ++  +  + R         + N    RWL +G+ L
Sbjct: 63  HVGGVVAMRELTDTPVIGPHCDDLFLLEDLSNKTREYAKYGFEFSTNFLPTRWLNEGEVL 122

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
            +G + F V H PGH+PGHV++          GD LF+ SIGRTD   G+ Q L + I  
Sbjct: 123 SVGQYEFSVLHIPGHTPGHVVFYCEREKLLIAGDVLFKESIGRTDFPRGNTQDLHHGIRT 182

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           K+  L + +  + GH   +TIG E+  NP++++
Sbjct: 183 KLYRLPENVVVIPGHRETTTIGHEKIYNPYVRA 215


>gi|15895540|ref|NP_348889.1| metallo-beta-lactamase superfamily Zn-dependent hydrolase
           [Clostridium acetobutylicum ATCC 824]
 gi|15025276|gb|AAK80229.1|AE007728_8 Predicted Zn-dependent hydrolase of metallo-beta-lactamase
           superfamily [Clostridium acetobutylicum ATCC 824]
 gi|325509688|gb|ADZ21324.1| Zn-dependent hydrolase of metallo-beta-lactamase superfamily
           [Clostridium acetobutylicum EA 2018]
          Length = 199

 Score =  161 bits (408), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 70/209 (33%), Positives = 111/209 (53%), Gaps = 10/209 (4%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +   ++Q   +  NC  L DE+S E+VV+DPG     I +  +    ++K + +THGH D
Sbjct: 1   MKISVIQAGAYMTNCYILVDEKSNESVVIDPGDAPQAILEAFKDTETNLKFVLLTHGHAD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H    A+LK++ ++ +   +KDD  ++   +            ++ ++ +++ DGD L  
Sbjct: 61  HTAAVAELKKEYNVDVYM-NKDDCKLIENGE-------YMFGDKSENATKYVDDGDELQF 112

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    K    PGH+P         +N+   GDTLF SSIGRTD   GD+  LINSI +K+
Sbjct: 113 GELKIKCIKTPGHTP--GGMCYLVDNYLFSGDTLFNSSIGRTDFPGGDFSTLINSIKSKL 170

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           + L + I    GHG  +TIG E+  NPF+
Sbjct: 171 MKLDENIVVYPGHGEGTTIGYEKIHNPFI 199


>gi|291279802|ref|YP_003496637.1| metallo-beta-lactamase family protein [Deferribacter desulfuricans
           SSM1]
 gi|290754504|dbj|BAI80881.1| metallo-beta-lactamase family protein [Deferribacter desulfuricans
           SSM1]
          Length = 208

 Score =  161 bits (408), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 75/210 (35%), Positives = 113/210 (53%), Gaps = 4/210 (1%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +   +V V     NC  +   ++ +A+++DPG D + IK  I S       I  THGH D
Sbjct: 1   MKIDVVIVGDLYVNCYII--SKNKDAIIIDPGSDFEKIKSFIDSNGLKPLAIVNTHGHFD 58

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG    LK + ++ +   H+ D  ++    E A +  I    ++++ D +L+D   L  
Sbjct: 59  HVGAIEDLKSEYNIPLYM-HEGDEFLLKNAVEHASMFGIFG-IKSSNIDNYLEDNQLLDF 116

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    KV H PGHSPG V     E      GDTLF+ S+GRTD  + D+  L NSI NK+
Sbjct: 117 GDIKLKVLHTPGHSPGGVSLYLGEAKVVFTGDTLFKDSVGRTDFPYADFNTLANSIKNKL 176

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
             L D+++   GHGP+STIG E+++N F++
Sbjct: 177 YVLDDDVTVYPGHGPSSTIGYEKKMNAFVR 206


>gi|260887824|ref|ZP_05899087.1| metallo-beta-lactamase family protein [Selenomonas sputigena ATCC
           35185]
 gi|330838609|ref|YP_004413189.1| beta-lactamase domain protein [Selenomonas sputigena ATCC 35185]
 gi|260862430|gb|EEX76930.1| metallo-beta-lactamase family protein [Selenomonas sputigena ATCC
           35185]
 gi|329746373|gb|AEB99729.1| beta-lactamase domain protein [Selenomonas sputigena ATCC 35185]
          Length = 213

 Score =  161 bits (408), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 71/214 (33%), Positives = 104/214 (48%), Gaps = 5/214 (2%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           MS L+   + V     NC  L +E S EA+ +DPGG  + +   IQ    ++K I  TH 
Sbjct: 1   MS-LNMKALVVGALGVNCYILHEEGSKEAIAIDPGGSEETVWQHIQEDGLNLKAILNTHA 59

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H DH+G    L+E     +     D   ++      +  +   +  R   +D  L+ G+ 
Sbjct: 60  HADHIGAIDFLREKTGAKLYIHEADAPMLLDAQKNLSAFMGTPIMTRP--ADILLKGGEV 117

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           L +G   F V H PGHSP          +    GDTLF  S+GRTD      + L+ SI 
Sbjct: 118 LEIGGMKFTVLHTPGHSP--GGVCYLMEDRVFSGDTLFAESVGRTDFPGSSSRDLLTSIK 175

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
            K++ L DE++  CGHGP +TIG ER+ NP++  
Sbjct: 176 EKLMTLPDELAVYCGHGPATTIGHERKCNPYING 209


>gi|329119138|ref|ZP_08247829.1| metallo-beta-lactamase domain protein [Neisseria bacilliformis ATCC
           BAA-1200]
 gi|327464769|gb|EGF11063.1| metallo-beta-lactamase domain protein [Neisseria bacilliformis ATCC
           BAA-1200]
          Length = 227

 Score =  161 bits (408), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 82/213 (38%), Positives = 125/213 (58%), Gaps = 3/213 (1%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           MS L   I+ VT F+QNCT ++D+E+ EAV  D GG +  + +  + R   VK +W+THG
Sbjct: 17  MS-LHVEIIPVTLFRQNCTLMWDDETNEAVFTDVGGKVPQLMEEAEKRGLTVKAVWLTHG 75

Query: 61  HVDHVGGAAQLKE-DLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGD 119
           H+DHV G ++L      L ++GPH+ D  ++  + E  +       A+     RWL++GD
Sbjct: 76  HLDHVSGVSELTALRPDLEVLGPHEADRFLLANLAEITKQYDFPP-AKPFIPTRWLEEGD 134

Query: 120 TLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSI 179
           TL +G + F+V H PGH+PGH+++   E      GD +F  SIGRTD    ++  LI +I
Sbjct: 135 TLSVGKYRFQVLHVPGHTPGHIVFYCAEAGLLIAGDVIFYESIGRTDFERSNHDDLIKNI 194

Query: 180 NNKILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
             KI  L D+   + GHG  +T+G E++ NP+L
Sbjct: 195 REKIFTLPDDTEIITGHGRTTTVGYEKQHNPYL 227


>gi|319902423|ref|YP_004162151.1| metallo-beta-lactamase [Bacteroides helcogenes P 36-108]
 gi|319417454|gb|ADV44565.1| putative metallo-beta-lactamase [Bacteroides helcogenes P 36-108]
          Length = 212

 Score =  161 bits (408), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 64/214 (29%), Positives = 110/214 (51%), Gaps = 6/214 (2%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGG----DLDIIKDVIQSRNFHVKQIWITH 59
           +     +   F +NC  L+DE + EAVV+DPG     +   +K+ I +   ++K +  TH
Sbjct: 1   MKIKRFEFNMFPENCYVLWDE-TNEAVVIDPGCFYEEEKQALKNFITNNGLNIKHLLNTH 59

Query: 60  GHVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGD 119
            H+DH+ G   + ++  L     ++ D   + +  +Q+R+   ++         +L DGD
Sbjct: 60  LHLDHIFGNPFMLKEFGLKAEA-NQADEFWIDEAPKQSRMFGFQLQEPPVPLGNYLHDGD 118

Query: 120 TLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSI 179
            +  G    +  H PGHSPG ++Y    ++    GD LF+ SIGR D+  G++ +LI  I
Sbjct: 119 IITFGNTKLEAIHVPGHSPGSLVYYCAADHCMFSGDVLFQGSIGRADLAGGNFDELIEHI 178

Query: 180 NNKILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
            +++  L +E     GHG  +TIG E+  NPF +
Sbjct: 179 CSRLFVLPNETVVYPGHGAPTTIGIEKAENPFFR 212


>gi|319947809|ref|ZP_08022003.1| hydrolase [Dietzia cinnamea P4]
 gi|319438533|gb|EFV93459.1| hydrolase [Dietzia cinnamea P4]
          Length = 221

 Score =  161 bits (407), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 72/222 (32%), Positives = 106/222 (47%), Gaps = 13/222 (5%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLD-IIKDVIQSRNFHVKQIWITHGHV 62
           +         F+ NC  + D+   + V+VDPG D +  ++  I       + + +THGH+
Sbjct: 1   MQIVGFPAGMFQTNCYIVSDDA-GDCVIVDPGQDAEEQVRRQISEAGLRPRAVLLTHGHL 59

Query: 63  DHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDE----QARLLSIRMNARNASSDRWLQDG 118
           DH+  A Q+ +   +     H DD  M+    +        +   M     +    + DG
Sbjct: 60  DHIWNARQVADHYRVP-AYIHPDDRPMLSDPGKGLSLDLSAMLKDMTFTEPAEVVEVFDG 118

Query: 119 DTLLLGTHIFKVFHCPGHSPGHVIYVNF------ENNFAHLGDTLFRSSIGRTDILHGDY 172
           DTL  G+  F V H PGHSPG V +                GD LF+  +GRTD+  GD 
Sbjct: 119 DTLRFGSMTFDVDHAPGHSPGSVSFRITVQTEEGPRMVVLGGDVLFQDGVGRTDLPAGDT 178

Query: 173 QQLINSINNKILPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           + L+ SI  K L L D+   + GHGP++TIGRERR NPFL+ 
Sbjct: 179 EVLMQSIAKKFLVLDDDAVVLPGHGPSTTIGRERRSNPFLRD 220


>gi|313497138|gb|ADR58504.1| Beta-lactamase domain protein [Pseudomonas putida BIRD-1]
          Length = 214

 Score =  161 bits (407), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 74/208 (35%), Positives = 109/208 (52%), Gaps = 4/208 (1%)

Query: 7   HIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVG 66
               V P + NCT + D  + +A+VVDPGGD+D I   +Q     +  I  TH H DH  
Sbjct: 11  ETFPVGPLQCNCTLIGDPLTKKAIVVDPGGDVDKILARLQVHGLTLVSIIHTHAHFDHFL 70

Query: 67  GAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTH 126
            + +LKE    T+   HKDD  +   ++ Q ++  +      A  DRWL D + L  G  
Sbjct: 71  ASGKLKELTGATLH-LHKDDQVLWDNLEMQCQMFGVPYTPVPA-PDRWLGDDEELACGC- 127

Query: 127 IFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPL 186
                H PGH+PG + +   +      GDTLFR  IGRTD+  GD + ++ SI  ++  L
Sbjct: 128 -GVALHTPGHTPGSMSFWFADAKLLIAGDTLFRRGIGRTDLWGGDQRAIVRSIKERLYRL 186

Query: 187 GDEISFVCGHGPNSTIGRERRLNPFLKS 214
            +E   V GHGP++ +G E R NPF+++
Sbjct: 187 DEEAIVVTGHGPDTRLGDEMRENPFVRA 214


>gi|331090639|ref|ZP_08339490.1| hypothetical protein HMPREF9477_00133 [Lachnospiraceae bacterium
           2_1_46FAA]
 gi|330401079|gb|EGG80674.1| hypothetical protein HMPREF9477_00133 [Lachnospiraceae bacterium
           2_1_46FAA]
          Length = 207

 Score =  161 bits (407), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 65/210 (30%), Positives = 103/210 (49%), Gaps = 3/210 (1%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +    +       NC  + +E + EA+++DPG     +KD +     +VK I +THGH D
Sbjct: 1   MRIKTIVTGIISTNCYVVHNETTKEAILIDPGACSKNLKDYLLEEKLNVKGILLTHGHFD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+ G   L +   + +    ++   +   V  Q++  +       A   ++++DG  L L
Sbjct: 61  HILGLDGLLQMFDVPVYVHEEEKELIEDAVLNQSKTYTEGYVFTKA---QYVKDGQMLNL 117

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
             + F+V H PGH+ G   Y   E      GDTLF +S+GRTD   G    LI SI  K+
Sbjct: 118 IGYDFQVIHTPGHTKGSACYYVKEEEVLFSGDTLFYASVGRTDFPTGSTSALIRSIKEKL 177

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           + L DE     GH   ++IG ER+ NPF++
Sbjct: 178 MCLPDETIVYPGHMGATSIGYERQQNPFIQ 207


>gi|226313456|ref|YP_002773350.1| hypothetical protein BBR47_38690 [Brevibacillus brevis NBRC 100599]
 gi|226096404|dbj|BAH44846.1| conserved hypothetical protein [Brevibacillus brevis NBRC 100599]
          Length = 214

 Score =  161 bits (407), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 67/213 (31%), Positives = 109/213 (51%), Gaps = 5/213 (2%)

Query: 1   MS-KLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITH 59
           M+  L+     +  F+ N   + +  + + +V+DPG + D +   + ++N  V  I +TH
Sbjct: 1   MNQNLAIESYALGAFQTNAYVVTNTATNQTIVIDPGMEPDQLLRALANKN--VVAILLTH 58

Query: 60  GHVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGD 119
            H+DH+GG  Q++E     +     +   +       +R  ++        ++  L+DG 
Sbjct: 59  AHLDHIGGLNQVRELTKAPVYIHPLEQEWLTNPDLNGSRRWNLPELIICERAEHELEDGQ 118

Query: 120 TLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSI 179
           TL L     +V H PGHSPG   +V  ++ F   GD LF  SIGRTD+  GD++ L+ SI
Sbjct: 119 TLELAGFHIQVLHTPGHSPGSCSFVIGQHCF--GGDVLFNQSIGRTDLFGGDFETLMISI 176

Query: 180 NNKILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
            +K+  L DE     GHGP +TI  E+  NPF+
Sbjct: 177 QDKLFELDDETIVYPGHGPKTTIDYEKTYNPFV 209


>gi|311030841|ref|ZP_07708931.1| Zn-dependent hydrolase [Bacillus sp. m3-13]
          Length = 210

 Score =  161 bits (407), Expect = 7e-38,   Method: Composition-based stats.
 Identities = 59/211 (27%), Positives = 101/211 (47%), Gaps = 2/211 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + +  + + P + N   L +E   E ++ DPG + +     ++        I +TH H D
Sbjct: 1   MKWKQLPLGPLQTNAYLLINER-KECLIFDPGSEGEAFNSYLEENALKPLAILLTHAHFD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G    +++   + +   HK + + +G                   +D  +   + L++
Sbjct: 60  HIGAVDAVRKHWDVPVY-VHKKEKSWLGDPSLNGSQFFQLGPITANPADHLIISEEKLVI 118

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
                ++   PGHSPG V + +  +     GD LF  SIGRTD+  G+++QLI SI+NK+
Sbjct: 119 SNFELEILFTPGHSPGSVSFYHEPSKVVFAGDALFAGSIGRTDLPGGNHEQLIQSIHNKL 178

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           L L +E + + GHG  +TI RE   NPFL  
Sbjct: 179 LILPEETTVLSGHGMTTTIEREMDSNPFLNG 209


>gi|110634487|ref|YP_674695.1| beta-lactamase-like [Mesorhizobium sp. BNC1]
 gi|110285471|gb|ABG63530.1| beta-lactamase-like protein [Chelativorans sp. BNC1]
          Length = 215

 Score =  161 bits (407), Expect = 7e-38,   Method: Composition-based stats.
 Identities = 109/212 (51%), Positives = 144/212 (67%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           MS L   IV VTPF+QNCT LFDEE    +VVDPGG++D I+  I+     ++ IW+THG
Sbjct: 1   MSTLRAGIVPVTPFQQNCTILFDEEEKRGIVVDPGGEVDRIRAAIEQNGLTIEAIWLTHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DH GGA  LK+ L + I+GPH+ +  ++  +  Q R+  +    R+ + DR+L +GD 
Sbjct: 61  HIDHAGGAMDLKDALGVEILGPHEAERDLLLNLAAQGRMFGLAEPVRDVTPDRFLNEGDV 120

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           +    H FKVFHCPGHSPGHV++ N    FAH+GD LF+ SIGRTD+  GD+  LI SI 
Sbjct: 121 VSFAGHSFKVFHCPGHSPGHVVFYNDAAKFAHVGDVLFQGSIGRTDLPGGDHAALIRSIK 180

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           +K+LPLGD+I F+CGHGP    G ERR NPFL
Sbjct: 181 DKLLPLGDDIGFLCGHGPGGRFGGERRTNPFL 212


>gi|226946150|ref|YP_002801223.1| metallo beta-lactamase-like protein [Azotobacter vinelandii DJ]
 gi|226721077|gb|ACO80248.1| metallo beta-lactamase-like protein [Azotobacter vinelandii DJ]
          Length = 213

 Score =  161 bits (407), Expect = 7e-38,   Method: Composition-based stats.
 Identities = 74/208 (35%), Positives = 107/208 (51%), Gaps = 4/208 (1%)

Query: 7   HIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVG 66
               V P + NCT + D  S +A+VVDPGG+ ++I   +Q     V  I  TH H DH  
Sbjct: 10  ETFPVGPLRCNCTIVGDPVSKKAMVVDPGGNPELILARLQRHGLKVVSIVHTHAHFDHFL 69

Query: 67  GAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTH 126
            A QLKE    T+   H+DD  +   ++ Q R+  +   A   + D WL D + L  G  
Sbjct: 70  AAGQLKELTGATLH-LHQDDRFLWDNLEMQCRMFGV-PYAPVPAPDHWLTDDEELACGC- 126

Query: 127 IFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPL 186
                H PGH+PG + +   +      GDTLF  S+GRTD+  GD   L  SI  ++  L
Sbjct: 127 -GVALHTPGHTPGSMSFWFADARLLIAGDTLFHRSVGRTDLWGGDAAALKRSIRERLYTL 185

Query: 187 GDEISFVCGHGPNSTIGRERRLNPFLKS 214
            +E + V GHG ++ +G E R NPF+++
Sbjct: 186 DEEATVVTGHGSDTRLGDEMRENPFVRA 213


>gi|150005536|ref|YP_001300280.1| putative metallo-beta-lactamase [Bacteroides vulgatus ATCC 8482]
 gi|254884548|ref|ZP_05257258.1| conserved hypothetical protein [Bacteroides sp. 4_3_47FAA]
 gi|294778737|ref|ZP_06744156.1| metallo-beta-lactamase domain protein [Bacteroides vulgatus PC510]
 gi|319640758|ref|ZP_07995471.1| metallo-beta-lactamase [Bacteroides sp. 3_1_40A]
 gi|149933960|gb|ABR40658.1| putative metallo-beta-lactamase [Bacteroides vulgatus ATCC 8482]
 gi|254837341|gb|EET17650.1| conserved hypothetical protein [Bacteroides sp. 4_3_47FAA]
 gi|294447393|gb|EFG15974.1| metallo-beta-lactamase domain protein [Bacteroides vulgatus PC510]
 gi|317387570|gb|EFV68436.1| metallo-beta-lactamase [Bacteroides sp. 3_1_40A]
          Length = 212

 Score =  160 bits (406), Expect = 8e-38,   Method: Composition-based stats.
 Identities = 61/214 (28%), Positives = 104/214 (48%), Gaps = 6/214 (2%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGG----DLDIIKDVIQSRNFHVKQIWITH 59
           +     +   F  NC  L DE + EAV++D G     +   +K  I S +  VK +  TH
Sbjct: 1   MKIKKFEFNMFPVNCYVLSDE-TKEAVIIDAGCFYEEEKQALKRYIDSNSLTVKHLLNTH 59

Query: 60  GHVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGD 119
            H+DH+ G   L ++  L     ++ D   + +   Q+R+   ++        +++ DGD
Sbjct: 60  LHLDHIFGNPFLLQEYGLKAEA-NQADEFWLEQAPAQSRMFGFQLPEAPVPLGKYIFDGD 118

Query: 120 TLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSI 179
            +  G    +  H PGHSPG +++   E +    GD LF+ SIGR D+  G++ +L   I
Sbjct: 119 IITFGNTQLEAIHVPGHSPGSIVFYCKEAHCIFSGDVLFQGSIGRADLTGGNFDELREHI 178

Query: 180 NNKILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
            +++  L  +     GHG  +T+G E+  NPF +
Sbjct: 179 CSRLFVLPPDTVVYPGHGDPTTVGAEKANNPFFR 212


>gi|15607080|ref|NP_214462.1| hypothetical protein aq_2135 [Aquifex aeolicus VF5]
 gi|6648043|sp|O67893|Y2135_AQUAE RecName: Full=Uncharacterized protein aq_2135
 gi|2984341|gb|AAC07862.1| hypothetical protein aq_2135 [Aquifex aeolicus VF5]
          Length = 211

 Score =  160 bits (406), Expect = 8e-38,   Method: Composition-based stats.
 Identities = 65/208 (31%), Positives = 105/208 (50%), Gaps = 4/208 (1%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +   ++ V P   NC+ + DE+S EA+++DPG + + I + ++  +F V  I  THGH+D
Sbjct: 1   MIIKVIPVGPIAVNCSVVADEKSGEAIIIDPGAEAEKILEAVK--DFKVVGIVATHGHID 58

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG   +LKE   +     +  D  ++   +  +   S          D  + +GD + +
Sbjct: 59  HVGQVGKLKELFDVP-FYMNPLDKFLIND-EIWSGFASYIGAVPCPEPDVEISEGDVIRV 116

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   FKV H PGH+PG       +      GD LF+ S+GR D+  G+  +L  S+   +
Sbjct: 117 GDVEFKVLHTPGHTPGLCCLYEEKRRVLIAGDLLFKGSVGRWDLPGGNLVELKKSVKRVL 176

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPF 211
             L  +   +CGH   +TIG+ER  NPF
Sbjct: 177 TELPQDTLVICGHYDETTIGQERAFNPF 204


>gi|104780137|ref|YP_606635.1| metallo-beta-lactamase family hydrolase [Pseudomonas entomophila
           L48]
 gi|95109124|emb|CAK13821.1| putative hydrolase; metallo-beta-lactamase family protein
           [Pseudomonas entomophila L48]
          Length = 214

 Score =  160 bits (406), Expect = 8e-38,   Method: Composition-based stats.
 Identities = 72/208 (34%), Positives = 105/208 (50%), Gaps = 4/208 (1%)

Query: 7   HIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVG 66
               V P + NCT + D  S +A+VVDPGGD   I   +Q     +  I  TH H DH  
Sbjct: 11  ETFPVGPLQCNCTLIGDPVSKKAIVVDPGGDEQKILARLQHHGLTLVSIIHTHAHFDHFL 70

Query: 67  GAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTH 126
            + +LK     T+   HK D  +   ++ Q ++          S DRWL D + L  G  
Sbjct: 71  ASGKLKALTGATLH-LHKADQPLWDNLEMQCQMF-GMPYTPVPSPDRWLSDDEELACGC- 127

Query: 127 IFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPL 186
                H PGH+PG + +   E+     GDTLFR  +GRTD+  GD + ++ SI  ++  L
Sbjct: 128 -GVALHTPGHTPGSMSFWFAEHKLLIAGDTLFRRGVGRTDLWGGDQRAIVRSIKERLYRL 186

Query: 187 GDEISFVCGHGPNSTIGRERRLNPFLKS 214
            +E   V GHGP++ +G E R NPF+++
Sbjct: 187 DEEAIVVTGHGPDTRLGDEMRENPFVRA 214


>gi|26987508|ref|NP_742933.1| beta-lactamase domain protein [Pseudomonas putida KT2440]
 gi|24982175|gb|AAN66397.1|AE016267_6 metallo-beta-lactamase family protein [Pseudomonas putida KT2440]
          Length = 214

 Score =  160 bits (406), Expect = 8e-38,   Method: Composition-based stats.
 Identities = 74/208 (35%), Positives = 109/208 (52%), Gaps = 4/208 (1%)

Query: 7   HIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVG 66
               V P + NCT + D  + +A+VVDPGGD+D I   +Q     +  I  TH H DH  
Sbjct: 11  ETFPVGPLQCNCTLIGDPLTKKAIVVDPGGDVDKILARLQVHGLTLVSIIHTHAHFDHFL 70

Query: 67  GAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTH 126
            + +LKE    T+   HKDD  +   ++ Q ++  +      A  DRWL D + L  G  
Sbjct: 71  ASGKLKELTGATLH-LHKDDQMLWDNLEMQCQMFGVPYTPVPA-PDRWLGDDEELACGC- 127

Query: 127 IFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPL 186
                H PGH+PG + +   +      GDTLFR  IGRTD+  GD + ++ SI  ++  L
Sbjct: 128 -GVALHTPGHTPGSMSFWFADAKLLIAGDTLFRRGIGRTDLWGGDQRAIVRSIKERLYRL 186

Query: 187 GDEISFVCGHGPNSTIGRERRLNPFLKS 214
            +E   V GHGP++ +G E R NPF+++
Sbjct: 187 DEEAVVVTGHGPDTRLGDEMRENPFVRA 214


>gi|229491977|ref|ZP_04385794.1| putative metallo-beta-lactamase domain protein [Rhodococcus
           erythropolis SK121]
 gi|229321109|gb|EEN86913.1| putative metallo-beta-lactamase domain protein [Rhodococcus
           erythropolis SK121]
          Length = 226

 Score =  160 bits (406), Expect = 9e-38,   Method: Composition-based stats.
 Identities = 74/220 (33%), Positives = 110/220 (50%), Gaps = 12/220 (5%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDL-DIIKDVIQSRNFHVKQIWITHGHV 62
           +         F+ NC  L  +++ E VVVDPG D  + + + + S++  V  + +THGH+
Sbjct: 1   MLVTGFPAGMFQTNCYILAQDDACECVVVDPGQDAAEPLFEYLDSKDMSVTAVLLTHGHL 60

Query: 63  DHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDE----QARLLSIRMNARNASSDRWLQDG 118
           DHV  A ++ E  S+     H +D  M+           +     M          L DG
Sbjct: 61  DHVWSAREVCERYSVP-AYIHPEDRYMLSDPARGIGPTMKEFIQGMTFVEPDEVIELADG 119

Query: 119 DTLLLGTHIFKVFHCPGHSPGHVIYVNFENNFA------HLGDTLFRSSIGRTDILHGDY 172
           D +      F V H PGH+ G V++    N  +        GDTLF+ S+GR+D+  G++
Sbjct: 120 DKITEAGMTFVVDHTPGHTQGSVVFRTQANTESGPVDLAFTGDTLFQGSVGRSDLPGGNH 179

Query: 173 QQLINSINNKILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           +QL+ SI  K+L LGDE   + GHG NS+IG ER  NPFL
Sbjct: 180 EQLLASIARKLLVLGDETVVLPGHGGNSSIGAERSSNPFL 219


>gi|226366291|ref|YP_002784074.1| hypothetical protein ROP_68820 [Rhodococcus opacus B4]
 gi|226244781|dbj|BAH55129.1| hypothetical protein [Rhodococcus opacus B4]
          Length = 226

 Score =  160 bits (406), Expect = 9e-38,   Method: Composition-based stats.
 Identities = 68/220 (30%), Positives = 105/220 (47%), Gaps = 12/220 (5%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDL-DIIKDVIQSRNFHVKQIWITHGHV 62
           +         F+ NC  L  +++ E VVVDPG D  + + + +  +N     + +THGH+
Sbjct: 1   MLVTGFPAGMFQTNCYILAQDDAPECVVVDPGQDAAEPLFEFLDQKNLTPTAVLLTHGHL 60

Query: 63  DHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDE----QARLLSIRMNARNASSDRWLQDG 118
           DHV  A  + E   +     H +D  M+           +     M          L DG
Sbjct: 61  DHVWNAYDVCEKFGIP-AYIHPEDRYMLSDPGRGIGPTMKPFIEGMTFVEPGEVIALADG 119

Query: 119 DTLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLG------DTLFRSSIGRTDILHGDY 172
           D +      F V H PGH+ G V++    +            DTLF+ SIGR+D+  G++
Sbjct: 120 DVIEQAGMSFAVDHTPGHTQGSVVFRTRVDTENGPVEIALTGDTLFQGSIGRSDLPGGNH 179

Query: 173 QQLINSINNKILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           +QL+ SI +K+L L D+ + + GHG +ST+G ER  NPFL
Sbjct: 180 EQLLRSIADKLLILADDTAVLPGHGGSSTVGAERGSNPFL 219


>gi|160889786|ref|ZP_02070789.1| hypothetical protein BACUNI_02217 [Bacteroides uniformis ATCC 8492]
 gi|156860778|gb|EDO54209.1| hypothetical protein BACUNI_02217 [Bacteroides uniformis ATCC 8492]
          Length = 212

 Score =  160 bits (406), Expect = 9e-38,   Method: Composition-based stats.
 Identities = 64/214 (29%), Positives = 109/214 (50%), Gaps = 6/214 (2%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGG----DLDIIKDVIQSRNFHVKQIWITH 59
           +     +   F +NC  L+DE + EAVV+DPG     +   +K+ I     +VK +  TH
Sbjct: 1   MKIKRFEFNMFPENCYVLWDE-TNEAVVIDPGCFYEEEKQALKNFIIKNGLNVKHLLNTH 59

Query: 60  GHVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGD 119
            H+DH+ G   + ++  L     ++ D   + +  +Q+R+   ++         +L DGD
Sbjct: 60  LHLDHIFGNPFMLKEFGLKAEA-NQADEFWIDEAPKQSRMFGFQLQEAPVPLGTYLHDGD 118

Query: 120 TLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSI 179
            +  G    +  H PGHSPG ++Y    ++    GD LF+ SIGR D+  G++ +LI  I
Sbjct: 119 IITFGNTELEAIHVPGHSPGSLVYYCAADHCMFSGDVLFQGSIGRADLAGGNFDELIEHI 178

Query: 180 NNKILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
            +++  L ++     GHG  +TIG E+  NPF +
Sbjct: 179 CSRLFILPNDTIVYPGHGAPTTIGIEKAENPFFR 212


>gi|333030418|ref|ZP_08458479.1| beta-lactamase domain protein [Bacteroides coprosuis DSM 18011]
 gi|332741015|gb|EGJ71497.1| beta-lactamase domain protein [Bacteroides coprosuis DSM 18011]
          Length = 217

 Score =  160 bits (406), Expect = 9e-38,   Method: Composition-based stats.
 Identities = 66/215 (30%), Positives = 109/215 (50%), Gaps = 6/215 (2%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPG----GDLDIIKDVIQSRNFHVKQIWITH 59
           ++    +   F  N   L+D ++ EAVV+DPG     + + +K  I      +K +  TH
Sbjct: 1   MNIQKFEFNMFPVNSYVLWD-DTKEAVVIDPGVFFDTEKEQLKKFIADNGLKIKHLLNTH 59

Query: 60  GHVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGD 119
            H+DH+ G   + ++  +      +DD   +  V +Q R+    +N       ++L++GD
Sbjct: 60  LHLDHILGNTFMFQEYGIKAEAS-QDDEYWLEGVAQQGRMFGFEVNDEPVPLGKYLKEGD 118

Query: 120 TLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSI 179
            +  G     +F  PGHSPG +++ N     A  GD LF+ S+GR D+  G++  L  +I
Sbjct: 119 QIHFGNQTLDIFQVPGHSPGSLVFYNQATGDAFSGDVLFQGSVGRADLQGGNFTALKENI 178

Query: 180 NNKILPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
             K+  L DE     GHGP++TIGRE++ NPF   
Sbjct: 179 IKKLFILPDETVVHAGHGPSTTIGREKKYNPFFTD 213


>gi|270294063|ref|ZP_06200265.1| conserved hypothetical protein [Bacteroides sp. D20]
 gi|270275530|gb|EFA21390.1| conserved hypothetical protein [Bacteroides sp. D20]
          Length = 212

 Score =  160 bits (406), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 64/214 (29%), Positives = 109/214 (50%), Gaps = 6/214 (2%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGG----DLDIIKDVIQSRNFHVKQIWITH 59
           +     +   F +NC  L+DE + EAVV+DPG     +   +K+ I     +VK +  TH
Sbjct: 1   MKIKRFEFNMFPENCYVLWDE-TNEAVVIDPGCFYEEEKQALKNFIIKNGLNVKHLLNTH 59

Query: 60  GHVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGD 119
            H+DH+ G   + ++  L     ++ D   + +  +Q+R+   ++         +L DGD
Sbjct: 60  LHLDHIFGNPFMLKEFGLKAEA-NQADEFWIDEAPKQSRMFGFQLQEAPVPLGTYLHDGD 118

Query: 120 TLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSI 179
            +  G    +  H PGHSPG ++Y    ++    GD LF+ SIGR D+  G++ +LI  I
Sbjct: 119 IITFGNTKLEAIHVPGHSPGSLVYYCAADHCMFSGDVLFQGSIGRADLAGGNFDELIEHI 178

Query: 180 NNKILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
            +++  L ++     GHG  +TIG E+  NPF +
Sbjct: 179 CSRLFILPNDTIVYPGHGAPTTIGIEKAENPFFR 212


>gi|317478820|ref|ZP_07937971.1| metallo-beta-lactamase superfamily protein [Bacteroides sp. 4_1_36]
 gi|316904996|gb|EFV26799.1| metallo-beta-lactamase superfamily protein [Bacteroides sp. 4_1_36]
          Length = 212

 Score =  160 bits (406), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 64/214 (29%), Positives = 109/214 (50%), Gaps = 6/214 (2%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGG----DLDIIKDVIQSRNFHVKQIWITH 59
           +     +   F +NC  L+DE + EAVV+DPG     +   +K+ I     +VK +  TH
Sbjct: 1   MKIKRFEFNMFPENCYVLWDE-TNEAVVIDPGCFYEEEKQALKNFIIKNGLNVKHLLNTH 59

Query: 60  GHVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGD 119
            H+DH+ G   + ++  L     ++ D   + +  +Q+R+   ++         +L DGD
Sbjct: 60  LHLDHIFGNPFMLKEFGLKAEA-NQADEFWIDEAPKQSRMFGFQLQEAPVPLGTYLHDGD 118

Query: 120 TLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSI 179
            +  G    +  H PGHSPG ++Y    ++    GD LF+ SIGR D+  G++ +LI  I
Sbjct: 119 IITFGNTKLEAIHVPGHSPGSLVYYCAADHCMFSGDVLFQGSIGRADLTGGNFDELIEHI 178

Query: 180 NNKILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
            +++  L ++     GHG  +TIG E+  NPF +
Sbjct: 179 CSRLFILPNDTIVYPGHGAPTTIGIEKAENPFFR 212


>gi|303230726|ref|ZP_07317473.1| metallo-beta-lactamase domain protein [Veillonella atypica
           ACS-049-V-Sch6]
 gi|302514486|gb|EFL56481.1| metallo-beta-lactamase domain protein [Veillonella atypica
           ACS-049-V-Sch6]
          Length = 211

 Score =  160 bits (405), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 62/211 (29%), Positives = 97/211 (45%), Gaps = 5/211 (2%)

Query: 2   SKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGH 61
           S L    + + P   NC  + D+   EA ++DP      + + ++  N   K + +THGH
Sbjct: 4   SNLVLMRMPLGPLGTNCYVIGDKAQGEAFIIDPA--TTEVLEALKKHNLKPKAVLLTHGH 61

Query: 62  VDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
            DH+GG   + +   + I   H +D   +   +      S             + +GD +
Sbjct: 62  GDHIGGVQGIVDAYDVPIYIHH-NDVKYLSDPELNLSNYSNPTPITVKGRIIEVHEGDHI 120

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
             G     V+  PGH+PG      +      +GDTLF  S+GRTD + GDY  LI++I  
Sbjct: 121 TCGAIDLTVYETPGHTPGG--VCYYMPGLVFVGDTLFNQSVGRTDFVEGDYDALIDAIKT 178

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           K+  L D      GHGP + IG E++ NPF+
Sbjct: 179 KLYTLPDNTMVYPGHGPETQIGYEKQYNPFV 209


>gi|168699564|ref|ZP_02731841.1| beta-lactamase domain protein [Gemmata obscuriglobus UQM 2246]
          Length = 214

 Score =  160 bits (405), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 75/215 (34%), Positives = 111/215 (51%), Gaps = 5/215 (2%)

Query: 4   LSFHIVQV--TPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGH 61
           ++  I+ V   PF +N   ++ + S EA V+DPG + D+I++ +  R   +  +  THGH
Sbjct: 1   MAVQILTVESQPFAENSYLVWKDGSPEAFVIDPGFEPDLIEEALAERGLKLVALVCTHGH 60

Query: 62  VDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
            DH+ G A LK+      I     DAAM+   ++               +DR + +G+TL
Sbjct: 61  CDHIAGNAALKQAHPEAPIVIGAGDAAMLTDANKNLSGPFGFEVLSPP-ADRVVGEGETL 119

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHL--GDTLFRSSIGRTDILHGDYQQLINSI 179
            +     +VF  PGHSPGHV+YV  E     +  GD LFR  +GRTD   G ++QL   I
Sbjct: 120 TVAGIALEVFEVPGHSPGHVVYVVRETQPVTVLGGDVLFRGGVGRTDFPGGSFEQLKAGI 179

Query: 180 NNKILPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
              + PL  +     GHGP +TIG E+R NPF+  
Sbjct: 180 QRVLWPLPADAVVYPGHGPVTTIGHEKRTNPFVAD 214


>gi|256752953|ref|ZP_05493780.1| beta-lactamase domain protein [Thermoanaerobacter ethanolicus
           CCSD1]
 gi|256748161|gb|EEU61238.1| beta-lactamase domain protein [Thermoanaerobacter ethanolicus
           CCSD1]
          Length = 210

 Score =  160 bits (405), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 76/211 (36%), Positives = 115/211 (54%), Gaps = 4/211 (1%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +      V  +  NC  + DEE  EA+V+DPG     I+D I + N +VK I +THGH D
Sbjct: 1   MKIQRYVVGLYGANCYIVSDEEEREAIVIDPGEYSSEIQDYIVTNNLNVKYILLTHGHFD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+GG  +LK+     +    +D   ++      + ++  ++      +D  L DGDTL  
Sbjct: 61  HIGGVEELKKLTQARVAISKEDAPMLLDPSLNLSEMVYKKILCNP--ADILLSDGDTLYF 118

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G +  ++ H PGH+          +N    GDTLF+ SIGR D   GD+  L +SI NK+
Sbjct: 119 GKYKVEILHTPGHT--KGGVCFKIDNVCFTGDTLFKGSIGRHDFPGGDFSTLRDSIKNKL 176

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           L LG++++   GHG +STIG+E+RLN FL+ 
Sbjct: 177 LVLGNDVTIYPGHGDSSTIGKEKRLNLFLRD 207


>gi|119713428|gb|ABL97490.1| beta-lactamase family protein [uncultured marine bacterium
           HF130_81H07]
          Length = 208

 Score =  160 bits (405), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 90/201 (44%), Positives = 136/201 (67%), Gaps = 1/201 (0%)

Query: 16  QNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLKEDL 75
           QN   +++E++  A V DPGGDL+ I+  ++  +  + +I+ITHGH+DH GGA  L +  
Sbjct: 2   QNSCIIWNEDTKNAAVTDPGGDLEKIESYLKENDLQLIKIFITHGHLDHAGGAFNLSKKF 61

Query: 76  SLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFKVFHCPG 135
           ++ I GPHK+D  ++  ++E  ++  +   ++N   DRWL DGD L L    F V+HCPG
Sbjct: 62  NVPIEGPHKEDEFLISALEEHGKMYGLSD-SKNFLPDRWLDDGDQLELDGIHFDVYHCPG 120

Query: 136 HSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEISFVCG 195
           H+PGHVI+ N E+ FA +GD LF+ SIGRTD   G++++LIN+I  K+ PLGD+++FV G
Sbjct: 121 HTPGHVIFHNKESKFAIVGDVLFQGSIGRTDFPRGNHEELINAIRTKLWPLGDDVTFVPG 180

Query: 196 HGPNSTIGRERRLNPFLKSNI 216
           HGP ST G+ER  NP++   +
Sbjct: 181 HGPVSTFGQERMTNPYVADQL 201


>gi|163814887|ref|ZP_02206275.1| hypothetical protein COPEUT_01038 [Coprococcus eutactus ATCC 27759]
 gi|158449826|gb|EDP26821.1| hypothetical protein COPEUT_01038 [Coprococcus eutactus ATCC 27759]
          Length = 218

 Score =  160 bits (405), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 59/213 (27%), Positives = 107/213 (50%), Gaps = 1/213 (0%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M++L+    ++  F+ NC  + + ++ EA+V+DP  +   IK  +  R      I++THG
Sbjct: 6   MAELNIDAYELGGFQTNCYIVSNADTGEAIVIDPSWNAAFIKGRLDERKLKCVGIYLTHG 65

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMG-KVDEQARLLSIRMNARNASSDRWLQDGD 119
           H+DH+    +++E           ++  +   KV+  A + ++        +D +L +GD
Sbjct: 66  HIDHMAAMDEIRELTGAPTYASEDEEEVLGSSKVNLSAMMTAVFGKVVETKADNYLTEGD 125

Query: 120 TLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSI 179
              +     +    PGH+ G + Y   E +    GDTLF+ S+GR+D   GD   L+ +I
Sbjct: 126 VKKILGTEMRCISVPGHTKGGMCYYFDEQHILFSGDTLFKYSVGRSDFPTGDEHALLENI 185

Query: 180 NNKILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
             K+  L D+     GHG  + IG+E+++NPF 
Sbjct: 186 REKLFVLPDDTVVYPGHGDKTQIGKEKKMNPFF 218


>gi|301063229|ref|ZP_07203778.1| metallo-beta-lactamase domain protein [delta proteobacterium
           NaphS2]
 gi|300442657|gb|EFK06873.1| metallo-beta-lactamase domain protein [delta proteobacterium
           NaphS2]
          Length = 190

 Score =  160 bits (405), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 76/209 (36%), Positives = 101/209 (48%), Gaps = 20/209 (9%)

Query: 6   FHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHV 65
              + V P++ NC  L  +++ E VV+DPG +   I   I     +++ I ITHGHVDHV
Sbjct: 2   LRKIVVGPYQANCYILGCDKTKEGVVIDPGDEAVRIVTEISKLGLNIRYILITHGHVDHV 61

Query: 66  GGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGT 125
           G A +LK      +   H  DA  +G   +                   L +G  +  G 
Sbjct: 62  GAAGELKNVTKAPVW-IHPQDAGALGFPSDGD-----------------LFEGQKISWGE 103

Query: 126 HIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILP 185
               V H PGHS                GDTLF  SIGRTD   G++QQLI  + NKI P
Sbjct: 104 FTLSVIHTPGHS--AGGVCFHAPGAVFTGDTLFAGSIGRTDFPGGNHQQLIQGVINKIFP 161

Query: 186 LGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           LGD +    GHGP+STIG+ER+ NPF + 
Sbjct: 162 LGDALRVYPGHGPHSTIGQERKFNPFFRG 190


>gi|229588473|ref|YP_002870592.1| putative metallo-beta-lactamase family protein [Pseudomonas
           fluorescens SBW25]
 gi|229360339|emb|CAY47196.1| putative metallo-beta-lactamase family protein [Pseudomonas
           fluorescens SBW25]
          Length = 214

 Score =  160 bits (405), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 71/208 (34%), Positives = 110/208 (52%), Gaps = 4/208 (1%)

Query: 7   HIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVG 66
               V P + NCT + D  S +A+VVDPGG+ ++I   + +    V  I  TH H+DH  
Sbjct: 11  ETFPVGPLQCNCTIIGDPISKKAIVVDPGGNHELILARLDALGLKVVSIIHTHAHLDHFL 70

Query: 67  GAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTH 126
            + QLKE    T+   HK+D  +   ++ Q ++  +      +  DRWL+D + L  G  
Sbjct: 71  ASGQLKEKTGATLH-LHKEDQFLWDNLEMQCQMFRVPYTPVPS-PDRWLEDDEELACGC- 127

Query: 127 IFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPL 186
                H PGH+PG + +   +      GDTLFR  IGRTD+  GD   ++ SI  ++  L
Sbjct: 128 -GVALHTPGHTPGSMSFWFADAKLLIAGDTLFRRGIGRTDLWGGDQATIVRSIKQRLYTL 186

Query: 187 GDEISFVCGHGPNSTIGRERRLNPFLKS 214
            +  + V GHGP++ +G E R NPF+++
Sbjct: 187 DEGATVVTGHGPDTRLGDEMRENPFVRA 214


>gi|312139504|ref|YP_004006840.1| metallo-beta-lactamase superfamily protein [Rhodococcus equi 103S]
 gi|325672606|ref|ZP_08152302.1| metallo-beta-lactamase superfamily protein [Rhodococcus equi ATCC
           33707]
 gi|311888843|emb|CBH48155.1| putative metallo-beta-lactamase superfamily protein [Rhodococcus
           equi 103S]
 gi|325556483|gb|EGD26149.1| metallo-beta-lactamase superfamily protein [Rhodococcus equi ATCC
           33707]
          Length = 226

 Score =  160 bits (404), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 68/220 (30%), Positives = 98/220 (44%), Gaps = 12/220 (5%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDL-DIIKDVIQSRNFHVKQIWITHGHV 62
           +         F+ NC  L  ++S E VVVDPG D  + +   +       K + +THGH+
Sbjct: 1   MLVTGFPAGMFQTNCYILAHDDSGECVVVDPGQDAAEPLMQFLAQSELEPKAVLLTHGHL 60

Query: 63  DHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDE----QARLLSIRMNARNASSDRWLQDG 118
           DH      + E   +     H DD  M+                 +          L DG
Sbjct: 61  DHTWSVHPVCEHYGIP-AYIHPDDRYMLTDPGRGIGPSMNQFIAGVEFLEPDEVIELADG 119

Query: 119 DTLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHL------GDTLFRSSIGRTDILHGDY 172
           D   +    F V H PGH+ G V+                 GDTLF+ SIGR+D+  G++
Sbjct: 120 DEFTVAGIDFVVDHTPGHTQGSVVLRTEIATEEGPLQVALTGDTLFQGSIGRSDLPGGNH 179

Query: 173 QQLINSINNKILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           +QL+ SI  K+L L D  + + GHG +S+IG+ER  NPFL
Sbjct: 180 EQLLQSIARKLLVLDDTTAILPGHGGSSSIGQERASNPFL 219


>gi|226306421|ref|YP_002766381.1| hypothetical protein RER_29340 [Rhodococcus erythropolis PR4]
 gi|226185538|dbj|BAH33642.1| conserved hypothetical protein [Rhodococcus erythropolis PR4]
          Length = 226

 Score =  160 bits (404), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 76/220 (34%), Positives = 110/220 (50%), Gaps = 12/220 (5%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDL-DIIKDVIQSRNFHVKQIWITHGHV 62
           +         F+ NC  L  +++ E VVVDPG D  + + + + S++  V  + +THGH+
Sbjct: 1   MLVTGFPAGMFQTNCYILAQDDACECVVVDPGQDAAEPLFEYLDSKDMSVNAVLLTHGHL 60

Query: 63  DHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDE----QARLLSIRMNARNASSDRWLQDG 118
           DHV  A ++ E  S+     H DD  M+           +     M          L DG
Sbjct: 61  DHVWSAREVCERYSVP-AYIHPDDRYMLSDPARGIGPTMKEFIQGMTFVEPDEVIELSDG 119

Query: 119 DTLLLGTHIFKVFHCPGHSPGHVIYVNFENNFA------HLGDTLFRSSIGRTDILHGDY 172
           D +      F V H PGH+ G V++    N  +        GDTLF+ SIGR+D+  G++
Sbjct: 120 DKITEAGMTFVVDHTPGHTQGSVVFRTQANTESGPVDLAFTGDTLFQGSIGRSDLPGGNH 179

Query: 173 QQLINSINNKILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           +QL+ SI  K+L LGDE   + GHG NS+IG ER  NPFL
Sbjct: 180 EQLLASIARKLLVLGDETVVLPGHGGNSSIGAERSSNPFL 219


>gi|320353168|ref|YP_004194507.1| hydroxyacylglutathione hydrolase [Desulfobulbus propionicus DSM
           2032]
 gi|320121670|gb|ADW17216.1| hydroxyacylglutathione hydrolase [Desulfobulbus propionicus DSM
           2032]
          Length = 210

 Score =  160 bits (404), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 69/212 (32%), Positives = 100/212 (47%), Gaps = 7/212 (3%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +    + V      C  +  +++ EA V+DPGGD D I D   S    V  I  THGH D
Sbjct: 1   MLVKQLTVGMMGVCCYIVSCDQTKEAAVIDPGGDEDRILDYCTSHGLRVTHIINTHGHPD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HV G  ++++     I+  H +D    G         S      +   D  + DGD + +
Sbjct: 61  HVCGNGRIQQATGAKIVM-HAEDVDYFGDP-RIRDYFSSLGLPESPPVDIVVHDGDLITV 118

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V H PGH+PG      +       GDTLF  ++GRTD   G  +Q+I++I N++
Sbjct: 119 GQEQLQVIHTPGHTPGG--ICLYSPPHCFTGDTLFVGAVGRTDFPGGSIRQMIDAIKNRL 176

Query: 184 LPLGDEISFVCGHGP---NSTIGRERRLNPFL 212
           +PL  E     GHG     ST+ RE R NP+L
Sbjct: 177 MPLPPETLVWPGHGYGGSQSTLARELRTNPYL 208


>gi|167040108|ref|YP_001663093.1| beta-lactamase domain-containing protein [Thermoanaerobacter sp.
           X514]
 gi|300914193|ref|ZP_07131509.1| beta-lactamase domain-containing protein [Thermoanaerobacter sp.
           X561]
 gi|307724572|ref|YP_003904323.1| beta-lactamase domain-containing protein [Thermoanaerobacter sp.
           X513]
 gi|166854348|gb|ABY92757.1| beta-lactamase domain protein [Thermoanaerobacter sp. X514]
 gi|300889128|gb|EFK84274.1| beta-lactamase domain-containing protein [Thermoanaerobacter sp.
           X561]
 gi|307581633|gb|ADN55032.1| beta-lactamase domain protein [Thermoanaerobacter sp. X513]
          Length = 210

 Score =  160 bits (404), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 76/211 (36%), Positives = 116/211 (54%), Gaps = 4/211 (1%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +      V  +  NC  + DEE  EA+V+DPG     I+D I + N +VK I +THGH D
Sbjct: 1   MKIQRYVVGLYGANCYIVSDEEEREAIVIDPGEYSSEIQDYIVTNNLNVKYILLTHGHFD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+GG  +LK+    ++    +D   ++      + ++  ++      +D  L DGDTL  
Sbjct: 61  HIGGVEELKKLTQASVAISKEDAPMLLDPSLNLSEMVYKKILCNP--ADILLSDGDTLYF 118

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G +  ++ H PGH+          +N    GDTLF+ SIGR D   GD+  L +SI NK+
Sbjct: 119 GKYKVEILHTPGHT--KGGVCFKIDNVCFTGDTLFKDSIGRHDFPGGDFSTLRDSIKNKL 176

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           L LG++++   GHG +STIG+E+RLN FL+ 
Sbjct: 177 LVLGNDVTIYPGHGDSSTIGKEKRLNLFLRD 207


>gi|299136768|ref|ZP_07029951.1| metallo-beta-lactamase family protein [Acidobacterium sp. MP5ACTX8]
 gi|298601283|gb|EFI57438.1| metallo-beta-lactamase family protein [Acidobacterium sp. MP5ACTX8]
          Length = 209

 Score =  160 bits (404), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 73/209 (34%), Positives = 101/209 (48%), Gaps = 2/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +    + V     NCT L DE S EA+VVDPG D+  I  V+      VKQI +TH H+D
Sbjct: 1   MIRETLAVGLLGCNCTVLGDETSREAIVVDPGYDIPRILAVLAKHQLTVKQIVVTHAHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+  A +LK+     I+    D    +  + E+               D    D + + +
Sbjct: 61  HIASAFELKQITGAPIVYNQADLP--LVAIMEEQAAWIEVAVPEVKPPDHSPADEEKITV 118

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
                 V H PGH+ G +       +    GDTLF  SIGRTD+  G+  +++ SI  ++
Sbjct: 119 RGIEATVLHTPGHTEGSLCLYIPTESLLLAGDTLFARSIGRTDLPGGNTAKILESIRERL 178

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           LPL D    V GHGP +TI RER  NPFL
Sbjct: 179 LPLPDATLVVPGHGPTTTIVRERTSNPFL 207


>gi|189462109|ref|ZP_03010894.1| hypothetical protein BACCOP_02789 [Bacteroides coprocola DSM 17136]
 gi|189431190|gb|EDV00175.1| hypothetical protein BACCOP_02789 [Bacteroides coprocola DSM 17136]
          Length = 212

 Score =  160 bits (404), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 65/214 (30%), Positives = 104/214 (48%), Gaps = 6/214 (2%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGG----DLDIIKDVIQSRNFHVKQIWITH 59
           +     +   F  NC  + DE + EA ++D G     +  ++K  I      VK +  TH
Sbjct: 1   MKIKRFEFNMFPVNCYVISDE-TGEAAIIDAGCFFPEEQQMLKQYIADNKLTVKHLLNTH 59

Query: 60  GHVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGD 119
            H+DHV G   +  +  L      + D  ++ K+ +Q R+     N        +++DG+
Sbjct: 60  LHLDHVFGNPFILREFGLKAEAC-QLDEFLLAKLPDQCRMFGFSPNEAPVGLGHYIEDGE 118

Query: 120 TLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSI 179
            +  G    +  H PGHSPG ++Y    +     GD LF+ SIGR D+  GD+ +LI  I
Sbjct: 119 IIRFGHTELQAIHVPGHSPGGMVYYCKADACLFSGDVLFQGSIGRADLEGGDFNELIEQI 178

Query: 180 NNKILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           + ++L L DE     GHG  ++IG+E+  NPF K
Sbjct: 179 SCRLLTLPDETLVYPGHGEPTSIGKEKMENPFFK 212


>gi|167758797|ref|ZP_02430924.1| hypothetical protein CLOSCI_01139 [Clostridium scindens ATCC 35704]
 gi|167663537|gb|EDS07667.1| hypothetical protein CLOSCI_01139 [Clostridium scindens ATCC 35704]
          Length = 206

 Score =  160 bits (404), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 62/209 (29%), Positives = 97/209 (46%), Gaps = 3/209 (1%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +            NC    +EE+ +AVVVDP      +   I+S    ++ + +TH H D
Sbjct: 1   MKVERFVTGIISTNCYLAVNEETRQAVVVDPAACPSYLLSHIKSEGIKIEALLLTHAHFD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+ G     ++  + +    +D  AM      Q+ + +       A   + +++G  L L
Sbjct: 61  HIMGIDGFVDEFHVPVYVYEEDADAMTDPKLNQSSVYTGGYTYEGA---KSIKEGQILKL 117

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
             + F+VFH PGH+ G   Y          GDTLF++SIGRTD   G    L+ ++  K+
Sbjct: 118 AGYDFEVFHTPGHTKGGCCYYVRSEGVLFSGDTLFQNSIGRTDFPGGSMSDLVRAVKEKL 177

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           + L DE     GH   +TIG E+  NPFL
Sbjct: 178 MVLPDETLVYPGHMGETTIGHEKTHNPFL 206


>gi|310643939|ref|YP_003948697.1| beta-lactamase domain-containing protein [Paenibacillus polymyxa
           SC2]
 gi|309248889|gb|ADO58456.1| Beta-lactamase domain-containing protein [Paenibacillus polymyxa
           SC2]
          Length = 209

 Score =  160 bits (404), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 67/212 (31%), Positives = 110/212 (51%), Gaps = 7/212 (3%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           LS     + P + N   L  ++   AV++DPG +   +   I+S    ++ I +TH H D
Sbjct: 3   LSIRSFNLGPLQTNAYLLQGDDPQRAVIIDPGMNPGPLLRAIES--LTIEAILLTHAHFD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNA--SSDRWLQDGDTL 121
           H+GG  +++      +   H  +   +        L+    +   +   ++  L +G  L
Sbjct: 61  HIGGVEEIRNAKGCPVY-LHALEQDWLTSPKLNGSLMWPEASPPISTGPAEYDLAEGQQL 119

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
            L  H FKV H PGHSPG V ++  ++ F   GD LFR  +GRTD+  G  + L +SI N
Sbjct: 120 KLIGHTFKVLHTPGHSPGSVSFLCGKDLF--SGDVLFRQGVGRTDLTGGRERDLYDSIQN 177

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           K+ PLGD+++   GHGP ++IG E+  NP+++
Sbjct: 178 KLFPLGDDVTVYPGHGPKTSIGYEKANNPYIR 209


>gi|308272929|emb|CBX29533.1| Uncharacterized protein aq_2135 [uncultured Desulfobacterium sp.]
          Length = 208

 Score =  160 bits (404), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 82/208 (39%), Positives = 113/208 (54%), Gaps = 4/208 (1%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +    + V P   NC  +  E + EAVV+DPG + D I  VI      VK I  THGHVD
Sbjct: 1   MIIEDLIVGPIMSNCFVVGCENTKEAVVIDPGDEPDKILMVIAKHKLKVKYIINTHGHVD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVGG  +LKE     +   H  DA M+ ++        + +       D+ L+DGD +  
Sbjct: 61  HVGGNKKLKEATGADL-LIHSLDAPMLSRIAATGAAWGLNVEDSPP-PDQMLKDGDEVKF 118

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    KV H PGHSPG +    + ++   +GDTLF  SIGRTD   GDY  +I+SI NK+
Sbjct: 119 GDITLKVIHTPGHSPGGISL--YTDDCVFVGDTLFAGSIGRTDFPGGDYDTIISSIRNKL 176

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPF 211
             LGD++  + GHGP ++I  E++ NPF
Sbjct: 177 FVLGDDVRVLAGHGPETSIAIEKKYNPF 204


>gi|89099202|ref|ZP_01172080.1| YqgX [Bacillus sp. NRRL B-14911]
 gi|89086048|gb|EAR65171.1| YqgX [Bacillus sp. NRRL B-14911]
          Length = 210

 Score =  159 bits (403), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 58/211 (27%), Positives = 101/211 (47%), Gaps = 2/211 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + +  + + P + N   L  E+    +++DPGG+   +   I+        + +TH H D
Sbjct: 1   MEWKQIPLGPIQTNSYVLSRED-GTCLIIDPGGEASKLAGYIKGNKLKPLAVLLTHAHFD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G   +++E+        HK +++ +                    +D  L     + +
Sbjct: 60  HIGALDEIREEFGCP-AYLHKKESSWLRDPSLNGSQFFRMGKVTAKPADNLLAGDQEMKI 118

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   F++   PGHSPG V +   E +    GD LF  SIGRTD+  G+ ++L+ SI++K+
Sbjct: 119 GAFSFQIIETPGHSPGSVSFYFPEASLVASGDALFSGSIGRTDLPGGNQEKLLKSIHDKL 178

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           L L ++   + GHGP + IG+E   NPFL  
Sbjct: 179 LVLPEDTLVLSGHGPATYIGQEMDSNPFLNG 209


>gi|329965432|ref|ZP_08302356.1| metallo-beta-lactamase domain protein [Bacteroides fluxus YIT
           12057]
 gi|328522224|gb|EGF49338.1| metallo-beta-lactamase domain protein [Bacteroides fluxus YIT
           12057]
          Length = 212

 Score =  159 bits (403), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 66/214 (30%), Positives = 109/214 (50%), Gaps = 6/214 (2%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGG----DLDIIKDVIQSRNFHVKQIWITH 59
           +     +   F +NC  L+DE + EAVV+DPG     +   +K+ I S   +VK +  TH
Sbjct: 1   MKIKRFEFNMFPENCYVLWDE-TYEAVVIDPGCFYEEEKQALKNFIISNGLNVKHLLNTH 59

Query: 60  GHVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGD 119
            H+DH+ G   + ++  L     ++ D   + +  +Q+R+   ++         +L DGD
Sbjct: 60  LHLDHIFGNPFMLKEFGLKAEA-NQADEFWIDEAPKQSRMFGFQLQETPVPLGNYLHDGD 118

Query: 120 TLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSI 179
            +  G    +  H PGHSPG ++Y    +     GD LF+ SIGR D+  G++ +LI  I
Sbjct: 119 IITFGNTSLEAIHVPGHSPGSLVYYCAADRCMFSGDVLFQGSIGRADLSGGNFDELIEHI 178

Query: 180 NNKILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
            +++  L +E     GHG  +TIG E+  NPF +
Sbjct: 179 CSRLFTLPNETIVYPGHGAPTTIGIEKAENPFFR 212


>gi|269798271|ref|YP_003312171.1| beta-lactamase [Veillonella parvula DSM 2008]
 gi|294792132|ref|ZP_06757280.1| metallo-beta-lactamase family protein [Veillonella sp. 6_1_27]
 gi|269094900|gb|ACZ24891.1| beta-lactamase domain protein [Veillonella parvula DSM 2008]
 gi|294457362|gb|EFG25724.1| metallo-beta-lactamase family protein [Veillonella sp. 6_1_27]
          Length = 211

 Score =  159 bits (403), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 63/214 (29%), Positives = 101/214 (47%), Gaps = 7/214 (3%)

Query: 1   MSK--LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWIT 58
           MS+  L    + + P   NC  + D+   EA ++DP      + D ++  +   K + +T
Sbjct: 1   MSEQQLVLMRMPLGPLGTNCYVIGDKAIGEAFIIDPA--TAEVLDALKKHDLKPKAVVLT 58

Query: 59  HGHVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDG 118
           HGH DH+GG  ++     + +   HK D   +   +      S        +    ++ G
Sbjct: 59  HGHGDHIGGIQEIVNTYHVPVY-IHKGDVPYLSDPELNLSAYSNPTPIMVKAEIIEVKQG 117

Query: 119 DTLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINS 178
           D +  G    +V   PGH+PG      +      +GDTLFR S+GRTD  +G Y+ LI+S
Sbjct: 118 DHITCGDIDLEVLETPGHTPGG--VCYYMEGLVFVGDTLFRDSVGRTDFPNGSYETLISS 175

Query: 179 INNKILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           I  ++  L D      GHGP + IG E++ NPF+
Sbjct: 176 IKTQLYTLPDNTMVYPGHGPETNIGYEKQYNPFV 209


>gi|224539433|ref|ZP_03679972.1| hypothetical protein BACCELL_04338 [Bacteroides cellulosilyticus
           DSM 14838]
 gi|224518938|gb|EEF88043.1| hypothetical protein BACCELL_04338 [Bacteroides cellulosilyticus
           DSM 14838]
          Length = 212

 Score =  159 bits (403), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 67/214 (31%), Positives = 110/214 (51%), Gaps = 6/214 (2%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLD----IIKDVIQSRNFHVKQIWITH 59
           +     +   F  NC  L+D ++LEA V+DPG   +     +K+ I     +VK +  TH
Sbjct: 1   MKIKRFEFNMFPVNCYVLWD-DTLEAAVIDPGCYYEEEKQALKNFIHKNGLNVKHLLNTH 59

Query: 60  GHVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGD 119
            H+DH+ G A + ++  L +   +K D   + +  +Q+R+     N   A    +L DGD
Sbjct: 60  LHLDHIFGNAFMVKEFGLPVEA-NKADEFWIDEAPKQSRMFGFHWNELPAPIGHYLHDGD 118

Query: 120 TLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSI 179
            +  G  + +  H PGHSPG ++Y    ++    GD LF+ SIGR D+  G++ +L   I
Sbjct: 119 IINFGNTMLEAIHVPGHSPGSLVYYCAADHCMFSGDVLFQGSIGRADLTGGNFDELKEHI 178

Query: 180 NNKILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
            +++  L +E     GHG  +TIG E+  NPF +
Sbjct: 179 CSRLFILPNETIVYPGHGAPTTIGIEKAENPFFR 212


>gi|260437935|ref|ZP_05791751.1| metallo-beta-lactamase family protein [Butyrivibrio crossotus DSM
           2876]
 gi|292809686|gb|EFF68891.1| metallo-beta-lactamase family protein [Butyrivibrio crossotus DSM
           2876]
          Length = 209

 Score =  159 bits (403), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 61/210 (29%), Positives = 100/210 (47%), Gaps = 2/210 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +      +     N  +++D+E+   +++DP GD   I + +     +V+ I ITHGH D
Sbjct: 2   IKIEHNIIGMCATNTYYVYDDETKRGLIIDPAGDPVRIIERVARLQINVEGILITHGHFD 61

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HV    +++E  ++     + + A +     E           R  S+D +L+DG+    
Sbjct: 62  HVLALDEVRERFNVKAYIGNTEKAVLED--PEANLTSGFMGEGRTFSADVYLKDGEEFEA 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    K F  PGH+ G + Y   +      GDTLF  S+GR+D   G    LI SI  K+
Sbjct: 120 GGFRIKAFEVPGHTIGGMCYYFMDEGVLFSGDTLFCESVGRSDFKGGSTFALIASIKEKL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
             L D++    GH   +TIG E++ NPF++
Sbjct: 180 YTLPDDVKVYPGHSEATTIGHEKKYNPFVR 209


>gi|253568082|ref|ZP_04845493.1| conserved hypothetical protein [Bacteroides sp. 1_1_6]
 gi|298387714|ref|ZP_06997265.1| metallo-beta-lactamase family protein [Bacteroides sp. 1_1_14]
 gi|251842155|gb|EES70235.1| conserved hypothetical protein [Bacteroides sp. 1_1_6]
 gi|298259570|gb|EFI02443.1| metallo-beta-lactamase family protein [Bacteroides sp. 1_1_14]
          Length = 212

 Score =  159 bits (403), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 67/214 (31%), Positives = 110/214 (51%), Gaps = 6/214 (2%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGG----DLDIIKDVIQSRNFHVKQIWITH 59
           +     +   F  NC  L+D ++ EAVV+DPG     +   +K  I +    VK +  TH
Sbjct: 1   MKIKRFEFNMFPVNCYVLWD-DTKEAVVIDPGCFYEEEKQALKKFILTNELTVKHLLNTH 59

Query: 60  GHVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGD 119
            H+DH+ G   + ++  L+    +K D   + +  +Q+R+   ++        ++L DGD
Sbjct: 60  LHLDHIFGNPFMLKEFGLSAEA-NKADEFWIDEAPKQSRMFGFQLQEEPVPLGKYLHDGD 118

Query: 120 TLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSI 179
            +  G    +  H PGHSPG ++Y   E N    GD LF+ SIGR D+  G++ +LI+ I
Sbjct: 119 IITFGHTKLEAIHVPGHSPGSLVYYCKEENCMFSGDVLFQGSIGRADLSGGNFDELIDHI 178

Query: 180 NNKILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
            +++  L +E     GHG  +TIG E+  NPF +
Sbjct: 179 CSRLFVLPNETVVYPGHGAPTTIGMEKAENPFFR 212


>gi|269126354|ref|YP_003299724.1| beta-lactamase domain-containing protein [Thermomonospora curvata
           DSM 43183]
 gi|268311312|gb|ACY97686.1| beta-lactamase domain protein [Thermomonospora curvata DSM 43183]
          Length = 231

 Score =  159 bits (403), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 71/221 (32%), Positives = 98/221 (44%), Gaps = 11/221 (4%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDI-IKDVIQSRNFHVKQIWITHGHV 62
           +         F  NC  +      E V++DPG D +  I++VI+        +  THGH+
Sbjct: 1   MLVAGFPAGSFAANCYLVAPAAGEECVIIDPGQDAEAGIEEVIREHRLKPVAVIATHGHL 60

Query: 63  DHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDE-----QARLLSIRMNARNASSDRWLQD 117
           DH+   A +     +     H  D  ++    +       + L   +        R L D
Sbjct: 61  DHIWSVAPVCGAKDIP-AYIHPADRDLLTDPAKGLSLGPGQQLFGGLKLSEPDDVRELSD 119

Query: 118 GDTLLLGTHIFKVFHCPGHSPGHVIYVNFENNFA----HLGDTLFRSSIGRTDILHGDYQ 173
           G  L L    F V H PGH+PG V +   E          GD LF  SIGRTD+  G Y+
Sbjct: 120 GMVLELAGLRFTVNHAPGHTPGSVTFRTPETGDMPEVLFTGDLLFAGSIGRTDLPGGSYE 179

Query: 174 QLINSINNKILPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           Q++ S+    LPL DE   + GHGP +TIGRER  NPFL  
Sbjct: 180 QILQSLARVCLPLADETIVLPGHGPQTTIGRERATNPFLAD 220


>gi|298246072|ref|ZP_06969878.1| beta-lactamase domain protein [Ktedonobacter racemifer DSM 44963]
 gi|297553553|gb|EFH87418.1| beta-lactamase domain protein [Ktedonobacter racemifer DSM 44963]
          Length = 220

 Score =  159 bits (403), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 65/207 (31%), Positives = 101/207 (48%), Gaps = 3/207 (1%)

Query: 6   FHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHV 65
              + V   ++NC      ++ EAV++DPG +   I + I+      K I  THGH DH 
Sbjct: 13  VACITVGMLEENCYLYACPQTREAVIIDPGDEAPRILEAIKELQIVPKYIINTHGHFDHT 72

Query: 66  GGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGT 125
           G   ++     + +   H  D  M    ++ ++  +++        D  L++GD   +GT
Sbjct: 73  GAIDEVSAVYPVPL-AIHPADVYMYTD-EQISKRYNLKHPLVEREPDILLKEGDRFTIGT 130

Query: 126 HIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILP 185
              +V   PGHS    + +  +      GDTLF   IGRTD+  GDY+QLI SI NK+  
Sbjct: 131 LTLEVIETPGHS-RGGVCLISQPYCVFSGDTLFYRGIGRTDLEGGDYEQLIQSIRNKLYT 189

Query: 186 LGDEISFVCGHGPNSTIGRERRLNPFL 212
           L +++    GHG  STI  E+  NPF+
Sbjct: 190 LTEDLFVFPGHGEPSTIEEEKHENPFV 216


>gi|28211804|ref|NP_782748.1| hydroxyacylglutathione hydrolase [Clostridium tetani E88]
 gi|28204246|gb|AAO36685.1| hydroxyacylglutathione hydrolase [Clostridium tetani E88]
          Length = 201

 Score =  159 bits (403), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 67/209 (32%), Positives = 109/209 (52%), Gaps = 8/209 (3%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +    + V  ++ NC  L D++S E ++VDPG + ++I   +   +  VK I +THGHVD
Sbjct: 1   MELKRIPVGMYQANCYILMDKKSKEGIIVDPGDEANLILQTVNKMDCKVKYILLTHGHVD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HV    ++K+ L   +    KD+ +++  +D          +    ++D  +++GDT  +
Sbjct: 61  HVSAVKEVKDSLKAPVGINEKDEESILKGMD------LFGNSQTCGAADIKIKEGDTFKI 114

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    K    PGHS           N    GDTLF  SIGRTD   G+++ LI +I  KI
Sbjct: 115 GDKEIKCIETPGHS--LGGMCFLIENIIFTGDTLFEGSIGRTDFYGGNFEILIKNIKEKI 172

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           L + ++   + GHG  +T+G+E+  NPFL
Sbjct: 173 LTIPEDTLVLPGHGMETTVGKEKISNPFL 201


>gi|284048849|ref|YP_003399188.1| beta-lactamase domain-containing protein [Acidaminococcus
           fermentans DSM 20731]
 gi|283953070|gb|ADB47873.1| beta-lactamase domain-containing protein [Acidaminococcus
           fermentans DSM 20731]
          Length = 207

 Score =  159 bits (403), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 64/211 (30%), Positives = 105/211 (49%), Gaps = 5/211 (2%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNF-HVKQIWITHGHV 62
           +  + V V P ++NC  + +E + + ++VDPG + + I D +       V  I+ITHGH 
Sbjct: 1   MKIYRVVVGPIQENCYIIKNEANNQGIIVDPGDEANRIMDAVAKAGIEKVPAIFITHGHG 60

Query: 63  DHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLL 122
           DHV    ++K      +    +D   +  +V   +   S   + +    D +  DG+ L 
Sbjct: 61  DHVSALDEVKAATCAKVYMSREDAPML--RVWNSSLSYSTNRDKKFDPPDEYFTDGEKLN 118

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
           +    F +   PGH+          +     GDT+F  SIGRTD+  G Y  +++SI  K
Sbjct: 119 VAGMDFTIAATPGHT--AGGVCIIGDGVVFCGDTVFLESIGRTDLPGGSYDAILDSIKTK 176

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           +L L D+   + GHGP +T+G E+R NPFL+
Sbjct: 177 LLVLPDDYKLLPGHGPATTVGWEKRRNPFLQ 207


>gi|111023855|ref|YP_706827.1| hydrolase [Rhodococcus jostii RHA1]
 gi|110823385|gb|ABG98669.1| possible hydrolase [Rhodococcus jostii RHA1]
          Length = 235

 Score =  159 bits (402), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 68/215 (31%), Positives = 103/215 (47%), Gaps = 12/215 (5%)

Query: 9   VQVTPFKQNCTFLFDEESLEAVVVDPGGDL-DIIKDVIQSRNFHVKQIWITHGHVDHVGG 67
                F+ NC  L  +++ E VVVDPG D  + + + ++  N     + +THGH+DHV  
Sbjct: 15  FPAGMFQTNCYILAQDDAQECVVVDPGQDAAEPLFEFLEQSNLTPTAVLLTHGHLDHVWN 74

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDE----QARLLSIRMNARNASSDRWLQDGDTLLL 123
           A  + E   +     H +D  M+           +     M          L DGD +  
Sbjct: 75  AYDVCEKFGIP-AYIHPEDRYMLSDPGRGIGPTMKPFIEGMTFVEPGEVIALADGDVIEQ 133

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLG------DTLFRSSIGRTDILHGDYQQLIN 177
               F V H PGH+ G V++                 DTLF+ SIGR+D+  G+++QL+ 
Sbjct: 134 AGMSFAVDHTPGHTQGSVVFRTRVATENGPVEIALTGDTLFQGSIGRSDLPGGNHEQLLQ 193

Query: 178 SINNKILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           SI +K+L L D+ + + GHG +ST+G ER  NPFL
Sbjct: 194 SIADKLLILADDTAVLPGHGGSSTVGAERGSNPFL 228


>gi|325290216|ref|YP_004266397.1| beta-lactamase domain protein [Syntrophobotulus glycolicus DSM
           8271]
 gi|324965617|gb|ADY56396.1| beta-lactamase domain protein [Syntrophobotulus glycolicus DSM
           8271]
          Length = 213

 Score =  159 bits (402), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 70/210 (33%), Positives = 104/210 (49%), Gaps = 3/210 (1%)

Query: 6   FHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHV 65
              ++      NC  +   E+ +A++VDPG   + I + I  +N  V  I +THGH DH+
Sbjct: 2   IEGIKTPGMGTNCYLVSCPETKKALLVDPGAGAEGILEWISQKNVEVIGILLTHGHYDHI 61

Query: 66  GGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGT 125
           G   ++++ L + +   H+DDA M+    +       R       +D  LQ+ D L +G 
Sbjct: 62  GALEEVRDALKVKVY-IHRDDAPMLADPQKNLSAYGGRNIRVEKGADVLLQENDVLEIGQ 120

Query: 126 HIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILP 185
             + V H PGH+P          +    GDTLF  SIGRTD   G    ++NSIN K++ 
Sbjct: 121 LTYTVLHTPGHTP--GCICLLGPDGLLSGDTLFCRSIGRTDFPGGSMLNILNSINGKLML 178

Query: 186 LGDEISFVCGHGPNSTIGRERRLNPFLKSN 215
           L DE     GH   +TIG ERR NP+L  +
Sbjct: 179 LRDETKVFPGHESTTTIGEERRYNPYLNGD 208


>gi|160936540|ref|ZP_02083907.1| hypothetical protein CLOBOL_01430 [Clostridium bolteae ATCC
           BAA-613]
 gi|158440331|gb|EDP18076.1| hypothetical protein CLOBOL_01430 [Clostridium bolteae ATCC
           BAA-613]
          Length = 228

 Score =  159 bits (402), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 57/218 (26%), Positives = 96/218 (44%), Gaps = 4/218 (1%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           MS +      +     NC  ++D+++ E VV+DP  +   I +        +  + +THG
Sbjct: 1   MSDIRIKTCVLGQVSTNCYLVYDDQTKEGVVIDPADNAPYILNKCSELGITLTAVLLTHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H DH+     +     + +     ++  +                  +  +D  L DG  
Sbjct: 61  HFDHIMAVPDVIRAFRVKLYAYEAEENMLADTKLNMTGGFRGPQ--TSLHADVLLHDGQE 118

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           L L    +KV   PGH+ G   +   +      GDTLFR S GRTD+  G+  ++++SI 
Sbjct: 119 LELLGTRWKVLFTPGHTAGSCCFYLPDEGIIFAGDTLFRGSYGRTDLATGNTIRIVSSIV 178

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFL--KSNI 216
           + +  L D+     GHG  +TIG E++ NP L  + NI
Sbjct: 179 DVLFALPDDTMVYTGHGDPTTIGFEKQGNPVLTVRDNI 216


>gi|77919608|ref|YP_357423.1| hypothetical protein Pcar_2012 [Pelobacter carbinolicus DSM 2380]
 gi|77545691|gb|ABA89253.1| conserved hypothetical protein [Pelobacter carbinolicus DSM 2380]
          Length = 213

 Score =  159 bits (402), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 70/213 (32%), Positives = 105/213 (49%), Gaps = 3/213 (1%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M+ L    +       NC  L   ++ +AVV+DPGG+   I   ++ + F +K +  THG
Sbjct: 1   MTDLWQAHMVTGELGVNCYLLGCPKTRQAVVIDPGGNGSSILAELEKQGFELKAVINTHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H DH+GG   L +     +   H +   ++      A     R    +    R LQDGD 
Sbjct: 61  HFDHIGGNKTLIDQTGADL-LLHAEALPLLRGASSHAASFGCRAIDPSPEPTRLLQDGDR 119

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           + +G+ + +V H PGHSPG              GD LF  SIGRTD+  GD+  L+  + 
Sbjct: 120 IEVGSIVLEVLHVPGHSPGS--VCLKCGEALFAGDVLFAGSIGRTDLPGGDHHLLLKGLQ 177

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           +++L L D +    GHGP +TIG ER+ NP+L 
Sbjct: 178 SRVLTLADSVKVYPGHGPATTIGHERKNNPYLN 210


>gi|291545649|emb|CBL18757.1| Zn-dependent hydrolases, including glyoxylases [Ruminococcus sp.
           SR1/5]
          Length = 209

 Score =  159 bits (402), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 58/212 (27%), Positives = 97/212 (45%), Gaps = 3/212 (1%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           MSKL      +     NC FL ++E+ E ++VDPG   + +   +         I +THG
Sbjct: 1   MSKLEMQQCVLGQVFTNCYFLKNKETGELLIVDPGDYAEKVFQKVSLMQGKPVGILLTHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H DH+    ++KE   + +    +++A +         +     + +    D  L DG  
Sbjct: 61  HFDHIMAVKEVKEKYQIPVYACRQEEAMLAEPTINMTAVYGSACSIK---PDVLLDDGQI 117

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
                   ++FH PGH+ G   Y   +      GDTLF  S+GRTD   G   +++ S++
Sbjct: 118 FEAAGFSIQMFHTPGHTKGSCCYYIKDEGVLFSGDTLFCGSVGRTDFPGGSSAEIVRSLH 177

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
             +  L ++     GH  ++TIG E+R NPF+
Sbjct: 178 KLVDTLPEDTEVFPGHDASTTIGYEKRYNPFV 209


>gi|326390130|ref|ZP_08211691.1| beta-lactamase domain-containing protein [Thermoanaerobacter
           ethanolicus JW 200]
 gi|325993778|gb|EGD52209.1| beta-lactamase domain-containing protein [Thermoanaerobacter
           ethanolicus JW 200]
          Length = 210

 Score =  159 bits (402), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 76/211 (36%), Positives = 115/211 (54%), Gaps = 4/211 (1%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +      V  +  NC  + DEE  EA+V+DPG     I+D I + N +VK I +THGH D
Sbjct: 1   MKIQRYMVGLYGANCYIVSDEEEREAIVIDPGEYSSEIQDYIITNNLNVKYILLTHGHFD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+GG  +LK+     +    +D   ++      + ++  ++      +D  L DGDTL  
Sbjct: 61  HIGGVEELKKLTQARVAISKEDAPMLLDPSLNLSEMVYKKILCNP--ADILLSDGDTLTF 118

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G +  +V + PGH+          NN    GD LF+ SIGR D   GD+  L++SI NK+
Sbjct: 119 GKYSVEVIYTPGHT--KGGVCFKINNVCFTGDILFKGSIGRYDFPGGDFSTLMDSIKNKL 176

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           L LG++++   GHG +STIG+E+RLN FL+ 
Sbjct: 177 LVLGNDVTIYPGHGDSSTIGKEKRLNMFLRD 207


>gi|294794003|ref|ZP_06759140.1| metallo-beta-lactamase family protein [Veillonella sp. 3_1_44]
 gi|294455573|gb|EFG23945.1| metallo-beta-lactamase family protein [Veillonella sp. 3_1_44]
          Length = 211

 Score =  159 bits (402), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 63/214 (29%), Positives = 101/214 (47%), Gaps = 7/214 (3%)

Query: 1   MSK--LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWIT 58
           MS+  L    + + P   NC  + D+   EA ++DP      + D ++  +   K + +T
Sbjct: 1   MSEQQLVLMRMPLGPLGTNCYVIGDKAIGEAFIIDPA--TAEVLDALKKHDLKPKAVVLT 58

Query: 59  HGHVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDG 118
           HGH DH+GG  ++     + +   HK D   +   +      S        +    ++ G
Sbjct: 59  HGHGDHIGGIQEIVNIYHVPVY-IHKGDVPYLSDPELNLSAYSNPTPIMVKAEIIEVKQG 117

Query: 119 DTLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINS 178
           D +  G    +V   PGH+PG      +      +GDTLFR S+GRTD  +G Y+ LI+S
Sbjct: 118 DHITCGDIDLEVLETPGHTPGG--VCYYMEGLVFVGDTLFRDSVGRTDFPNGSYETLISS 175

Query: 179 INNKILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           I  ++  L D      GHGP + IG E++ NPF+
Sbjct: 176 IKTQLYTLPDNTMVYPGHGPETNIGYEKQYNPFV 209


>gi|260589629|ref|ZP_05855542.1| metallo-beta-lactamase family protein [Blautia hansenii DSM 20583]
 gi|331083061|ref|ZP_08332178.1| hypothetical protein HMPREF0992_01102 [Lachnospiraceae bacterium
           6_1_63FAA]
 gi|260539869|gb|EEX20438.1| metallo-beta-lactamase family protein [Blautia hansenii DSM 20583]
 gi|330405063|gb|EGG84600.1| hypothetical protein HMPREF0992_01102 [Lachnospiraceae bacterium
           6_1_63FAA]
          Length = 210

 Score =  159 bits (402), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 56/212 (26%), Positives = 91/212 (42%), Gaps = 2/212 (0%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M KL    + V P + NC FL +EE+ E ++VDPG + + I   +         I +THG
Sbjct: 1   MKKLMLRGIVVGPVQTNCYFLKNEETQEILIVDPGAEQERIIYALDKLQGKPVGILLTHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H DHV    +L+E   + +    +++  +       +   S       A +   L+D + 
Sbjct: 61  HYDHVCAVNELREHYKIPVYAAKEEEPLLADSQQNLSAAWSGVPYKVKADA--LLEDEEE 118

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           +            PGH+ G   Y   +      GDT+F  S GR D+  G   ++  S+N
Sbjct: 119 IQAAGFEITTILTPGHTSGSCCYWIKDEEVCFSGDTVFYGSCGRCDLPTGSMSEMKKSLN 178

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
                L D+     GHG  +    E++ NP+L
Sbjct: 179 KIFAMLPDKTVIYPGHGEATDAEFEKKNNPYL 210


>gi|294668357|ref|ZP_06733460.1| hypothetical protein NEIELOOT_00269 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
 gi|291309675|gb|EFE50918.1| hypothetical protein NEIELOOT_00269 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
          Length = 211

 Score =  159 bits (401), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 81/213 (38%), Positives = 128/213 (60%), Gaps = 3/213 (1%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           MS L   I+ VT F+QNCT ++D+E+ EAV  D GG++  + +  + R  HVK IW+THG
Sbjct: 1   MS-LHVEIIAVTLFRQNCTLMWDDETNEAVFTDVGGNVPRLLEEAEKRGLHVKAIWLTHG 59

Query: 61  HVDHVGGAAQLKEDLS-LTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGD 119
           H+DH+GG A++      + ++GPH+ D  ++  + E  +  +     +     RWL++GD
Sbjct: 60  HLDHIGGVAEMTAGNPKIEVLGPHEADRFLLANLTEITKQYNFPP-TKPFIPTRWLEEGD 118

Query: 120 TLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSI 179
            L +G + FKV H PGH+PGH+++   E +    GD +F  S+GRTD    ++  LI +I
Sbjct: 119 ELKVGQYAFKVLHIPGHTPGHIVFYCAEADLLVAGDVIFYESVGRTDFERSNHDDLIRNI 178

Query: 180 NNKILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
             KI  L ++   V GHG  +T+G E++ NP+L
Sbjct: 179 REKIFTLPEDTQIVTGHGRMTTVGYEKQHNPYL 211


>gi|225568637|ref|ZP_03777662.1| hypothetical protein CLOHYLEM_04715 [Clostridium hylemonae DSM
           15053]
 gi|225162565|gb|EEG75184.1| hypothetical protein CLOHYLEM_04715 [Clostridium hylemonae DSM
           15053]
          Length = 211

 Score =  159 bits (401), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 61/209 (29%), Positives = 95/209 (45%), Gaps = 3/209 (1%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +            NC    +EE+ +  V+DP      +   I+S    ++ + +THGH D
Sbjct: 6   MKVEKFVTGIISTNCYLAVNEETRQTAVIDPAACPSYLMGHIKSEGLKIEAVLLTHGHFD 65

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+ G     ++  + +   H+DD  ++         +          S  +++D +TL  
Sbjct: 66  HIMGLDGFLKEYDVPVY-LHRDDEQLIKDPGLNQSGVYTSGYT--FGSATYIEDNETLKT 122

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
               FKV H PGH+PG V Y          GDTLF+SS+GRTD   G    L+  I  K+
Sbjct: 123 AGFEFKVLHTPGHTPGGVCYYAEAEKVLFSGDTLFQSSVGRTDFPLGSMSDLVRGIREKL 182

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           + L D++    GH   +TIG E+  NPFL
Sbjct: 183 MVLPDDVLVYPGHMGETTIGYEKSHNPFL 211


>gi|94265075|ref|ZP_01288842.1| Beta-lactamase-like [delta proteobacterium MLMS-1]
 gi|93454454|gb|EAT04745.1| Beta-lactamase-like [delta proteobacterium MLMS-1]
          Length = 213

 Score =  159 bits (401), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 80/212 (37%), Positives = 106/212 (50%), Gaps = 7/212 (3%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +    + V      C  L  EES + + +DPGGD D I +  ++    +K +  THGH D
Sbjct: 1   MRLEQLVVGEMGVCCYLLGCEESGQVLAIDPGGDEDKILEHCRAAGLELKMLLCTHGHPD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HV G A LK+     II  H DDAA   K + Q     + + A     DR L+DGDT++L
Sbjct: 61  HVCGNAVLKKATGAEIIM-HGDDAAFFAKPEIQHYFSMLGLPASPP-PDRLLRDGDTVVL 118

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           GT   +V H PGH+P       +       GDTLF   +GRTD   GD   L+NS+  ++
Sbjct: 119 GTIELQVIHTPGHTP--GGICLYTAPHLFTGDTLFVGGVGRTDFPGGDTATLVNSLQQRL 176

Query: 184 LPLGDEISFVCGHGPN---STIGRERRLNPFL 212
           L L  E     GHG     STIG E R NP+L
Sbjct: 177 LKLPPETVVWPGHGYGGARSTIGEEARDNPYL 208


>gi|167762774|ref|ZP_02434901.1| hypothetical protein BACSTE_01132 [Bacteroides stercoris ATCC
           43183]
 gi|167699114|gb|EDS15693.1| hypothetical protein BACSTE_01132 [Bacteroides stercoris ATCC
           43183]
          Length = 212

 Score =  158 bits (400), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 67/214 (31%), Positives = 108/214 (50%), Gaps = 6/214 (2%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGG----DLDIIKDVIQSRNFHVKQIWITH 59
           +     +   F +NC  L+DE +LEAVV+DPG     +   +K+ I S    VK +  TH
Sbjct: 1   MKIKRFEFNMFPENCYVLWDE-TLEAVVIDPGCFYEEEKQALKNFIISNGLQVKHLLNTH 59

Query: 60  GHVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGD 119
            H+DH+ G   + ++  L     ++ D   + +  +Q+R+   ++         +L DGD
Sbjct: 60  LHLDHIFGNPFMLKEFGLKAEA-NQADEFWIDEAPKQSRMFGFQLPEPPVPLGTYLHDGD 118

Query: 120 TLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSI 179
            +  G    +  H PGHSPG ++Y     +    GD LF+ SIGR D+  G++ +LI  I
Sbjct: 119 IITFGHTELEAIHVPGHSPGSLVYYCAAEHCMFSGDVLFQGSIGRADLAGGNFDELIEHI 178

Query: 180 NNKILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
            +++  L  E     GHG  +TIG E+  NPF +
Sbjct: 179 CSRLFILPSETVVYPGHGAPTTIGTEKAENPFFR 212


>gi|295108480|emb|CBL22433.1| Zn-dependent hydrolases, including glyoxylases [Ruminococcus obeum
           A2-162]
          Length = 209

 Score =  158 bits (400), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 61/212 (28%), Positives = 102/212 (48%), Gaps = 3/212 (1%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           MS+L      V     NC FL ++E+ E +++DPG + + I+  I     +   I +THG
Sbjct: 1   MSRLDLQKCIVGSVFTNCYFLKNKETGEMLIIDPGDNAEKIEQKILEMQGNPVAILLTHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H DH+  A  +++   + I    K++  +    D +  L +  MN+    +D +L D   
Sbjct: 61  HFDHILAAEAIRDRYQIPIYASQKEEKTLQ---DPKINLTAYHMNSYTLKADVYLTDLQV 117

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
             L     ++   PGH+ G   Y   +      GDT+F  S+GRTD   G    ++ S++
Sbjct: 118 ARLAGFSVQMIETPGHTVGSCCYYLKDEGVLFSGDTVFCGSVGRTDFPEGSTAAIVESLH 177

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
             +  L D+     GH  ++TIG E+R NPF+
Sbjct: 178 RLLDALPDDTEVYPGHDASTTIGYEKRYNPFV 209


>gi|153806709|ref|ZP_01959377.1| hypothetical protein BACCAC_00980 [Bacteroides caccae ATCC 43185]
 gi|149131386|gb|EDM22592.1| hypothetical protein BACCAC_00980 [Bacteroides caccae ATCC 43185]
          Length = 212

 Score =  158 bits (400), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 67/214 (31%), Positives = 113/214 (52%), Gaps = 6/214 (2%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGG----DLDIIKDVIQSRNFHVKQIWITH 59
           +     +   F  NC  L+D ++ EAVV+DPG     +   +K  I +   +VK +  TH
Sbjct: 1   MKIKRFEFNMFPVNCYVLWD-DTKEAVVIDPGCFYEEEKQALKKFILTNELNVKHLLNTH 59

Query: 60  GHVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGD 119
            H+DH+ G   + ++  L+    +K D   + +  +Q+R+   ++  +     ++L DGD
Sbjct: 60  LHLDHIFGNPFMLKEFGLSAEA-NKADEYWIDEAPKQSRMFGFQLQEKPVPLGKYLHDGD 118

Query: 120 TLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSI 179
           ++  G    +  H PGHSPG ++Y   E+N    GD LF+ SIGR D+  G++ +LI  I
Sbjct: 119 SITFGHTTLEAIHVPGHSPGSLVYYCKEDNCMFSGDVLFQGSIGRADLTGGNFDELIEHI 178

Query: 180 NNKILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
            +++  L +E     GHG  +TIG E+  NPF +
Sbjct: 179 CSRLFVLPNETVVYPGHGAPTTIGMEKAENPFFR 212


>gi|289548991|ref|YP_003473979.1| beta-lactamase [Thermocrinis albus DSM 14484]
 gi|289182608|gb|ADC89852.1| beta-lactamase domain protein [Thermocrinis albus DSM 14484]
          Length = 212

 Score =  158 bits (400), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 67/210 (31%), Positives = 96/210 (45%), Gaps = 3/210 (1%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +   ++ V     NC+ L DEES E ++VDPG +  ++   ++        I  THGH+D
Sbjct: 1   MVIKVIPVGLLSVNCSLLVDEESGEVLLVDPGAESHLLMRELE--GLKPVGIVATHGHID 58

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG    LKE L +     H  D  +            I         D +L+DG  + L
Sbjct: 59  HVGQVKTLKELLDVP-FYMHPLDIPLSNDPIWPGFDKQIGAQLPCPPPDVYLEDGMRIKL 117

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    +V H PGH+PG       E      GD LF+ S+GR D+  GD   L  S+   +
Sbjct: 118 GKKTLRVLHTPGHTPGLCCLYAEEEGVLIAGDLLFKGSVGRWDLPGGDLNALRRSLRRVL 177

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
             L D+   VCGH   +T+G E+  NP L+
Sbjct: 178 EELPDDTLVVCGHYDETTLGHEKVFNPLLR 207


>gi|253682453|ref|ZP_04863250.1| metallo-beta-lactamase family protein [Clostridium botulinum D str.
           1873]
 gi|253562165|gb|EES91617.1| metallo-beta-lactamase family protein [Clostridium botulinum D str.
           1873]
          Length = 201

 Score =  158 bits (400), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 73/209 (34%), Positives = 107/209 (51%), Gaps = 8/209 (3%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +    +    +  NC  L DEE++   ++DPGGD D + ++I   N  +K I +THGH+D
Sbjct: 1   MKIKRIPAGMYGANCYILIDEETMVGCIIDPGGDADRLANIIDELNIEIKFILLTHGHMD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVGG   L+E  ++ +    KD   M        R+       +       L+D + + L
Sbjct: 61  HVGGVEVLREKYNVPVYINGKDKELMEKGTQVFGRIWGKTPEDKE------LKDEEIIKL 114

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G+   +    PGH+PG + +    NN    GDTLF  S+GR D+  G+  QLI SI NK+
Sbjct: 115 GSLDIRCIETPGHTPGGMSF--LVNNVVFTGDTLFHGSVGRCDLPGGNQSQLIESIKNKL 172

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           + L DEI  + GH   S I  ER+ NPFL
Sbjct: 173 MVLDDEIVVLPGHEGESNIKFERQYNPFL 201


>gi|224024051|ref|ZP_03642417.1| hypothetical protein BACCOPRO_00768 [Bacteroides coprophilus DSM
           18228]
 gi|224017273|gb|EEF75285.1| hypothetical protein BACCOPRO_00768 [Bacteroides coprophilus DSM
           18228]
          Length = 212

 Score =  158 bits (400), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 62/214 (28%), Positives = 106/214 (49%), Gaps = 6/214 (2%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGG----DLDIIKDVIQSRNFHVKQIWITH 59
           ++    +   F  NC  L+D ++ EA+V+D G     +   +KD + +    +K +  TH
Sbjct: 1   MNIKRFEFNMFPVNCYVLWD-DTKEAIVIDAGCYYPEEQQRLKDFLVNNGLQLKHLLNTH 59

Query: 60  GHVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGD 119
            H+DH+ G A ++ +  +     +++D   + K     R+   ++N   A    ++ DGD
Sbjct: 60  LHLDHIFGNAFMEREFGIKPEA-NQEDEFWLAKAAGHCRMFGFQINESPAPLGGYICDGD 118

Query: 120 TLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSI 179
            +  G    +  H PGHSPG +++     N    GD LF+ SIGRTD+  GD++ L   I
Sbjct: 119 VIRFGNTNLEAIHVPGHSPGSLVFYCRAANCLFSGDALFKGSIGRTDLEGGDFETLREHI 178

Query: 180 NNKILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
            + +  L  E     GHG  ++IG E+  NPF +
Sbjct: 179 CSNLFSLPAETVVYPGHGEPTSIGAEKMTNPFFR 212


>gi|94268959|ref|ZP_01291335.1| Beta-lactamase-like [delta proteobacterium MLMS-1]
 gi|93451399|gb|EAT02253.1| Beta-lactamase-like [delta proteobacterium MLMS-1]
          Length = 213

 Score =  158 bits (400), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 81/212 (38%), Positives = 107/212 (50%), Gaps = 7/212 (3%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +    + V      C  L  EES + + +DPGGD D I +  ++    +K +  THGH D
Sbjct: 1   MRLEQLVVGEMGVCCYLLGCEESGQVLAIDPGGDEDKILEHCRAAGLELKMLLCTHGHPD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HV G A LK++    II  H DDAA   K + Q     + + A     DR LQDGDT++L
Sbjct: 61  HVCGNAVLKKETGAEIIM-HGDDAAFFAKPEIQHYFSMLGLPASPP-PDRLLQDGDTVVL 118

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           GT   +V H PGH+P       +       GDTLF   +GRTD   GD   L+NS+  ++
Sbjct: 119 GTIELQVIHTPGHTP--GGICLYTAPHLFTGDTLFVGGVGRTDFPGGDTATLVNSLQQRL 176

Query: 184 LPLGDEISFVCGHGPN---STIGRERRLNPFL 212
           L L  E     GHG     STIG E R NP+L
Sbjct: 177 LKLPPETVVWPGHGYGGARSTIGEEARDNPYL 208


>gi|303229374|ref|ZP_07316164.1| metallo-beta-lactamase domain protein [Veillonella atypica
           ACS-134-V-Col7a]
 gi|302515910|gb|EFL57862.1| metallo-beta-lactamase domain protein [Veillonella atypica
           ACS-134-V-Col7a]
          Length = 211

 Score =  158 bits (400), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 63/211 (29%), Positives = 98/211 (46%), Gaps = 5/211 (2%)

Query: 2   SKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGH 61
           S L    + + P   NC  + D+E  +A ++DP      + D ++  N   K + +THGH
Sbjct: 4   SNLVLMRMPLGPLGTNCYVIGDKEQGKAFIIDPATI--EVLDALKKHNLKPKAVLLTHGH 61

Query: 62  VDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
            DH+GG   + +   + I   H +D   +   +      S             + +GD +
Sbjct: 62  GDHIGGVQGIVDAYDVPIYIHH-NDVKYLSDPELNLSNYSNPSPITVKGRIIEVHEGDHI 120

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
             G     V+  PGH+PG      +      +GDTLF  S+GRTD + GDY  LI++I  
Sbjct: 121 TYGAIDLTVYETPGHTPGG--VCYYMPGLVFVGDTLFNQSVGRTDFVEGDYDALIDAIKT 178

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           K+  L D      GHGP + IG E++ NPF+
Sbjct: 179 KLYTLPDNTMVYPGHGPETQIGYEKQYNPFV 209


>gi|282850509|ref|ZP_06259888.1| metallo-beta-lactamase domain protein [Veillonella parvula ATCC
           17745]
 gi|282580002|gb|EFB85406.1| metallo-beta-lactamase domain protein [Veillonella parvula ATCC
           17745]
          Length = 211

 Score =  158 bits (400), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 63/214 (29%), Positives = 102/214 (47%), Gaps = 7/214 (3%)

Query: 1   MSK--LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWIT 58
           MS+  L    + + P   NC  + D+   EA ++DP      + D ++  +   K + +T
Sbjct: 1   MSEQQLVLMRMPLGPLGTNCYVIGDKAIGEAFIIDPA--TAEVLDALKKHDLKPKAVVLT 58

Query: 59  HGHVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDG 118
           HGH DH+GG  ++     + +   HK D   +   +      S     +  +    ++ G
Sbjct: 59  HGHGDHIGGIQEIVNTYHVPVY-IHKGDVPYLSDPELNLSAYSNPTPIKVKAEIIEVKQG 117

Query: 119 DTLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINS 178
           D +  G    +V   PGH+PG      +      +GDTLFR S+GRTD  +G Y+ LI+S
Sbjct: 118 DHITCGDIDLEVLETPGHTPGG--VCYYMEGLVFVGDTLFRDSVGRTDFPNGSYEILISS 175

Query: 179 INNKILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           I  ++  L D      GHGP + IG E++ NPF+
Sbjct: 176 IKTQLYRLPDNTMVYPGHGPETNIGYEKQYNPFV 209


>gi|162454293|ref|YP_001616660.1| hypothetical protein sce6016 [Sorangium cellulosum 'So ce 56']
 gi|161164875|emb|CAN96180.1| unnamed protein product [Sorangium cellulosum 'So ce 56']
          Length = 217

 Score =  158 bits (400), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 82/211 (38%), Positives = 107/211 (50%), Gaps = 4/211 (1%)

Query: 6   FHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHV 65
                V P   NC+ L D  S  AVV+DPGGD D I+  ++     V  I  TH H+DHV
Sbjct: 9   LETFSVGPLGCNCSILVDPVSKGAVVIDPGGDFDEIRARVEQAGAKVAAIVHTHTHIDHV 68

Query: 66  GGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGT 125
           G  A L+          H+ D  +   +  QA +L I +  R       L DG  +  G 
Sbjct: 69  GATAPLQRWSGAAAR-IHEADRFLYDMLPVQAAMLGIALPERCEVDG-DLNDGAVVKAGG 126

Query: 126 HIFKVFHCPGHSPGHVIYVN--FENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
               V H PGH+PG V ++        A  GDTLFR SIGRTD+  GD + +++SI  K+
Sbjct: 127 LDLHVLHTPGHTPGSVSFLVLAETGAVAFTGDTLFRRSIGRTDLWGGDSRAIVSSIRGKL 186

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           L L      V GHGP++TIG ER  NPFL+S
Sbjct: 187 LTLDPSTRVVTGHGPSTTIGEERDRNPFLRS 217


>gi|307266553|ref|ZP_07548085.1| beta-lactamase domain-containing protein [Thermoanaerobacter
           wiegelii Rt8.B1]
 gi|306918407|gb|EFN48649.1| beta-lactamase domain-containing protein [Thermoanaerobacter
           wiegelii Rt8.B1]
          Length = 210

 Score =  158 bits (400), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 77/211 (36%), Positives = 115/211 (54%), Gaps = 4/211 (1%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +      V  +  NC  + DEE  EA+V+DPG     I+D I + N +VK I +THGH D
Sbjct: 1   MKIQRYMVGLYGANCYIVSDEEESEAIVIDPGEYSSEIQDYIITNNLNVKYILLTHGHFD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+GG  +LK+     +    +D   ++      + ++  R+      +D  L DGDTL  
Sbjct: 61  HIGGVEELKKLTQARVAISKEDAPMLLDPSLNLSEMVYKRILCNP--ADILLSDGDTLTF 118

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G +  +V + PGH+          NN    GD LF+ SIGR D   GD+  L++SI NK+
Sbjct: 119 GKYSVEVIYTPGHT--KGGVCFKINNVCFTGDILFKGSIGRYDFPGGDFSTLMDSIKNKL 176

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           L LG++++   GHG +STIG+E+RLN FL+ 
Sbjct: 177 LVLGNDVTIYPGHGDSSTIGKEKRLNMFLRD 207


>gi|330999269|ref|ZP_08322986.1| metallo-beta-lactamase domain protein [Parasutterella
           excrementihominis YIT 11859]
 gi|329575127|gb|EGG56678.1| metallo-beta-lactamase domain protein [Parasutterella
           excrementihominis YIT 11859]
          Length = 208

 Score =  158 bits (400), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 65/209 (31%), Positives = 96/209 (45%), Gaps = 5/209 (2%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +S  +  + P + NC  +  E   +AV +D GGD       ++     +K I ITH H D
Sbjct: 5   MSVAVFPLGPLETNCYLVSYE--GQAVAIDVGGDPAPGSKYLKEHGLELKAICITHMHFD 62

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+ G A L  +   T+  P KD       +    +  S    A        ++ G+    
Sbjct: 63  HLYGVAALAAETHATVYTPEKDKVIASTVLG---QGGSSGFPAVPKFESVSIEPGNKTEF 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
                KV   PGH+PG V Y   +     +GDTLF  SIGRTD     ++QL+ SI +++
Sbjct: 120 AGLECKVLSVPGHTPGSVAYYFKKEKCVFVGDTLFLESIGRTDFPFSSHEQLVTSIRSEL 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
             L D+     GHGP ++IG E+  N FL
Sbjct: 180 FSLPDDTIVYPGHGPGTSIGYEKEHNAFL 208


>gi|298528422|ref|ZP_07015826.1| beta-lactamase domain protein [Desulfonatronospira thiodismutans
           ASO3-1]
 gi|298512074|gb|EFI35976.1| beta-lactamase domain protein [Desulfonatronospira thiodismutans
           ASO3-1]
          Length = 210

 Score =  158 bits (400), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 62/212 (29%), Positives = 95/212 (44%), Gaps = 6/212 (2%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L      +   + NC  L  ++  EA+V+DPGGD   I D ++     +  I  TH H D
Sbjct: 2   LEIKTFPLGVLQTNCYVLHSQQ--EALVMDPGGDPQRIVDYLRDNGLSLAMILNTHLHFD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+ G A L E     I  P ++D  ++    E      +            L++G    L
Sbjct: 60  HIQGNAALAESSGAKIFAP-EEDRFLLD--TEVGGGGFMDFPETPGFDFEDLKEGKQ-EL 115

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
             H   V   PGH+PG + +   +     +GD LF+ ++GRTD   G  + L  S   KI
Sbjct: 116 LGHECTVLSTPGHTPGSLSFYFPDLKAVFVGDLLFQRAVGRTDFPGGSMEVLKKSAREKI 175

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSN 215
             L  +     GHGP ST+  E++ NPF +++
Sbjct: 176 FTLPGDTVIYSGHGPQSTVMDEKQNNPFFQNS 207


>gi|148546043|ref|YP_001266145.1| beta-lactamase domain-containing protein [Pseudomonas putida F1]
 gi|148510101|gb|ABQ76961.1| beta-lactamase domain protein [Pseudomonas putida F1]
          Length = 238

 Score =  158 bits (399), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 74/208 (35%), Positives = 109/208 (52%), Gaps = 4/208 (1%)

Query: 7   HIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVG 66
               V P + NCT + D  + +A+VVDPGGD+D I   +Q     +  I  TH H DH  
Sbjct: 35  ETFPVGPLQCNCTLIGDPLTKKAMVVDPGGDVDKILARLQVHGLTLVSIIHTHAHFDHFL 94

Query: 67  GAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTH 126
            + +LKE    T+   HKDD  +   ++ Q ++  +      A  DRWL D + L  G  
Sbjct: 95  ASGKLKELTGATLH-LHKDDQMLWDNLEMQCQMFGVPYTPVPA-PDRWLGDDEELACGC- 151

Query: 127 IFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPL 186
                H PGH+PG + +   +      GDTLFR  IGRTD+  GD + ++ SI  ++  L
Sbjct: 152 -GVALHTPGHTPGSMSFWFADAKLLIAGDTLFRRGIGRTDLWGGDQRAIVRSIKERLYRL 210

Query: 187 GDEISFVCGHGPNSTIGRERRLNPFLKS 214
            +E   V GHGP++ +G E R NPF+++
Sbjct: 211 DEEAIVVTGHGPDTRLGDEMRENPFVRA 238


>gi|56420974|ref|YP_148292.1| hypothetical protein GK2439 [Geobacillus kaustophilus HTA426]
 gi|56380816|dbj|BAD76724.1| hypothetical conserved protein [Geobacillus kaustophilus HTA426]
          Length = 210

 Score =  158 bits (399), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 62/211 (29%), Positives = 98/211 (46%), Gaps = 3/211 (1%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + +  + V P + N   L   +  + ++VDPG +   +   I+ +      I +TH H D
Sbjct: 1   MEWTRIPVGPIQANAYLLSSAD-RQCLIVDPGAEGAALVRRIEEKGLTPLAILLTHAHFD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+GG   +     + +    K+   +       +      +  R   +   L+    L +
Sbjct: 60  HIGGIPDVLARWDIPVYVHEKEKQWLQDPALNGSLYFGGPVAVRCEPTC--LKGPTVLNI 117

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V   PGHSPG V Y   + N    GD LF  SIGRTD+  G++QQL+ SI++++
Sbjct: 118 GPFALDVRETPGHSPGSVSYYCKQANIVFSGDALFAGSIGRTDLPGGNHQQLLKSIHDEL 177

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           L L +E   + GHGP +TI  E   NPFL  
Sbjct: 178 LTLPEETIVLSGHGPETTIAAEMDANPFLHG 208


>gi|197303673|ref|ZP_03168710.1| hypothetical protein RUMLAC_02400 [Ruminococcus lactaris ATCC
           29176]
 gi|197297193|gb|EDY31756.1| hypothetical protein RUMLAC_02400 [Ruminococcus lactaris ATCC
           29176]
          Length = 218

 Score =  158 bits (399), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 59/211 (27%), Positives = 95/211 (45%), Gaps = 3/211 (1%)

Query: 2   SKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGH 61
             +      + P + NC  + +E++ E   VD         D I+ + + +K +++THGH
Sbjct: 11  KNMKIERFVLGPIETNCYVVVNEDTKECFAVDMAYCPKAYVDHIREQGYQMKALFLTHGH 70

Query: 62  VDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
            DH+ G     +   + +    ++   +       + +         A +   L+DG T+
Sbjct: 71  FDHIMGIEDFLKAFDVPVYVGREEQPLLADDRLNASSMYGYHCAYTGAKA---LEDGQTV 127

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
                   V H PGH+ G   Y   E+     GDTLF  SIGRTD+  G  + L +SI  
Sbjct: 128 ECAGTEIHVIHTPGHTVGGCCYYLPEDEALFCGDTLFCGSIGRTDLPTGSSRDLAHSIRE 187

Query: 182 KILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           K++ L DE     GH   STIG E+ +NPF+
Sbjct: 188 KLMILPDETKLYPGHMDESTIGYEKEINPFI 218


>gi|114566346|ref|YP_753500.1| beta-lactamase-like protein [Syntrophomonas wolfei subsp. wolfei
           str. Goettingen]
 gi|114337281|gb|ABI68129.1| beta-lactamase-like protein [Syntrophomonas wolfei subsp. wolfei
           str. Goettingen]
          Length = 207

 Score =  158 bits (399), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 66/209 (31%), Positives = 99/209 (47%), Gaps = 3/209 (1%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +    ++++    NC  +  EE+ E  V+DPGG+   I ++++      + I  THGH+D
Sbjct: 1   MILKGLELSSMMVNCYIVGCEETKEVAVIDPGGNARAILNLLEEDGLKTQYIINTHGHID 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G    +K+     I   H++DA M+         +         +     +     + 
Sbjct: 61  HIGANQAIKDATDAKI-LIHENDAKMLVNPVSNFSFMMGSKVISPPADQLIQEGDIIKIG 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
            T   +V H PGHS           N   +GDTLF+ SIGRTD   G Y+QLI +I  K+
Sbjct: 120 NTVELEVIHTPGHS--QGGVCLKIGNIIFVGDTLFQGSIGRTDFPGGSYKQLIQNIKEKL 177

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           L   D+     GHGP +TIG ER  NPFL
Sbjct: 178 LRYDDDTICYPGHGPATTIGFERMHNPFL 206


>gi|226227392|ref|YP_002761498.1| hydrolase [Gemmatimonas aurantiaca T-27]
 gi|226090583|dbj|BAH39028.1| hydrolase [Gemmatimonas aurantiaca T-27]
          Length = 220

 Score =  158 bits (399), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 68/211 (32%), Positives = 105/211 (49%), Gaps = 5/211 (2%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L    + V P ++NC  L D  S +AV+VDPG +++ +   + +    ++ IW+TH H D
Sbjct: 8   LKVQQLTVGPLEENCWLLADPASGKAVLVDPGDEVERLLAAVDATGCTLEAIWLTHAHFD 67

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG  A L  +  + +   H  D  + G     +             +   L +G  + L
Sbjct: 68  HVGAVAPLLRERPVPVW-LHPLDLPLYGNA-ATSAARWGISIETPTGATEPLAEGSVVSL 125

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   F+V+H PGH+PGHV +    +     GD +F  SIGRTD+   D + +  S+  +I
Sbjct: 126 GRFQFEVWHVPGHAPGHVAF--LGHGLCISGDLVFAGSIGRTDLPLCDPRAMQASLM-RI 182

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
             L D    + GHG  +TIG+ER  NPFL+ 
Sbjct: 183 TTLDDGTRVLPGHGVTTTIGQERLSNPFLRG 213


>gi|86159897|ref|YP_466682.1| beta-lactamase-like protein [Anaeromyxobacter dehalogenans 2CP-C]
 gi|85776408|gb|ABC83245.1| Beta-lactamase-like protein [Anaeromyxobacter dehalogenans 2CP-C]
          Length = 218

 Score =  157 bits (398), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 71/203 (34%), Positives = 100/203 (49%), Gaps = 2/203 (0%)

Query: 10  QVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAA 69
            V PF  NC       + EAV+VDPG ++     +     + V +I+ THGH+DHVGG A
Sbjct: 8   VVGPFAANCWLAACGRTGEAVLVDPGAEVHRALALTGPSGWRVTRIFCTHGHIDHVGGGA 67

Query: 70  QLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFK 129
           + +      +   H  D A +  +  QA +               + DG+   +G    +
Sbjct: 68  EARAATGAPLQ-IHAADDAWLEALPRQAEMFGFDPVEAPEVDHHHV-DGEAFRVGDCEAQ 125

Query: 130 VFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDE 189
           V H PGHS G              GDTLF  S+GRTD+  GD++ L  SI  ++ PLGD 
Sbjct: 126 VIHTPGHSAGSCSLWFPGEQVLFTGDTLFAGSVGRTDLPGGDFEALERSIKERLFPLGDA 185

Query: 190 ISFVCGHGPNSTIGRERRLNPFL 212
           + F  GHGP+ T+G ERR NPF+
Sbjct: 186 VRFHPGHGPSGTLGEERRANPFV 208


>gi|238018955|ref|ZP_04599381.1| hypothetical protein VEIDISOL_00815 [Veillonella dispar ATCC 17748]
 gi|237864439|gb|EEP65729.1| hypothetical protein VEIDISOL_00815 [Veillonella dispar ATCC 17748]
          Length = 211

 Score =  157 bits (398), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 60/214 (28%), Positives = 101/214 (47%), Gaps = 7/214 (3%)

Query: 1   MSK--LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWIT 58
           MS+  L    + + P   NC  + D+   EA ++DP      + + ++  +   K + +T
Sbjct: 1   MSEQQLVLMRMPLGPLGTNCYVIGDKAVGEAFIIDPA--TPEVLESLKKHDLKPKAVLLT 58

Query: 59  HGHVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDG 118
           HGH DH+GG  ++ +   + +    K D   +   +      S     +  +    ++ G
Sbjct: 59  HGHGDHIGGVQEIVDTYHVPVY-IQKGDIPYLLDPELNLSAYSNPTPIKVKADIIEVKQG 117

Query: 119 DTLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINS 178
           D +  G    +V   PGH+PG      +      +GDTLFR S+GRTD  +G Y+ L+ S
Sbjct: 118 DHITCGAIDLEVLETPGHTPGG--VCYYMEGLVFVGDTLFRDSVGRTDFPNGSYETLMES 175

Query: 179 INNKILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           I  ++  L D      GHGP + IG E++ NPF+
Sbjct: 176 IKTQLYKLPDNTMVYPGHGPETNIGYEKQYNPFV 209


>gi|227871729|ref|ZP_03990138.1| possible hydroxyacylglutathione hydrolase [Oribacterium sinus
           F0268]
 gi|227842438|gb|EEJ52659.1| possible hydroxyacylglutathione hydrolase [Oribacterium sinus
           F0268]
          Length = 210

 Score =  157 bits (398), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 64/212 (30%), Positives = 100/212 (47%), Gaps = 7/212 (3%)

Query: 5   SFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDH 64
           +   + V     NC  ++++ + E V++DPG + + I   I     ++K I +THGH DH
Sbjct: 3   NIRSLTVGIVATNCYLVWNKATREGVLIDPGDEAERICSAIAEERVNLKAILLTHGHFDH 62

Query: 65  VGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLG 124
           +  A +LKE   + +    K++  M+         LS        +    +QDGD L L 
Sbjct: 63  ILVAEELKEKYDVPLYAS-KEEKEMLENP---QWNLSGMDEGVTITDYIPVQDGDKLELL 118

Query: 125 THIFKVFHCPGHSPGHVIYVNFENNFA-HLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
              ++V   PGH+ G V Y    +      GDTLF  S GRTD+  G   ++  SI  K+
Sbjct: 119 GKEWQVIATPGHTKGSVSYFVPGDVPYLFSGDTLFYESYGRTDLYGGSEVEIKKSIKEKL 178

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNP--FLK 213
             L DE     GH   +TI  E++ NP  F++
Sbjct: 179 FCLPDETLVYPGHEEATTIANEKQYNPVNFMR 210


>gi|237716319|ref|ZP_04546800.1| conserved hypothetical protein [Bacteroides sp. D1]
 gi|237721002|ref|ZP_04551483.1| conserved hypothetical protein [Bacteroides sp. 2_2_4]
 gi|262407922|ref|ZP_06084470.1| conserved hypothetical protein [Bacteroides sp. 2_1_22]
 gi|293373033|ref|ZP_06619402.1| metallo-beta-lactamase domain protein [Bacteroides ovatus SD CMC
           3f]
 gi|294646732|ref|ZP_06724355.1| metallo-beta-lactamase domain protein [Bacteroides ovatus SD CC 2a]
 gi|294807739|ref|ZP_06766532.1| metallo-beta-lactamase domain protein [Bacteroides xylanisolvens SD
           CC 1b]
 gi|298484214|ref|ZP_07002379.1| metallo-beta-lactamase family protein [Bacteroides sp. D22]
 gi|299145413|ref|ZP_07038481.1| metallo-beta-lactamase family protein [Bacteroides sp. 3_1_23]
 gi|315918860|ref|ZP_07915100.1| conserved hypothetical protein [Bacteroides sp. D2]
 gi|229443966|gb|EEO49757.1| conserved hypothetical protein [Bacteroides sp. D1]
 gi|229449837|gb|EEO55628.1| conserved hypothetical protein [Bacteroides sp. 2_2_4]
 gi|262354730|gb|EEZ03822.1| conserved hypothetical protein [Bacteroides sp. 2_1_22]
 gi|292632101|gb|EFF50710.1| metallo-beta-lactamase domain protein [Bacteroides ovatus SD CMC
           3f]
 gi|292637892|gb|EFF56287.1| metallo-beta-lactamase domain protein [Bacteroides ovatus SD CC 2a]
 gi|294445175|gb|EFG13849.1| metallo-beta-lactamase domain protein [Bacteroides xylanisolvens SD
           CC 1b]
 gi|298269627|gb|EFI11223.1| metallo-beta-lactamase family protein [Bacteroides sp. D22]
 gi|298515904|gb|EFI39785.1| metallo-beta-lactamase family protein [Bacteroides sp. 3_1_23]
 gi|313692735|gb|EFS29570.1| conserved hypothetical protein [Bacteroides sp. D2]
          Length = 212

 Score =  157 bits (398), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 67/214 (31%), Positives = 111/214 (51%), Gaps = 6/214 (2%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGG----DLDIIKDVIQSRNFHVKQIWITH 59
           +     +   F  NC  L+D ++ EAVV+DPG     +   +K  I +   +VK +  TH
Sbjct: 1   MKIKRFEFNMFPVNCYVLWD-DTKEAVVIDPGCFYEEEKQALKKFILTNELNVKHLLNTH 59

Query: 60  GHVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGD 119
            H+DH+ G   + ++  L+    +K D   + +  +Q+R+   ++        ++L DGD
Sbjct: 60  LHLDHIFGNPFMLKEFGLSAEA-NKADEYWIDEAPKQSRMFGFQLQEEPVPLGKYLHDGD 118

Query: 120 TLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSI 179
            +  G    +  H PGHSPG ++Y   E+N    GD LF+ SIGR D+  G++ +LI  I
Sbjct: 119 IITFGHTKLEAIHVPGHSPGSLVYYCKEDNCMFSGDVLFQGSIGRADLTGGNFDELIEHI 178

Query: 180 NNKILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
            +++  L +E     GHG  +TIG E+  NPF +
Sbjct: 179 CSRLFVLPNETVVYPGHGAPTTIGMEKAENPFFR 212


>gi|197123954|ref|YP_002135905.1| beta-lactamase [Anaeromyxobacter sp. K]
 gi|196173803|gb|ACG74776.1| beta-lactamase domain protein [Anaeromyxobacter sp. K]
          Length = 218

 Score =  157 bits (398), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 71/203 (34%), Positives = 99/203 (48%), Gaps = 2/203 (0%)

Query: 10  QVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAA 69
            V PF  NC       + EAV+VDPG ++     +     + + +I+ THGH+DHVGG A
Sbjct: 8   VVGPFAANCWLAACGRTGEAVLVDPGAEVHRALALAGPSGWRITRIFCTHGHIDHVGGGA 67

Query: 70  QLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFK 129
           + +      +   H  D A +  +  QA +               + DG+ L +G    +
Sbjct: 68  EARAATGAPLQ-IHAADDAWLEALPRQAEMFGFDPVEAPEVDHHHV-DGEALRVGDCEAR 125

Query: 130 VFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDE 189
           V H PGHS G              GDTLF  S+GRTD+  GD+  L  SI  ++ PLGD 
Sbjct: 126 VIHTPGHSAGSCSLWFPGEQILFTGDTLFAGSVGRTDLPGGDFDALERSIKERLFPLGDA 185

Query: 190 ISFVCGHGPNSTIGRERRLNPFL 212
           + F  GHGP  T+G ERR NPF+
Sbjct: 186 VRFHPGHGPAGTLGEERRANPFV 208


>gi|317476050|ref|ZP_07935302.1| metallo-beta-lactamase superfamily protein [Bacteroides eggerthii
           1_2_48FAA]
 gi|316907688|gb|EFV29390.1| metallo-beta-lactamase superfamily protein [Bacteroides eggerthii
           1_2_48FAA]
          Length = 212

 Score =  157 bits (398), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 65/214 (30%), Positives = 110/214 (51%), Gaps = 6/214 (2%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGG----DLDIIKDVIQSRNFHVKQIWITH 59
           +     +   F +NC  L+DE + EAVV+DPG     +   +K+ I +   +VK +  TH
Sbjct: 1   MKIKRFEFNMFPENCYVLWDE-TNEAVVIDPGCFYEEEKQALKNFIINNKLNVKHLLNTH 59

Query: 60  GHVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGD 119
            H+DH+ G   + ++  L     ++ D   + +  +Q+R+   ++         +L DGD
Sbjct: 60  LHLDHIFGNPFMLKEFGLKAEA-NQADEFWIDEAPKQSRMFGFQLQEPPVPLGSYLHDGD 118

Query: 120 TLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSI 179
            +  G    +  H PGHSPG ++Y    ++    GD LF+ SIGR D+  G++ +LI  I
Sbjct: 119 IITFGNTELEAIHVPGHSPGSLVYYCAADHCMFSGDVLFQGSIGRADLAGGNFDELIEHI 178

Query: 180 NNKILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
            +++  L +E     GHG  +TIG E+  NPF +
Sbjct: 179 CSRLFILPNETIVYPGHGAPTTIGVEKAENPFFR 212


>gi|218130856|ref|ZP_03459660.1| hypothetical protein BACEGG_02451 [Bacteroides eggerthii DSM 20697]
 gi|217987200|gb|EEC53531.1| hypothetical protein BACEGG_02451 [Bacteroides eggerthii DSM 20697]
          Length = 212

 Score =  157 bits (398), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 65/214 (30%), Positives = 110/214 (51%), Gaps = 6/214 (2%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGG----DLDIIKDVIQSRNFHVKQIWITH 59
           +     +   F +NC  L+DE + EAVV+DPG     +   +K+ I +   +VK +  TH
Sbjct: 1   MKIKRFEFNMFPENCYVLWDE-TNEAVVIDPGCFYEEEKQALKNFIINNKLNVKHLLNTH 59

Query: 60  GHVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGD 119
            H+DH+ G   + ++  L     ++ D   + +  +Q+R+   ++         +L DGD
Sbjct: 60  LHLDHIFGNPFMLKEFGLKAEA-NQADEFWIDEAPKQSRMFGFQLQEPPVPLGSYLHDGD 118

Query: 120 TLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSI 179
            ++ G    +  H PGHSPG ++Y     +    GD LF+ SIGR D+  G++ +LI  I
Sbjct: 119 IIIFGNTELEAIHVPGHSPGSLVYYCAAEHCMFSGDVLFQGSIGRADLAGGNFDELIEHI 178

Query: 180 NNKILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
            +++  L +E     GHG  +TIG E+  NPF +
Sbjct: 179 CSRLFILPNETIVYPGHGAPTTIGVEKAENPFFR 212


>gi|290968826|ref|ZP_06560363.1| metallo-beta-lactamase domain protein [Megasphaera genomosp. type_1
           str. 28L]
 gi|290781122|gb|EFD93713.1| metallo-beta-lactamase domain protein [Megasphaera genomosp. type_1
           str. 28L]
          Length = 213

 Score =  157 bits (397), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 68/212 (32%), Positives = 110/212 (51%), Gaps = 5/212 (2%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           MS + + +  + P   NC  ++D E++EA+V+DP    + I   +Q     +K+I +THG
Sbjct: 1   MS-MKYDVTVLGPVMTNCYIVYDTETMEAMVIDPSWSCETIAANLQRLGVTLKRIVLTHG 59

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H DH+G    L++   + +      D  ++        L   +    ++      +DGD 
Sbjct: 60  HADHIGALQDLRQQYQVPVY-VGAGDKDLITNSRNNMSLFVGKEIVCDSPDYIA-EDGDI 117

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           + +G   FKV   PGH+P       + +     GDTLFR S+GRTD+  G ++ L+ SIN
Sbjct: 118 IAVGKLQFKVITTPGHTP--GGICLYGSRTLFSGDTLFRYSVGRTDLYGGAWETLLQSIN 175

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           +K++ L D    + GHGP +TIG ER  NP+L
Sbjct: 176 DKLMVLPDSTLVLPGHGPATTIGEERTGNPYL 207


>gi|283795475|ref|ZP_06344628.1| metallo-beta-lactamase family protein [Clostridium sp. M62/1]
 gi|291077140|gb|EFE14504.1| metallo-beta-lactamase family protein [Clostridium sp. M62/1]
 gi|295091159|emb|CBK77266.1| Zn-dependent hydrolases, including glyoxylases [Clostridium cf.
           saccharolyticum K10]
          Length = 215

 Score =  157 bits (397), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 62/208 (29%), Positives = 106/208 (50%), Gaps = 4/208 (1%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +    + V   + NC  + +EE+ EAVV+DPG   ++I + ++  +   K I +THGH D
Sbjct: 1   MQIKKLTVGYVQTNCYIVSNEETREAVVIDPGDQGELIAEALKRDSLQTKAILLTHGHSD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+GG   +K+     +    ++   +  +    ++ L   +      +D WL+DG+   +
Sbjct: 61  HIGGLEAVKKATGAKVYALDQERELLADENLNLSKSLLGTIIREE--ADVWLRDGEKFSM 118

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
             + F+V   PGH+ G   Y          GDTLF  S GR D+  G   QL++S+ +K+
Sbjct: 119 IGYEFQVIGTPGHTTGSCCYYVESEKALFAGDTLFEGSYGRVDLPGGSSVQLLHSVLDKL 178

Query: 184 LPLGDEISFVCGH-GPNSTIGRERRLNP 210
             L D+++   GH G  +TIG E++ NP
Sbjct: 179 FELPDDVNVYPGHLGY-TTIGDEKKYNP 205


>gi|317131344|ref|YP_004090658.1| Hydroxyacylglutathione hydrolase [Ethanoligenens harbinense YUAN-3]
 gi|315469323|gb|ADU25927.1| Hydroxyacylglutathione hydrolase [Ethanoligenens harbinense YUAN-3]
          Length = 211

 Score =  157 bits (397), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 61/209 (29%), Positives = 93/209 (44%), Gaps = 4/209 (1%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +    ++V   + NC  + ++E+    V+DPG D   I D ++        I +THGH D
Sbjct: 1   MHIQYLRVGRLETNCYIVCNDETKRCAVIDPGADAARIIDAVRRSGCAPDMILLTHGHFD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G   +L  +    +  P K +   +              +    + D   +DGDT+  
Sbjct: 61  HIGAVRELLAEFGCKLAAP-KAELDFLNNPHRNLHSSMSGEDFVPFAPDILFEDGDTVEA 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
               FK  H PGH+PG        ++    GDTLF  S GRTD   GD   +  S+  K+
Sbjct: 120 AGLSFKALHTPGHTPGSSCL--LCDDVLFTGDTLFAGSAGRTDFPGGDPAAMRASLR-KL 176

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
             L      + GHGP ST+ +ER  NP+L
Sbjct: 177 AMLAGNYQVLPGHGPFSTLEKERVENPYL 205


>gi|296270028|ref|YP_003652660.1| beta-lactamase domain-containing protein [Thermobispora bispora DSM
           43833]
 gi|296092815|gb|ADG88767.1| beta-lactamase domain protein [Thermobispora bispora DSM 43833]
          Length = 229

 Score =  157 bits (397), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 66/220 (30%), Positives = 99/220 (45%), Gaps = 11/220 (5%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPG-GDLDIIKDVIQSRNFHVKQIWITHGHV 62
           +         F+ NC  +      E VV+DPG G ++ + ++++        + +THGH+
Sbjct: 1   MLVAGFPAGSFQANCYVVAPAAGEECVVIDPGQGAVEGLDELLREHRLKPVAVLLTHGHI 60

Query: 63  DHVGGAAQLKEDLSLTIIGPHKDDAAMMGKV----DEQARLLSIRMNARNASSDRWLQDG 118
           DH+     +     +     H +D  ++           R L   +        R L DG
Sbjct: 61  DHIWSVVPVCGARDVPAW-IHPEDRDLLSDPAKGFPPPTRQLFGGLEFTEPDDVRELTDG 119

Query: 119 DTLLLGTHIFKVFHCPGHSPGHVIYVNFENNFA----HLGDTLFRSSIGRTDILHGDYQQ 174
            TL L      V H PGH+PG V +   +          GD LF  SIGRTD+  GDY  
Sbjct: 120 VTLRLAGLDITVDHTPGHTPGSVTFRTPDQERDTLLLFSGDLLFAGSIGRTDLPGGDYPT 179

Query: 175 LINSINNKILPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           ++ S+  K + L D+   + GHGP +TIGRER  NPFL+ 
Sbjct: 180 MLRSLA-KTMRLPDDTVVLPGHGPQTTIGRERATNPFLRE 218


>gi|261417697|ref|YP_003251379.1| beta-lactamase [Geobacillus sp. Y412MC61]
 gi|297529392|ref|YP_003670667.1| beta-lactamase [Geobacillus sp. C56-T3]
 gi|319767495|ref|YP_004132996.1| beta-lactamase [Geobacillus sp. Y412MC52]
 gi|261374154|gb|ACX76897.1| beta-lactamase domain protein [Geobacillus sp. Y412MC61]
 gi|297252644|gb|ADI26090.1| beta-lactamase domain protein [Geobacillus sp. C56-T3]
 gi|317112361|gb|ADU94853.1| beta-lactamase domain protein [Geobacillus sp. Y412MC52]
          Length = 210

 Score =  157 bits (397), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 62/211 (29%), Positives = 98/211 (46%), Gaps = 3/211 (1%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + +  + V P + N   L   +  + ++VDPG +   +   I+ +      I +TH H D
Sbjct: 1   MEWTRIPVGPIQANAYLLSSAD-RQCLIVDPGAEGAALVRRIEEKGLTPLAILLTHAHFD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+GG   +     + +    K+   +       +      +  R   +   L+    L +
Sbjct: 60  HIGGIPDVLARWDIPVYVHEKEKQWLQDPALNGSLYFGGPVAVRCEPTC--LKGPTALNI 117

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V   PGHSPG V Y   + N    GD LF  SIGRTD+  G++QQL+ SI++++
Sbjct: 118 GPFALDVRETPGHSPGSVSYYCKQANIVFSGDALFAGSIGRTDLPGGNHQQLLKSIHDEL 177

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           L L +E   + GHGP +TI  E   NPFL  
Sbjct: 178 LTLPEETIVLSGHGPETTIAAEMDANPFLHG 208


>gi|52081013|ref|YP_079804.1| hypothetical protein BL01575 [Bacillus licheniformis ATCC 14580]
 gi|52786390|ref|YP_092219.1| YqgX [Bacillus licheniformis ATCC 14580]
 gi|52004224|gb|AAU24166.1| conserved protein YqgX [Bacillus licheniformis ATCC 14580]
 gi|52348892|gb|AAU41526.1| YqgX [Bacillus licheniformis ATCC 14580]
          Length = 212

 Score =  157 bits (397), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 56/211 (26%), Positives = 102/211 (48%), Gaps = 2/211 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + +  + + P + N   L +++    ++ DPG +   +   I+        + +TH H D
Sbjct: 1   MKWRRMPLGPIQTNAYILSNDD-GTCLIFDPGSESGKLNAYIKENGLKPLAVLLTHAHFD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G    ++++ ++ +   HK++A  +         L          +D  +++   L +
Sbjct: 60  HIGAVDNVRKEWNIPVY-VHKNEAEWLTDPSLNGSALLTGQTITAEKADHLIEEEGDLKI 118

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    ++   PGHSPG V Y   E N    GD LF+  IGRTD+  G+ + L++SI+ K+
Sbjct: 119 GPFTLRMLFTPGHSPGSVSYYAEEENLIVSGDVLFKGGIGRTDLPGGNQKVLMDSIHQKL 178

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           L L +E   + GHGP + I  E+  NPF+  
Sbjct: 179 LTLPEETLVLSGHGPETDIATEQEQNPFING 209


>gi|325105738|ref|YP_004275392.1| beta-lactamase domain protein [Pedobacter saltans DSM 12145]
 gi|324974586|gb|ADY53570.1| beta-lactamase domain protein [Pedobacter saltans DSM 12145]
          Length = 212

 Score =  157 bits (397), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 66/214 (30%), Positives = 105/214 (49%), Gaps = 7/214 (3%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGG----DLDIIKDVIQSRNFHVKQIWITH 59
           L        P+++N   L DE +   V++DPG     + + + + I+  N   + +  TH
Sbjct: 2   LKLQQFVNNPYQENTYVLSDE-TGSCVIIDPGMYNATEQNAVVNYIKENNLKPEILLNTH 60

Query: 60  GHVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGD 119
            H+DHV G   + +   L     HK +  ++  V              +   + +L + D
Sbjct: 61  CHIDHVLGNKFVFDIYGLRPQ-IHKGELQLLHAVP-SYAPQQGFNYEISPEPEAFLTEED 118

Query: 120 TLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSI 179
           T+  G  I K+   PGHSP H+ + + E+     GD LF  SIGRTD+  G+++ LI+SI
Sbjct: 119 TVKFGNSILKIIFAPGHSPAHLCFYHEESKTLIGGDVLFYGSIGRTDLPGGNFETLISSI 178

Query: 180 NNKILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
            N +  L D+     GHGP +TIG E+  NPFL+
Sbjct: 179 KNNLFILPDDTKVYPGHGPATTIGFEKANNPFLR 212


>gi|323485945|ref|ZP_08091278.1| metallo-beta-lactamase [Clostridium symbiosum WAL-14163]
 gi|323693058|ref|ZP_08107278.1| beta-lactamase domain-containing protein [Clostridium symbiosum
           WAL-14673]
 gi|323400735|gb|EGA93100.1| metallo-beta-lactamase [Clostridium symbiosum WAL-14163]
 gi|323502939|gb|EGB18781.1| beta-lactamase domain-containing protein [Clostridium symbiosum
           WAL-14673]
          Length = 214

 Score =  157 bits (396), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 60/207 (28%), Positives = 93/207 (44%), Gaps = 2/207 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +    + V   + NC    + ++ EAV+VDPG +   I +        VK I +THGH D
Sbjct: 1   MEITRLVVGMVETNCYIALNPQNKEAVIVDPGDNAPKIIETCGKLGASVKAILLTHGHFD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HV    +L+      +    ++   +     ++              +DR L+D +   L
Sbjct: 61  HVMAMEELRLKYKAPVFASEQEAGVLAD--PDKNLSCQFMSGGLYLKADRLLKDQEEFEL 118

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
             + FKV H PGH+ G   Y          GDTLF  S GR D   G+ +++INS+ N +
Sbjct: 119 IGYQFKVIHTPGHTCGSCCYYIASEKVLFAGDTLFEGSYGRIDFPTGNSREMINSVANVL 178

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNP 210
             L ++     GH   +TIG E+R NP
Sbjct: 179 FGLPEDTDVYPGHMGYTTIGDEKRYNP 205


>gi|33152156|ref|NP_873509.1| glyoxalase II family protein [Haemophilus ducreyi 35000HP]
 gi|33148378|gb|AAP95898.1| glyoxalase II family protein [Haemophilus ducreyi 35000HP]
          Length = 209

 Score =  157 bits (396), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 72/209 (34%), Positives = 125/209 (59%), Gaps = 2/209 (0%)

Query: 5   SFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDH 64
           +  I+ V+PF+QNC  ++D++   AV++D G +   I   ++S++  ++++ ITH H+DH
Sbjct: 3   NLQIIPVSPFQQNCCVIWDKD-KNAVIIDAGDEAGKIIQFVESQDLKLQKLLITHAHLDH 61

Query: 65  VGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLG 124
           +    ++++   + + G H DD  +  ++ +   +    +  ++   D WL DGD + +G
Sbjct: 62  IMAVEKVRDHFGVEVYGSHIDDKPLFEQLPQMCEMF-GMLPVKSFLPDHWLADGDVVQVG 120

Query: 125 THIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKIL 184
              F V H PGH+PGHV + +F+N     GD LF+ SIGRTD+  G+   L+ SI +KI 
Sbjct: 121 ALTFNVRHLPGHAPGHVGFFDFDNKIIFSGDVLFKDSIGRTDLYMGNLAVLLASIRSKIF 180

Query: 185 PLGDEISFVCGHGPNSTIGRERRLNPFLK 213
            L D+   V GHG ++T+GRE+  +PF+K
Sbjct: 181 DLPDDFIIVAGHGSHTTVGREKMYHPFVK 209


>gi|332799392|ref|YP_004460891.1| beta-lactamase domain-containing protein [Tepidanaerobacter sp.
           Re1]
 gi|332697127|gb|AEE91584.1| beta-lactamase domain protein [Tepidanaerobacter sp. Re1]
          Length = 208

 Score =  157 bits (396), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 76/213 (35%), Positives = 112/213 (52%), Gaps = 5/213 (2%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +    +QV     NC  + DE++  A ++DPG D D I + I   +  VK I++THGH D
Sbjct: 1   MFLKRLQVGDLAANCYIIADEKNANAAIIDPGADADKIIETITKEHLIVKYIFLTHGHSD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+    ++K      I   H+ DA M+    +   +       +    D  L+  +   +
Sbjct: 61  HISALKEVKNATDAKI-AIHEQDAPMLLSPKDNLSIYFGEGFIQPP-PDIMLKGNEKFAV 118

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G  + ++ H PGH+PG +       N    GDTLF  S+GRTD   G Y +LINSI +K+
Sbjct: 119 GDLVLEIIHTPGHTPGGISI--KVGNIVFTGDTLFAGSVGRTDFPGGSYDELINSIRDKL 176

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI 216
           LPLGD IS + GHG  ST+  E+++NPFL  NI
Sbjct: 177 LPLGDNISILPGHGEPSTLSIEKKINPFL-CNI 208


>gi|295114807|emb|CBL35654.1| Zn-dependent hydrolases, including glyoxylases [butyrate-producing
           bacterium SM4/1]
          Length = 215

 Score =  157 bits (396), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 61/208 (29%), Positives = 106/208 (50%), Gaps = 4/208 (1%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +    + V   + NC  + +EE+ EAVV+DPG   ++I + ++  +   + I +THGH D
Sbjct: 1   MQIKKLTVGYVQTNCYIVSNEETREAVVIDPGDQGELIAEALKRDSLQTRAILLTHGHSD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+GG   +K+     +    ++   +  +    ++ L   +      +D WL+DG+   +
Sbjct: 61  HIGGLEAVKKATGAKVYALDQERELLADENLNLSKSLLGTIIREE--ADVWLRDGEKFSM 118

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
             + F+V   PGH+ G   Y          GDTLF  S GR D+  G   QL++S+ +K+
Sbjct: 119 IGYEFQVIGTPGHTTGSCCYYVESEKALFAGDTLFEGSYGRVDLPGGSSVQLLHSVLDKL 178

Query: 184 LPLGDEISFVCGH-GPNSTIGRERRLNP 210
             L D+++   GH G  +TIG E++ NP
Sbjct: 179 FELPDDVNVYPGHLGY-TTIGDEKKYNP 205


>gi|320451367|ref|YP_004203463.1| putative metallo-beta-lactamase domain-containing protein [Thermus
           scotoductus SA-01]
 gi|320151536|gb|ADW22914.1| putative metallo-beta-lactamase domain protein [Thermus scotoductus
           SA-01]
          Length = 211

 Score =  157 bits (396), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 63/209 (30%), Positives = 95/209 (45%), Gaps = 5/209 (2%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +  + + V P ++N   +  +E   AV++DPG + + I  +++S     K I +TH H D
Sbjct: 1   MRVYGLSVGPLQENTYLVEGKEG--AVLIDPGDEAERILALLESTGLTPKAILLTHAHFD 58

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG  A L E LSL +   H  D  +     E AR+  + +          L++G  L  
Sbjct: 59  HVGAVAPLVEALSLPVF-LHPLDLPLYRHAAEVARMWGLAI-PDPPLPVEPLEEGQVLYG 116

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
            T      H PGH          E      GD LF+ SIGR D+     + L  S+  ++
Sbjct: 117 FTVWHLPGHSPGHVAFIHPGEAGEPPRVLSGDLLFQGSIGRYDLPGASREDLFRSLK-RL 175

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           L L  +     GHGP +T+  E + NPFL
Sbjct: 176 LTLPPQTEVYPGHGPPTTLALEAKTNPFL 204


>gi|225026136|ref|ZP_03715328.1| hypothetical protein EUBHAL_00377 [Eubacterium hallii DSM 3353]
 gi|224956541|gb|EEG37750.1| hypothetical protein EUBHAL_00377 [Eubacterium hallii DSM 3353]
          Length = 215

 Score =  157 bits (396), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 61/213 (28%), Positives = 102/213 (47%), Gaps = 1/213 (0%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M +L     Q+ P   N   L D+E  EA+++DP G  + +   ++   + +  + +THG
Sbjct: 1   MGQLKIVCAQLGPIDTNTYILMDDEIKEAIIIDPAGSPEELIKFLEDEGYSLDGVLLTHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H DH+G    L+E      +  +         + +   L ++        ++  + D   
Sbjct: 61  HHDHIGALEGLREHYDPWKLRVYAAKPEQEVLMVKDYNLSTMFGEGYTTHANMMIDDKQI 120

Query: 121 LLLG-THIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSI 179
             +   H  +  + PGH+ G   Y   E  +   GDTLF  S+GR+D   GD Q L+ S+
Sbjct: 121 FEVTSKHKCQCLYTPGHTLGSCCYYFAEEGWLFSGDTLFAGSVGRSDFPTGDAQALLKSL 180

Query: 180 NNKILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           N+ ++ L DE+    GHGP++TIG ER  NPF+
Sbjct: 181 NHVVMRLPDEVIVYPGHGPSTTIGEERETNPFV 213


>gi|229828400|ref|ZP_04454469.1| hypothetical protein GCWU000342_00461 [Shuttleworthia satelles DSM
           14600]
 gi|229792994|gb|EEP29108.1| hypothetical protein GCWU000342_00461 [Shuttleworthia satelles DSM
           14600]
          Length = 210

 Score =  157 bits (396), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 55/209 (26%), Positives = 93/209 (44%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +      V P + NC  +  E   EA+++DPG     + + ++     +  + +THGH D
Sbjct: 1   MLIQQFVVGPVETNCYIIHKEGEKEALIIDPGAAGRQLAEHLRKEGLRLAAVLLTHGHAD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GG   L  +L   +     +                I  +++   +D +++DG+   L
Sbjct: 61  HAGGIEDLLRELKDRVPVIAYEGEKRTLADPNYNLSSWILSHSQVFHADLFMRDGEEKDL 120

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
               F++   PGH+ G   +     N    GD+LF  S+GRTD   G    L+ S+  K+
Sbjct: 121 AGLHFRLLATPGHTEGGCCFYFPYENVLFSGDSLFAGSLGRTDFPGGSVALLVRSVKEKL 180

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           + L +    + GH   +TIG ER  NP+L
Sbjct: 181 MTLPEGTRVLPGHEGETTIGEERVNNPYL 209


>gi|196248908|ref|ZP_03147608.1| beta-lactamase domain protein [Geobacillus sp. G11MC16]
 gi|196211784|gb|EDY06543.1| beta-lactamase domain protein [Geobacillus sp. G11MC16]
          Length = 210

 Score =  157 bits (396), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 65/211 (30%), Positives = 101/211 (47%), Gaps = 3/211 (1%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + +  + V P + N   L  E+    V+VDPG +  ++   ++ +      I +TH H D
Sbjct: 1   MEWTRIPVGPIQANAYLLSAED-GSCVIVDPGAEGAVLVRRMEEKQLTPLAILLTHAHFD 59

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+GG   +     + +   H+++   +      + L               +    TL +
Sbjct: 60  HIGGIPDVLARWDVPVY-LHENEKQWLQDPALNSSLYFGAPVVVRCEPT-CIAGRTTLTI 117

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G  +F V   PGHSPG V Y          GD LF  SIGRTD+  G++QQL+NSI++++
Sbjct: 118 GPFVFDVRETPGHSPGSVSYYCEAAQIVFSGDALFAGSIGRTDLPGGNHQQLLNSIHDEL 177

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           L L +E   + GHGP +TIG E   NPFL  
Sbjct: 178 LTLPEETIVLSGHGPETTIGAEMDTNPFLHG 208


>gi|15827169|ref|NP_301432.1| hydrolase [Mycobacterium leprae TN]
 gi|221229647|ref|YP_002503063.1| putative hydrolase [Mycobacterium leprae Br4923]
 gi|2494859|sp|Q49649|Y493_MYCLE RecName: Full=Uncharacterized protein ML0493
 gi|466827|gb|AAA17102.1| B1177_C3_247 [Mycobacterium leprae]
 gi|3136014|emb|CAA19086.1| hypothetical protein MLCB1259.11 [Mycobacterium leprae]
 gi|13092717|emb|CAC30001.1| putative hydrolase [Mycobacterium leprae]
 gi|219932754|emb|CAR70586.1| putative hydrolase [Mycobacterium leprae Br4923]
          Length = 218

 Score =  156 bits (395), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 65/216 (30%), Positives = 100/216 (46%), Gaps = 8/216 (3%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPG-GDLDIIKDVIQSRNFHVKQIWITHGHV 62
           +          + NC  L D    +AV+VDPG   +  ++ ++         + +THGH+
Sbjct: 1   MLITGFPAGMLQCNCYVLADRAGTDAVIVDPGQRAMGPLRRILDENRLTPSAVLLTHGHI 60

Query: 63  DHVGGAAQLKEDLSLTIIGPHKDDAAMMGKV-----DEQARLLSIRMNARNASSDRWLQD 117
           DH+  A ++ +         H +D  M+           A++++              +D
Sbjct: 61  DHMWSAQKVSDTYGCPTY-IHPEDRFMLTDPLFGFGPRVAQVVTGAFFREPKQVVELDRD 119

Query: 118 GDTLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAH-LGDTLFRSSIGRTDILHGDYQQLI 176
           GD L LG+    V H PGH+ G V +    +      GDTLF  +IGRTD+  G  + L 
Sbjct: 120 GDKLDLGSVTVNVDHTPGHTRGSVCFWVAADTDVVLTGDTLFERTIGRTDLFGGSGRDLY 179

Query: 177 NSINNKILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
            SI  K+L L D+   + GHG ++TIG ERR NPFL
Sbjct: 180 RSIVEKLLVLDDKTVVLPGHGNSTTIGAERRFNPFL 215


>gi|255526673|ref|ZP_05393578.1| beta-lactamase domain protein [Clostridium carboxidivorans P7]
 gi|296187178|ref|ZP_06855575.1| metallo-beta-lactamase domain protein [Clostridium carboxidivorans
           P7]
 gi|255509653|gb|EET85988.1| beta-lactamase domain protein [Clostridium carboxidivorans P7]
 gi|296048213|gb|EFG87650.1| metallo-beta-lactamase domain protein [Clostridium carboxidivorans
           P7]
          Length = 201

 Score =  156 bits (395), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 73/212 (34%), Positives = 113/212 (53%), Gaps = 11/212 (5%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           MS +    +    +  NC  + D+E+ + +V+DPGGD + +  +I+  N  VK I +THG
Sbjct: 1   MS-IKIKRIPAGIYAANCYIVIDQETKDCIVMDPGGDEEDLIKIIKEENVQVKYILLTHG 59

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H+DH G A  LK++    I   ++D   +                  + + D+++++GD 
Sbjct: 60  HLDHTGAAVSLKKEFKAPICISNEDYKMISKGAS--------MYGDIDNNVDQFIKEGDI 111

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
             +G+   K  H PGH+PG         +    GDTLF  SIGRTD+  GD+  ++ +I 
Sbjct: 112 FKVGSMEIKCIHTPGHTPGS--LCFLMGDSIFTGDTLFAGSIGRTDLEAGDFNAIVKNIK 169

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
            K++ L DEI  + GHGP STIGRE+  NPFL
Sbjct: 170 EKLMILDDEIQVLPGHGPESTIGREKVHNPFL 201


>gi|329121019|ref|ZP_08249650.1| metallo-beta-lactamase [Dialister micraerophilus DSM 19965]
 gi|327471181|gb|EGF16635.1| metallo-beta-lactamase [Dialister micraerophilus DSM 19965]
          Length = 211

 Score =  156 bits (395), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 64/212 (30%), Positives = 103/212 (48%), Gaps = 3/212 (1%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +    V + P + N   ++ E   E VV+DP  D++ I   I+  N  +K I +TH H+D
Sbjct: 1   MKIEKVILGPLQNNTYIIYFENINEVVVIDPSFDVENILSEIKKSNIKIKAILLTHAHID 60

Query: 64  HVGGAAQLKEDLS-LTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLL 122
           H+ G  ++KE      +    K+   ++      + L    +          L+DG+ L 
Sbjct: 61  HIAGILKIKESFPDAKVYMGEKEQKTLLNSNFNLSYLFPGTLIYDKVDF--LLKDGEKLN 118

Query: 123 LGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
            G   F++   PGH+ G + Y     N    GDTLF  +IGR+D   G++ QL+NSI N+
Sbjct: 119 FGNVEFEIITTPGHTIGSICYYIKSENILFTGDTLFYKTIGRSDFPGGNFIQLVNSIVNR 178

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           +  L D    + GHG  ++I  ER  NPF++ 
Sbjct: 179 LFTLPDNTDVMPGHGITTSIKFERENNPFVRG 210


>gi|58039612|ref|YP_191576.1| metallo-beta-lactamase superfamily protein [Gluconobacter oxydans
           621H]
 gi|58002026|gb|AAW60920.1| Metallo-beta-lactamase superfamily protein [Gluconobacter oxydans
           621H]
          Length = 245

 Score =  156 bits (395), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 91/217 (41%), Positives = 127/217 (58%), Gaps = 10/217 (4%)

Query: 2   SKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGH 61
           + L    V VTP +QNCT L ++E   AVVVDPGGD+  I   +      V+ I +THGH
Sbjct: 31  TPLYAKRVPVTPLRQNCTILSNDE-GRAVVVDPGGDVGDILQHLD--GMTVEAILLTHGH 87

Query: 62  VDHVGGAAQLKEDL------SLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWL 115
           +DH GGAA LK  L       + ++GP + D  ++  + +QA    I     N + DR++
Sbjct: 88  LDHAGGAAALKRALEKQQGQPVPVLGPDRRDEFLLQSITKQAAAFGIPGM-ENVAPDRFV 146

Query: 116 QDGDTLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQL 175
           + G+ L L      V H PGH+PGHV++V+ +N     GDTLFR ++GRTD  +GD Q L
Sbjct: 147 EGGEVLHLLGQDLHVAHVPGHTPGHVVFVDHDNRRVLAGDTLFRGTVGRTDFAYGDSQAL 206

Query: 176 INSINNKILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           ++ I   +L L D+   +CGHG  +TIG ERR NPFL
Sbjct: 207 VDGIRRHLLTLSDDTVVLCGHGMPTTIGEERRTNPFL 243


>gi|160886033|ref|ZP_02067036.1| hypothetical protein BACOVA_04039 [Bacteroides ovatus ATCC 8483]
 gi|260170516|ref|ZP_05756928.1| putative metallo-beta-lactamase [Bacteroides sp. D2]
 gi|156108846|gb|EDO10591.1| hypothetical protein BACOVA_04039 [Bacteroides ovatus ATCC 8483]
          Length = 219

 Score =  156 bits (395), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 67/214 (31%), Positives = 111/214 (51%), Gaps = 6/214 (2%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGG----DLDIIKDVIQSRNFHVKQIWITH 59
           +     +   F  NC  L+D ++ EAVV+DPG     +   +K  I +   +VK +  TH
Sbjct: 8   MKIKRFEFNMFPVNCYVLWD-DTKEAVVIDPGCFYEEEKQALKKFILTNELNVKHLLNTH 66

Query: 60  GHVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGD 119
            H+DH+ G   + ++  L+    +K D   + +  +Q+R+   ++        ++L DGD
Sbjct: 67  LHLDHIFGNPFMLKEFGLSAEA-NKADEYWIDEAPKQSRMFGFQLQEEPVPLGKYLHDGD 125

Query: 120 TLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSI 179
            +  G    +  H PGHSPG ++Y   E+N    GD LF+ SIGR D+  G++ +LI  I
Sbjct: 126 IITFGHTKLEAIHVPGHSPGSLVYYCKEDNCMFSGDVLFQGSIGRADLTGGNFDELIEHI 185

Query: 180 NNKILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
            +++  L +E     GHG  +TIG E+  NPF +
Sbjct: 186 CSRLFVLPNETVVYPGHGAPTTIGMEKAENPFFR 219


>gi|195952855|ref|YP_002121145.1| beta-lactamase domain protein [Hydrogenobaculum sp. Y04AAS1]
 gi|195932467|gb|ACG57167.1| beta-lactamase domain protein [Hydrogenobaculum sp. Y04AAS1]
          Length = 212

 Score =  156 bits (394), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 65/214 (30%), Positives = 107/214 (50%), Gaps = 4/214 (1%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M KL    +   P  +NC  + +E++ EA+V+DPG D+  I + I   +F +  I  THG
Sbjct: 1   MEKLKIETIPTKPIDENCIVIKNEDTKEAIVIDPGSDIQAILETIG--DFKLVAILATHG 58

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H DH+G  A LKE  ++     HK+D  ++   +                 D +++DGD 
Sbjct: 59  HYDHIGQVATLKERYNVP-FYMHKEDEFLLND-ELFPGFSIYLNAKTPPKPDFYIKDGDK 116

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           L + +   ++ H PGH+PG   +     N    GDTLF+  +GRTD+  G ++ L  S+ 
Sbjct: 117 LSIASVDIEIIHTPGHTPGGCCFYLPSQNTLIAGDTLFKGGVGRTDLPGGSWEDLSKSLK 176

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
                L  +   +CGH  ++++  E + NPFL+ 
Sbjct: 177 KIFSILPKDTHVICGHYQDTSLEHELKFNPFLRG 210


>gi|158520045|ref|YP_001527915.1| beta-lactamase domain-containing protein [Desulfococcus oleovorans
           Hxd3]
 gi|158508871|gb|ABW65838.1| beta-lactamase domain protein [Desulfococcus oleovorans Hxd3]
          Length = 220

 Score =  156 bits (394), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 61/218 (27%), Positives = 97/218 (44%), Gaps = 8/218 (3%)

Query: 2   SKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGH 61
           + +    ++++  +  C  + D  S   +++DP  D   I     +  F +  +  THGH
Sbjct: 7   NPMVVRQIKLSRMETFCYLVGDPASKTGLLIDPAFDTGRILAAAATAGFTITAVVNTHGH 66

Query: 62  VDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
            DH  G A +       +    KD   + G  +    L  +     +   D  LQ G+ +
Sbjct: 67  ADHCCGNAAVMGASGARLHIHKKDARQLTGFFNGV--LCRLLGGRPSPRPDVVLQHGEAV 124

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
           +LG     V H PGH+PG      +       GDTLF  S GRTD+  G  + L  SI  
Sbjct: 125 VLGQTTLTVLHTPGHTPGS--ICLYMPGHLFAGDTLFVGSAGRTDLSGGSIKDLHASIRT 182

Query: 182 KILPLGDEISFVCGHG----PNSTIGRERRLNPFLKSN 215
           ++ PL D+     GH     P STIG E++ NPF++++
Sbjct: 183 RLFPLPDDTRVWPGHDYGDRPVSTIGHEKKTNPFMQAD 220


>gi|332981510|ref|YP_004462951.1| beta-lactamase domain-containing protein [Mahella australiensis
           50-1 BON]
 gi|332699188|gb|AEE96129.1| beta-lactamase domain protein [Mahella australiensis 50-1 BON]
          Length = 211

 Score =  156 bits (394), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 67/211 (31%), Positives = 105/211 (49%), Gaps = 3/211 (1%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +   +++V  ++ NC     +++  AV++DPG + + I  V+      +  I +THGH D
Sbjct: 1   MKVKVLRVGIYQTNCYICVYDDNNSAVIIDPGDEGERIYGVVAQDKLAITHIILTHGHPD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG    L++     +   HKDD+ M+   +  +    + MN  +   D +L D DT+ +
Sbjct: 61  HVGAVPYLRKFTGAKV-LIHKDDSFMITDSEASSFAHLLGMNPVSMVPDGFLTDNDTIDM 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
                 + H PGH+PG         +    GDTLF  SIGRTD+  GD  ++  S+N  +
Sbjct: 120 SFSKAHIMHTPGHTPGS--ICIQMRDCLFTGDTLFAGSIGRTDLPGGDEHEMRISLNRIL 177

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
             + D      GHGP+STI  ER  NPFL  
Sbjct: 178 TNIDDNTILYPGHGPSSTIKYERVSNPFLTD 208


>gi|300856532|ref|YP_003781516.1| putative Zn-dependent hydrolase [Clostridium ljungdahlii DSM 13528]
 gi|300436647|gb|ADK16414.1| putative Zn-dependent hydrolase [Clostridium ljungdahlii DSM 13528]
          Length = 199

 Score =  156 bits (394), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 65/209 (31%), Positives = 100/209 (47%), Gaps = 10/209 (4%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +    V V  +  NC  L DE+  ++VV+DPG D+  I D I +    V+ I +THGH D
Sbjct: 1   MKLTKVIVGVYAANCYILADEKEGKSVVIDPGDDVKDIIDAIDASKTKVEYILLTHGHAD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H   A +++   +  I    +D            +   +         D +++D      
Sbjct: 61  HTSAAEEIRNKYNAPIAISRED--------YNMMKSRELMYGKLIDEVDIYIEDNQVFEF 112

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    K  + PGH+PG V +     N    GDTLF+ S+GRTD   GD+  ++ SI N++
Sbjct: 113 GNIKLKALYTPGHTPGGVSF--LGENMVFTGDTLFKRSVGRTDFTGGDFNAIMGSIKNRL 170

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           + L DE+    GHG  ++I  E+  NPFL
Sbjct: 171 MTLPDEMVVFPGHGSKTSIKEEKMYNPFL 199


>gi|138896015|ref|YP_001126468.1| hydroxyacylglutathione hydrolase [Geobacillus thermodenitrificans
           NG80-2]
 gi|134267528|gb|ABO67723.1| Hydroxyacylglutathione hydrolase [Geobacillus thermodenitrificans
           NG80-2]
          Length = 265

 Score =  156 bits (394), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 65/211 (30%), Positives = 100/211 (47%), Gaps = 3/211 (1%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + +  + V P + N   L  E+    V+VDPG +   +   ++ +      I +TH H D
Sbjct: 56  MEWTRIPVGPIQANAYLLSAED-GSCVIVDPGAEGAALVRRMEEKQLTPLAILLTHAHFD 114

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+GG   +     + +   H+++   +      + L               +    TL +
Sbjct: 115 HIGGIPDVLARWDVPVY-LHENEKQWLQDPALNSSLYFGAPVVVRCEPT-CIAGRTTLTI 172

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G  +F V   PGHSPG V Y          GD LF  SIGRTD+  G++QQL+NSI++++
Sbjct: 173 GPFVFDVRETPGHSPGSVSYYCEAAQIVFSGDALFAGSIGRTDLPGGNHQQLLNSIHDEL 232

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           L L +E   + GHGP +TIG E   NPFL  
Sbjct: 233 LTLPEETIVLSGHGPETTIGAEMDTNPFLHG 263


>gi|149198624|ref|ZP_01875668.1| Beta-lactamase-like protein [Lentisphaera araneosa HTCC2155]
 gi|149138339|gb|EDM26748.1| Beta-lactamase-like protein [Lentisphaera araneosa HTCC2155]
          Length = 213

 Score =  156 bits (394), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 67/212 (31%), Positives = 111/212 (52%), Gaps = 4/212 (1%)

Query: 5   SFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDH 64
                 V  ++ NC+ ++  ES EA+++DPG + + I   I  +   +K I  TH H+DH
Sbjct: 4   KVITFPVGLYQCNCSIVYCPESKEAILIDPGSEAETILKKINYQGLKIKAIIHTHAHLDH 63

Query: 65  VGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLG 124
            G   ++ E    ++   HKDD  +    D QA +L +     +A+ D +++D  +   G
Sbjct: 64  FGATHEVSESTDASVH-LHKDDMPLWNIADLQAEMLGLPKC-PHANVDHFIEDSQSFEFG 121

Query: 125 THIFKVFHCPGHSPGHVIYVNFENNFA--HLGDTLFRSSIGRTDILHGDYQQLINSINNK 182
               +  H PGHS G   +    ++      GDTLFR  +GRTD+  GD +++  SI  K
Sbjct: 122 EFKLEAIHTPGHSAGSTCFKIENSDEQLLFSGDTLFRRGVGRTDLPSGDSREIAKSIKEK 181

Query: 183 ILPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           +  L  + + + GHGPN+ IG E+R NP++K+
Sbjct: 182 LYKLDIDTTVIPGHGPNTVIGEEKRQNPYIKA 213


>gi|212702064|ref|ZP_03310192.1| hypothetical protein DESPIG_00066 [Desulfovibrio piger ATCC 29098]
 gi|212674505|gb|EEB34988.1| hypothetical protein DESPIG_00066 [Desulfovibrio piger ATCC 29098]
          Length = 207

 Score =  156 bits (394), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 63/208 (30%), Positives = 98/208 (47%), Gaps = 6/208 (2%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + + +  + P + N   ++  +  +AVV+D GGD   I   ++++   +  I +TH H D
Sbjct: 1   MPYSVYPLGPLETNSYLVY--KDGQAVVIDAGGDPAPILHDLRAKGLTLAAICLTHRHFD 58

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+ G A L ++    +  P  D   +     E +           A   R L  G  +  
Sbjct: 59  HMYGVATLVKETGAPVYSPVHDACLIGT---ESSDGGIWGFPPVPAFESRDLPTGRQV-F 114

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G     V   PGH+PG V Y   +      GD LF  S+GRTD   GD+  L++SI   +
Sbjct: 115 GGMACTVLDTPGHTPGGVSYYFPDEKAVFTGDALFYRSLGRTDFPGGDHDTLLHSIRKVL 174

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPF 211
             L +E + + GHGP ++IG ERR NPF
Sbjct: 175 FALPEETAVLPGHGPATSIGNERRNNPF 202


>gi|225848337|ref|YP_002728500.1| metallo-beta-lactamase [Sulfurihydrogenibium azorense Az-Fu1]
 gi|225644580|gb|ACN99630.1| putative metallo-beta-lactamase domain protein
           [Sulfurihydrogenibium azorense Az-Fu1]
          Length = 212

 Score =  156 bits (394), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 72/209 (34%), Positives = 115/209 (55%), Gaps = 5/209 (2%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +   ++ V P  +NC  ++DE++ + V++DPG D + I + ++   F+VK I  THGH+D
Sbjct: 1   MIVKVLTVGPLAENCVVIYDEKTKDCVIIDPGADGEDILEEVEH--FNVKAILATHGHLD 58

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG    LK+ L +      KD+  +   +        I    +  + D  L++GD L  
Sbjct: 59  HVGQVGFLKKILDVPFYMNVKDEFLINNDIFPGFS--MIIKATKCPNPDFDLKEGDNLKF 116

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G+  F V   PGH+PG V + N EN     GDTLF  S+GR D+  G+  +L  S+ +K+
Sbjct: 117 GSISFYVIETPGHTPGSVCFYNQENKILISGDTLFAGSVGRVDLPGGNGAELEKSL-SKL 175

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           + L ++     GHG  +TIG+E+R NPF+
Sbjct: 176 MTLPEDTVVYPGHGGRTTIGKEKRTNPFI 204


>gi|258406306|ref|YP_003199048.1| beta-lactamase domain-containing protein [Desulfohalobium retbaense
           DSM 5692]
 gi|257798533|gb|ACV69470.1| beta-lactamase domain protein [Desulfohalobium retbaense DSM 5692]
          Length = 210

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 61/211 (28%), Positives = 86/211 (40%), Gaps = 6/211 (2%)

Query: 5   SFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDH 64
           S     + P + NC    DE      V+DPGGD   + D +      ++ I  TH H DH
Sbjct: 3   SIQTFALGPLETNCYLYTDEACG--FVIDPGGDPQAVVDTLTKDGLRLEAIVNTHLHFDH 60

Query: 65  VGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLG 124
           + G A L+      I  P  D+  +  +V        + +      S   L+ G    L 
Sbjct: 61  IHGNAALQNATGAPIYAPSADETLLQTEVGA---GGFMGLPEVPPFSFTPLEPG-RWQLC 116

Query: 125 THIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKIL 184
               +V   PGH+ G V     E     +GD +F  S+GRTD   GD   L  S+  +I 
Sbjct: 117 GLDCRVLPTPGHTQGSVSLYFPELQAVFVGDLIFARSVGRTDFPGGDTATLAASVREQIF 176

Query: 185 PLGDEISFVCGHGPNSTIGRERRLNPFLKSN 215
            L  E     GHGP + +G E   NPF +  
Sbjct: 177 TLPAETVIYPGHGPQTRVGDEAAHNPFFQDG 207


>gi|317128381|ref|YP_004094663.1| beta-lactamase [Bacillus cellulosilyticus DSM 2522]
 gi|315473329|gb|ADU29932.1| beta-lactamase domain protein [Bacillus cellulosilyticus DSM 2522]
          Length = 212

 Score =  155 bits (393), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 61/211 (28%), Positives = 109/211 (51%), Gaps = 2/211 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           + +  + + P + N   ++  E+   V++DPGGD   + + ++S + H++ + +TH H D
Sbjct: 1   MKWKKLPLGPLQTNGYVVY--ENGTGVMIDPGGDEGRLLNWLKSEDIHIQAVLLTHAHFD 58

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+G   ++K++ S  +     +   ++      + L           ++  +     L +
Sbjct: 59  HIGAVERIKKEFSAPLYVHKNEQQWLVDPQLNGSGLFQGITPISVGEAEHLITKEGPLEV 118

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   F+V+  PGHSPG V Y   E++    GD LF   +GRTD+  G  + L+++I+NK 
Sbjct: 119 GPFTFQVYTTPGHSPGSVSYYLPESHVIFSGDVLFHGGVGRTDLPGGSQETLMDTIHNKF 178

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           L L DE     GHGP +TIG E+ +NPF+  
Sbjct: 179 LSLPDETIVANGHGPVTTIGEEKEINPFING 209


>gi|329955197|ref|ZP_08296154.1| metallo-beta-lactamase domain protein [Bacteroides clarus YIT
           12056]
 gi|328526196|gb|EGF53215.1| metallo-beta-lactamase domain protein [Bacteroides clarus YIT
           12056]
          Length = 212

 Score =  155 bits (393), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 65/214 (30%), Positives = 109/214 (50%), Gaps = 6/214 (2%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGG----DLDIIKDVIQSRNFHVKQIWITH 59
           +     +   F +NC  L+DE + EAVV+DPG     +   +K+ I     +VK +  TH
Sbjct: 1   MKIKRFEFNMFPENCYVLWDE-TNEAVVIDPGCFYEEEKQALKNFIIHNELNVKHLLNTH 59

Query: 60  GHVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGD 119
            H+DH+ G   + ++  L     ++ D   + +  +Q+R+   ++         +L DGD
Sbjct: 60  LHLDHIFGNPFMLKEFGLKAEA-NQADEFWIDEAPKQSRMFGFQLQEPPVPLGTYLHDGD 118

Query: 120 TLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSI 179
            +  G    +  H PGHSPG ++Y    ++    GD LF+ SIGR D+  G++ +LI  I
Sbjct: 119 IITFGNTELEAIHVPGHSPGSLVYYCAADHCMFSGDVLFQGSIGRADLAGGNFDELIEHI 178

Query: 180 NNKILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
            +++  L +E     GHG  +TIG E+  NPF +
Sbjct: 179 CSRLFILPNETIVYPGHGAPTTIGIEKAENPFFR 212


>gi|331697362|ref|YP_004333601.1| beta-lactamase domain-containing protein [Pseudonocardia
           dioxanivorans CB1190]
 gi|326952051|gb|AEA25748.1| beta-lactamase domain protein [Pseudonocardia dioxanivorans CB1190]
          Length = 230

 Score =  155 bits (393), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 69/220 (31%), Positives = 104/220 (47%), Gaps = 10/220 (4%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDL-DIIKDVIQSRNFHVKQIWITHGHV 62
           +         F+ NC  L  E     +VVDPG D  + +++++         + +THGH 
Sbjct: 1   MLVAGFPAGSFQTNCYVLAREAGEACIVVDPGQDAVEPLEELLAEHRLTPVAVLLTHGHF 60

Query: 63  DHVGGAAQLKEDLSLTIIGPHKDDAAMMGKV-----DEQARLLSIRMNARNASSDRWLQD 117
           DH    A + +   +     H DD  ++         E A     R+  R   S   L D
Sbjct: 61  DHTFSVAPVCDGNDIPAW-IHPDDRELLADPLKGISAESAAFFGGRLELREPRSVELLAD 119

Query: 118 GDTLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLG---DTLFRSSIGRTDILHGDYQQ 174
           G  L L     +V H PGH+PG V++    ++   +    DTLF  S+GRTD+  G ++Q
Sbjct: 120 GSDLQLAGLTLRVDHTPGHTPGSVVFTTPSDDGTEVILAGDTLFAGSVGRTDLPGGSHRQ 179

Query: 175 LINSINNKILPLGDEISFVCGHGPNSTIGRERRLNPFLKS 214
           L+ S+ +K+L   D    + GHGP +TIGRER  NPFL+ 
Sbjct: 180 LLASVRDKLLVRDDSGFVLPGHGPATTIGRERASNPFLQD 219


>gi|210616269|ref|ZP_03291019.1| hypothetical protein CLONEX_03240 [Clostridium nexile DSM 1787]
 gi|210149867|gb|EEA80876.1| hypothetical protein CLONEX_03240 [Clostridium nexile DSM 1787]
          Length = 206

 Score =  155 bits (393), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 56/209 (26%), Positives = 93/209 (44%), Gaps = 3/209 (1%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +      +     NC  + +EE+ E V++DP    D +   ++   +  K I +THGH D
Sbjct: 1   MKIEKYALGSLGTNCYLVENEETKELVIIDPAICPDYMISYVKRIGYEPKAILLTHGHFD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HV G     ++  + +     + A +       + +          +    L DG+ L+L
Sbjct: 61  HVMGIEGWTKEFDIPVYIYKDEAAILRDPALNLSSMFGTSYAYEKVTC---LSDGEKLVL 117

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
             + F+V H PGH+ G   Y   +      GDTLF  S+GR+D   G    L+ SI  K+
Sbjct: 118 AGYTFEVIHTPGHTSGGCCYYVKDEEVLFSGDTLFCRSVGRSDFPTGSASVLVKSIQEKL 177

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
             L D++    GH   + I  E++ NPF+
Sbjct: 178 FSLPDQVMVYPGHNDLTCIADEKQYNPFI 206


>gi|294628354|ref|ZP_06706914.1| metallo-beta-lactamase [Streptomyces sp. e14]
 gi|292831687|gb|EFF90036.1| metallo-beta-lactamase [Streptomyces sp. e14]
          Length = 235

 Score =  155 bits (393), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 61/220 (27%), Positives = 92/220 (41%), Gaps = 11/220 (5%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDI-IKDVIQSRNFHVKQIWITHGHV 62
           +         +  NC  +      E V++DPG      +++ ++        + +THGH+
Sbjct: 1   MLIAGFPAGAWGTNCYLVAPAAGEECVIIDPGHQAAPGVEEALKKHRLKPVAVVLTHGHI 60

Query: 63  DHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQ-----ARLLSIRMNARNASSDRWLQD 117
           DHV     +     +     H  D  MM   ++         L   +          L D
Sbjct: 61  DHVASVVPVCGAHGVPAW-IHPADRYMMSDPEKALGRSIGMPLMGELTVGEPDDVEELAD 119

Query: 118 GDTLLLGTHIFKVFHCPGHSPGHVIYVNF----ENNFAHLGDTLFRSSIGRTDILHGDYQ 173
           G  L L    F V H PGH+ G V +              GD LF  SIGRTD+  GD  
Sbjct: 120 GARLELAGLEFSVAHAPGHTKGSVTFRMPETADIPQVFFSGDLLFAGSIGRTDLPGGDMA 179

Query: 174 QLINSINNKILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           ++++S+    LPL D    + GHGP +TIG+ER  NP+L+
Sbjct: 180 EMLDSLARVCLPLDDSTVVLSGHGPQTTIGQERATNPYLR 219


>gi|53713315|ref|YP_099307.1| putative metallo-beta-lactamase [Bacteroides fragilis YCH46]
 gi|253565294|ref|ZP_04842749.1| conserved hypothetical protein [Bacteroides sp. 3_2_5]
 gi|265763390|ref|ZP_06091958.1| conserved hypothetical protein [Bacteroides sp. 2_1_16]
 gi|52216180|dbj|BAD48773.1| putative metallo-beta-lactamase [Bacteroides fragilis YCH46]
 gi|251945573|gb|EES85980.1| conserved hypothetical protein [Bacteroides sp. 3_2_5]
 gi|263255998|gb|EEZ27344.1| conserved hypothetical protein [Bacteroides sp. 2_1_16]
          Length = 212

 Score =  155 bits (392), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 66/214 (30%), Positives = 111/214 (51%), Gaps = 6/214 (2%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGG----DLDIIKDVIQSRNFHVKQIWITH 59
           +     +   F  NC  L+DE + EAVV+DPG     +   +K+ I + N ++K +  TH
Sbjct: 1   MKIKRFEFNMFPVNCYVLWDE-TNEAVVIDPGCFYDEEKQALKNFIVTNNLNIKHLLNTH 59

Query: 60  GHVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGD 119
            H+DH+ G   +  +  L+    ++ D   + +  +Q+R+   ++N       ++L DGD
Sbjct: 60  LHLDHIFGNPFMLREFGLSAEA-NQADEYWIDEAPKQSRMFGFQLNEAPVPLGKYLHDGD 118

Query: 120 TLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSI 179
            +  G    +  H PGHSPG ++Y    +N    GD LF+ SIGR D+  G++ +L   I
Sbjct: 119 IITFGNTTLEAIHVPGHSPGSLVYYCRADNCMFSGDVLFQGSIGRADLAGGNFDELKEHI 178

Query: 180 NNKILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
            +++  L +E     GHG  +TIG E+  NPF +
Sbjct: 179 CSRLFVLPNETIVYPGHGAPTTIGIEKAENPFFR 212


>gi|150016420|ref|YP_001308674.1| beta-lactamase domain-containing protein [Clostridium beijerinckii
           NCIMB 8052]
 gi|149902885|gb|ABR33718.1| beta-lactamase domain protein [Clostridium beijerinckii NCIMB 8052]
          Length = 198

 Score =  155 bits (392), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 71/209 (33%), Positives = 108/209 (51%), Gaps = 11/209 (5%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +    +    +++NC  + DE + E  ++DPGG  ++I+  I   +   K I +THGH+D
Sbjct: 1   MIIKTLIAGMYEENCYLIMDEGTKELAIIDPGGQPNLIEKEISRLDGKPKFILLTHGHMD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG   +L   L++       ++  M              +      + ++L++GDT+ L
Sbjct: 61  HVGAVIELMNKLNIPFYISENEEQYMKND---------EFVFGSLPKASKYLKEGDTVSL 111

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G +I KV    GH+          N+    GDTLF+ SIGR+D   G+  QLI +I  K+
Sbjct: 112 GNNIIKVIETAGHT--AGGICFLVNDELFTGDTLFQGSIGRSDFPGGNGAQLIKNIKEKL 169

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           LPLGD +    GHGP STIG E+R NPFL
Sbjct: 170 LPLGDGVKVYPGHGPASTIGYEKRNNPFL 198


>gi|313902175|ref|ZP_07835584.1| Putative metal-binding hydrolase [Thermaerobacter subterraneus DSM
           13965]
 gi|313467575|gb|EFR63080.1| Putative metal-binding hydrolase [Thermaerobacter subterraneus DSM
           13965]
          Length = 220

 Score =  155 bits (392), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 73/214 (34%), Positives = 107/214 (50%), Gaps = 7/214 (3%)

Query: 2   SKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGH 61
             L      + P + N   L D+    AV+VD   D D + + +  R + V  + +TH H
Sbjct: 3   PTLRVLAFPLGPVQANGYVLLDDAGKVAVLVDAPHDPDPMLEAV--RGYRVAAVLLTHAH 60

Query: 62  VDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
            DH+GG   +KE     +   H+++A+ +G    Q  L           +D  L+ G+ L
Sbjct: 61  FDHIGGLQAIKEATGAPVW-IHRNEASWLGDP--QLNLSVWLEPVVAPPADHLLEGGERL 117

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNF--AHLGDTLFRSSIGRTDILHGDYQQLINSI 179
             G+  F+V   PGHSPGHV+YV           GDTLF   IGRTD+  GD + L+ SI
Sbjct: 118 AFGSMEFEVRFTPGHSPGHVVYVGRGAAEGLVLAGDTLFAGGIGRTDLPGGDLETLLQSI 177

Query: 180 NNKILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
           + +++ L D    + GHGP + IG ER  NPFL+
Sbjct: 178 HRELMVLPDATRVLPGHGPETRIGTERVANPFLR 211


>gi|297568309|ref|YP_003689653.1| Hydroxyacylglutathione hydrolase [Desulfurivibrio alkaliphilus
           AHT2]
 gi|296924224|gb|ADH85034.1| Hydroxyacylglutathione hydrolase [Desulfurivibrio alkaliphilus
           AHT2]
          Length = 213

 Score =  155 bits (392), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 74/214 (34%), Positives = 102/214 (47%), Gaps = 7/214 (3%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +    + V      C  L  E+S +A+ +DPGGD  +I D  +  N  +K +  THGH D
Sbjct: 1   MQITQLTVGSMGVCCYLLACEDSSQAMAIDPGGDEALILDHCRRNNLQLKMLVCTHGHPD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HV   A LKE     I+   +D A       E  +  S+     +   DR +QD DT+ L
Sbjct: 61  HVAANAALKEATGAEIVMHREDAAFF--GKPEVGQYFSMLGLPPSPPPDRLVQDRDTIEL 118

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G+   +V H PGH+PG      +       GDTLF  ++GRTD   GD   L++SI  ++
Sbjct: 119 GSIKLEVIHTPGHTPGG--ICLYSPPHLFSGDTLFVGAVGRTDFPGGDTATLVDSIRQRL 176

Query: 184 LPLGDEISFVCGHGP---NSTIGRERRLNPFLKS 214
           L L  E     GHG     STI  E   NPFL+ 
Sbjct: 177 LVLPPETVVWPGHGYGGSQSTIAAEAAENPFLQE 210


>gi|315126518|ref|YP_004068521.1| enzyme with metallo-hydrolase/oxidoreductase domain
           [Pseudoalteromonas sp. SM9913]
 gi|315015032|gb|ADT68370.1| putative enzyme with metallo-hydrolase/oxidoreductase domain
           [Pseudoalteromonas sp. SM9913]
          Length = 213

 Score =  155 bits (392), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 82/209 (39%), Positives = 121/209 (57%), Gaps = 1/209 (0%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +    + VTPF QNC  +  E++ +AV VDPGGD + I   ++  N  +  IW+THGH+D
Sbjct: 1   MKIITIPVTPFMQNCRIIVCEQTQQAVAVDPGGDAEKINASLKQHNLSLAAIWLTHGHLD 60

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVG A  L+E   + +IGPH+++      +  QA +        +   D WL  GD++ +
Sbjct: 61  HVGAAHNLREQHKVKMIGPHENERFWFDNLPMQATMFGF-KPINSFYPDEWLAHGDSIKV 119

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G   FKV HCPGH+PGHV++    +N   +GD +F+ SIGRTD   GD +QLI SI   I
Sbjct: 120 GQLEFKVLHCPGHAPGHVVFYQQAHNTVIVGDVIFKGSIGRTDFPKGDSKQLIESIMQHI 179

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           + L    + + GHG N+ +  E+  NPF+
Sbjct: 180 MTLPPNTAILSGHGDNTHVAHEQATNPFV 208


>gi|325278893|ref|YP_004251435.1| beta-lactamase domain-containing protein [Odoribacter splanchnicus
           DSM 20712]
 gi|324310702|gb|ADY31255.1| beta-lactamase domain protein [Odoribacter splanchnicus DSM 20712]
          Length = 212

 Score =  155 bits (392), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 65/214 (30%), Positives = 107/214 (50%), Gaps = 6/214 (2%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGG----DLDIIKDVIQSRNFHVKQIWITH 59
           +   I    P+++N   L+D  + EAV++D G     +   ++D +  +      +  TH
Sbjct: 1   MEIKIFVNNPWQENTVVLYDR-TGEAVIIDCGCFSGEEERRLQDFLSQKKLKPVALLDTH 59

Query: 60  GHVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGD 119
            H+DH+ G   +K    L+      +D  ++    E A +L +       +  ++L+DGD
Sbjct: 60  LHIDHIFGNNFIKNTYGLSAQAS-DEDNFLIENAVEYAAMLGVTGITPPPAVGKFLKDGD 118

Query: 120 TLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSI 179
            +  G    +V    GHSPG + Y +  +     GD LF  S+GR+D+  G+ + LI  I
Sbjct: 119 RVRFGESELEVIAVGGHSPGGLCYYSSADRLLIAGDVLFAGSVGRSDLPGGNARVLIEGI 178

Query: 180 NNKILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
             K+L L DE+  + GHGP +TIG E+R NPFL 
Sbjct: 179 RRKLLCLPDEVKVIPGHGPATTIGEEKRYNPFLN 212


>gi|153810164|ref|ZP_01962832.1| hypothetical protein RUMOBE_00545 [Ruminococcus obeum ATCC 29174]
 gi|149833343|gb|EDM88424.1| hypothetical protein RUMOBE_00545 [Ruminococcus obeum ATCC 29174]
          Length = 209

 Score =  155 bits (391), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 62/212 (29%), Positives = 103/212 (48%), Gaps = 3/212 (1%)

Query: 1   MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG 60
           M +L      V     NC FL ++E+ E ++VDPG + D I+  +         I +THG
Sbjct: 1   MKRLDLQKCIVGSVFTNCYFLKNKETEEMLIVDPGDNADRIEQKVLEMQGRPVAILLTHG 60

Query: 61  HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT 120
           H DH+  A ++K+  ++ I    K++  +    D +  L +  M++    +D +L D   
Sbjct: 61  HFDHILAAEEIKKKYNIPIYACAKEEKTLQ---DPRINLTAFHMSSYTLKADVYLTDLQV 117

Query: 121 LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN 180
           + L     ++   PGH+ G   Y   +      GDT+F  S+GRTD   G    ++NS++
Sbjct: 118 VELAGFSVQMIETPGHTLGSCCYYLKDEGVLFSGDTVFCGSVGRTDFPEGSTAAIVNSLH 177

Query: 181 NKILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
             +  L D      GH  ++TIG E+R NPF+
Sbjct: 178 RLLEALPDNTEVYPGHDTSTTIGYEKRYNPFV 209


>gi|271967381|ref|YP_003341577.1| beta-lactamase-like protein [Streptosporangium roseum DSM 43021]
 gi|270510556|gb|ACZ88834.1| beta-lactamase-like protein [Streptosporangium roseum DSM 43021]
          Length = 231

 Score =  155 bits (391), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 64/219 (29%), Positives = 97/219 (44%), Gaps = 11/219 (5%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDL-DIIKDVIQSRNFHVKQIWITHGHV 62
           +         F+ NC  +      E V+VDPG +    + DV++        + +THGH+
Sbjct: 1   MLIAGFPAGSFQTNCYVVAPAAGEECVIVDPGQNAVGDLDDVLREHRLKPVAVLVTHGHI 60

Query: 63  DHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDE-----QARLLSIRMNARNASSDRWLQD 117
           DH+   A +     +     H +D  ++    +       + L   +        R L D
Sbjct: 61  DHMWSVAPVCGARDVPAW-IHPEDRDLLSDPGKGLSLATKQQLFGGLTFTEPDDVRELAD 119

Query: 118 GDTLLLGTHIFKVFHCPGHSPGHVIYV----NFENNFAHLGDTLFRSSIGRTDILHGDYQ 173
           G+ L L      V H PGH+ G V +         +    GD LF  SIGRTD+  GDY 
Sbjct: 120 GEVLRLAGMELTVDHTPGHTRGSVTFRLPSTEEIPDVLFSGDLLFAGSIGRTDLPGGDYP 179

Query: 174 QLINSINNKILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
            ++ S+  K LPL ++   + GHGP +TIG ER  NP+L
Sbjct: 180 TILRSLATKCLPLPEDTVVLPGHGPQTTIGHERATNPYL 218


>gi|182420397|ref|ZP_02951619.1| metallo-beta-lactamase family protein [Clostridium butyricum 5521]
 gi|237668438|ref|ZP_04528422.1| hydroxyacylglutathione hydrolase [Clostridium butyricum E4 str.
           BoNT E BL5262]
 gi|182375763|gb|EDT73361.1| metallo-beta-lactamase family protein [Clostridium butyricum 5521]
 gi|237656786|gb|EEP54342.1| hydroxyacylglutathione hydrolase [Clostridium butyricum E4 str.
           BoNT E BL5262]
          Length = 199

 Score =  155 bits (391), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 69/209 (33%), Positives = 108/209 (51%), Gaps = 11/209 (5%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           L+   V    ++ NC  L D E+ +  ++D GGD   I   ++S   + K + +THGH D
Sbjct: 2   LNLKTVPAGVYEANCYILVDSETKDCAIIDAGGDAGKISAAVESMQGNPKYLLLTHGHFD 61

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           HVGG  ++     +            + K DE+       +      +  +L++GD + L
Sbjct: 62  HVGGVKEICSKYDIP---------FYISKTDEEYMEKDNSVFGTLPKASGYLKEGDVVKL 112

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G+   KV   PGH+          +     GDTLF+ SIGRTD + GD +++I+SI NK+
Sbjct: 113 GSREIKVIETPGHT--KGGLCFLIDGKLFTGDTLFQGSIGRTDFIGGDMKEIISSIKNKL 170

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           LPLGD++    GHGP+S+I  E+  NP+L
Sbjct: 171 LPLGDDVEVYPGHGPSSSIKFEKMRNPYL 199


>gi|118444608|ref|YP_877919.1| metallo-beta-lactamase family protein [Clostridium novyi NT]
 gi|118135064|gb|ABK62108.1| metallo-beta-lactamase family protein [Clostridium novyi NT]
          Length = 199

 Score =  155 bits (391), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 72/209 (34%), Positives = 104/209 (49%), Gaps = 10/209 (4%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +    +    +  NC  L D    E  ++DPGGD D++   I + N  VK I +THGH+D
Sbjct: 1   MKIKRIPAGMYGANCYILID--GNEGCIIDPGGDADMLIRNIDALNIDVKFILLTHGHMD 58

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H GG  +LK+  ++ +     D   M         + +          D+ ++DGD L L
Sbjct: 59  HTGGVQELKDRYNVPVYINENDLELMRKHSQVFGPIWN------ETEEDKTIKDGDVLKL 112

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
           G    K    PGH+PG + +V  +  F   GDTLFR S+GRTD   GD+  LI SI  K+
Sbjct: 113 GNLEIKCLETPGHTPGGMSFVVKDVVF--TGDTLFRGSVGRTDFPGGDHSALIRSIKEKL 170

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           + L D+   + GH   S I  E++ NPFL
Sbjct: 171 IVLDDDTVVLPGHEGESNIKFEKQYNPFL 199


>gi|189466164|ref|ZP_03014949.1| hypothetical protein BACINT_02534 [Bacteroides intestinalis DSM
           17393]
 gi|189434428|gb|EDV03413.1| hypothetical protein BACINT_02534 [Bacteroides intestinalis DSM
           17393]
          Length = 212

 Score =  155 bits (391), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 67/214 (31%), Positives = 110/214 (51%), Gaps = 6/214 (2%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLD----IIKDVIQSRNFHVKQIWITH 59
           +     +   F  NC  L+D ++LEA V+DPG   +     +K+ I   + +VK +  TH
Sbjct: 1   MKIKRFEFNMFPVNCYVLWD-DTLEATVIDPGCYYEEEKQALKNFIIKNSLNVKHLLNTH 59

Query: 60  GHVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGD 119
            H+DH+ G A + ++  L +   +K D   + +  +Q+R+     N   A    +L DGD
Sbjct: 60  LHLDHIFGNAFMVKEFGLQVEA-NKADEFWIDEAPKQSRMFGFHWNELPAPIGHYLHDGD 118

Query: 120 TLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSI 179
            +  G    +  H PGHSPG ++Y    ++    GD LF+ SIGR D+  G++ +L   I
Sbjct: 119 IISFGNTTLEAIHVPGHSPGSLVYYCAADHCMFSGDVLFQGSIGRADLTGGNFDELKEHI 178

Query: 180 NNKILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
            +++  L +E     GHG  +TIG E+  NPF +
Sbjct: 179 CSRLFVLPNETIVYPGHGAPTTIGIEKAENPFFR 212


>gi|332879369|ref|ZP_08447066.1| metallo-beta-lactamase domain protein [Capnocytophaga sp. oral
           taxon 329 str. F0087]
 gi|332682789|gb|EGJ55689.1| metallo-beta-lactamase domain protein [Capnocytophaga sp. oral
           taxon 329 str. F0087]
          Length = 215

 Score =  155 bits (391), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 69/214 (32%), Positives = 102/214 (47%), Gaps = 6/214 (2%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPG----GDLDIIKDVIQSRNFHVKQIWITH 59
           L    + V   ++NC  + D ++ EAVV+D G     D   I D I+ R   V+    TH
Sbjct: 2   LDIKKIPVNMLEENCYVVSD-DTREAVVIDCGALTDDDRRRITDYIEDRRLQVRHHLCTH 60

Query: 60  GHVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQA-RLLSIRMNARNASSDRWLQDG 118
            H DH  GAA + E   +       D+    G   E    L  +       ++ R+L +G
Sbjct: 61  MHYDHCFGAAFMWETFHVGPEFNRADEPIYKGMGAEIFGPLAQVMKEGLTPAAARYLTEG 120

Query: 119 DTLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINS 178
           D +L G H   V   PGH+PG + +         +GDTLF  S+GRTD   GD + L  S
Sbjct: 121 DDILFGHHKLTVLSTPGHTPGGICFYCAAEKAVFVGDTLFYCSVGRTDFPGGDSEALCES 180

Query: 179 INNKILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           + NK+  L ++     GHGP++ IG E+  NP++
Sbjct: 181 VRNKLFTLPEDTRVYPGHGPHTEIGFEKAHNPYI 214


>gi|107100289|ref|ZP_01364207.1| hypothetical protein PaerPA_01001314 [Pseudomonas aeruginosa PACS2]
          Length = 197

 Score =  155 bits (391), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 69/201 (34%), Positives = 105/201 (52%), Gaps = 4/201 (1%)

Query: 14  FKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLKE 73
            + NCT + D  + +A+VVDPGGD ++I   +      V  I  TH H+DH   + ++K+
Sbjct: 1   MQCNCTIIGDPLTRKAIVVDPGGDHEMILQRLDRLGLQVVSIIHTHAHLDHFLASGEMKK 60

Query: 74  DLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFKVFHC 133
               ++   HKDD  +   ++ Q +L  +      A  DRWL D + L  G       H 
Sbjct: 61  RTGASLH-LHKDDQFLWDNLEMQCQLFGVPYTPVPA-PDRWLADDEELACGC--GVALHT 116

Query: 134 PGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEISFV 193
           PGH+PG + +          GDTLFR  IGRTD+  GD   +  SI  ++  L ++ + V
Sbjct: 117 PGHTPGSMSFWFPRAKLLIAGDTLFRRGIGRTDLWGGDSAAIQRSIRQRLYSLDEDATVV 176

Query: 194 CGHGPNSTIGRERRLNPFLKS 214
            GHGP++T+G E R NPF++ 
Sbjct: 177 AGHGPDTTLGEEMRENPFVRG 197


>gi|332703111|ref|ZP_08423199.1| beta-lactamase domain protein [Desulfovibrio africanus str. Walvis
           Bay]
 gi|332553260|gb|EGJ50304.1| beta-lactamase domain protein [Desulfovibrio africanus str. Walvis
           Bay]
          Length = 208

 Score =  155 bits (391), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 56/209 (26%), Positives = 89/209 (42%), Gaps = 6/209 (2%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVD 63
           +      + P + N   +  + +  A+ +DPGGD   I D ++    +++ I  TH H D
Sbjct: 1   MRVTSFALGPLETNAYVV--DNAGRALAIDPGGDPREILDFLRDEKLNLETILATHLHFD 58

Query: 64  HVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLL 123
           H+ G A L +     I+   + D  ++         +              L++G     
Sbjct: 59  HIFGNAALAKATGAPIMAS-RADEFLLDTPVGGGGFMGFPK--VPDFEFTPLEEGPA-EF 114

Query: 124 GTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKI 183
                 V   PGH+PG + +   E     +GD LF  S+GRTD   G  + L  S+ +KI
Sbjct: 115 IGLACHVLATPGHTPGSLSFHFPEGRSVFVGDLLFYRSVGRTDFPGGSLEALKRSVRDKI 174

Query: 184 LPLGDEISFVCGHGPNSTIGRERRLNPFL 212
             L  E     GHGP +++G E   NPFL
Sbjct: 175 FSLPKETVVYSGHGPETSVGDEELNNPFL 203


>gi|313893093|ref|ZP_07826670.1| metallo-beta-lactamase domain protein [Veillonella sp. oral taxon
           158 str. F0412]
 gi|313442446|gb|EFR60861.1| metallo-beta-lactamase domain protein [Veillonella sp. oral taxon
           158 str. F0412]
          Length = 211

 Score =  154 bits (390), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 61/214 (28%), Positives = 99/214 (46%), Gaps = 7/214 (3%)

Query: 1   MSK--LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWIT 58
           MS+  L    + + P   NC  + D+   EA ++DP      + D ++  +   K + +T
Sbjct: 1   MSEQQLVLMRMPLGPLGTNCYVIGDKAVGEAFIIDPATS--EVLDALKKHDLKPKAVLLT 58

Query: 59  HGHVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDG 118
           HGH DH+GG   +     + +   HK D   +   +      S     +  +    ++ G
Sbjct: 59  HGHSDHIGGVQDIVNTHHVPVY-VHKGDVPYLSDPELNLSAYSNPTPIKVQADLIEVKQG 117

Query: 119 DTLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINS 178
           D +  G    +V   PGH+PG      +      +GDTLFR S+GRTD  +G Y+ L+ S
Sbjct: 118 DHITCGDIDLEVLETPGHTPGG--VCYYMEGLVFVGDTLFRDSVGRTDFPNGSYETLMES 175

Query: 179 INNKILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           I  ++  L +      GHGP S I  E++ NPF+
Sbjct: 176 IKTQLYKLPNNTMVYPGHGPESNIEYEKQYNPFV 209


>gi|218779831|ref|YP_002431149.1| beta-lactamase domain protein [Desulfatibacillum alkenivorans
           AK-01]
 gi|218761215|gb|ACL03681.1| beta-lactamase domain protein [Desulfatibacillum alkenivorans
           AK-01]
          Length = 221

 Score =  154 bits (390), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 74/219 (33%), Positives = 110/219 (50%), Gaps = 10/219 (4%)

Query: 2   SKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGH 61
             +    + V  ++ NC  +   +++EAVV+DPG +   I   ++    +VK I  THGH
Sbjct: 6   KTMDIKTLAVGAYQANCYIVACLKTMEAVVIDPGAEEARIAAAVKMMGCNVKMILATHGH 65

Query: 62  VDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTL 121
            DHV GA  L + L++ I   H+DD +    +           ++R   +D   +DG   
Sbjct: 66  GDHVMGAKGLADMLNVPI-AMHEDDVSFFQGI---YMDRPPSQSSRYPQTDIQFKDGRIF 121

Query: 122 LLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINN 181
            +G   FKV H PGHSPG         ++   GDTLF   +GRTD+     Q L+NS+ +
Sbjct: 122 EIGELQFKVLHTPGHSPGS--CCFLCGDYLFTGDTLFVEGVGRTDMGGMTLQDLLNSVES 179

Query: 182 KILPLGDEISFVCGHG----PNSTIGRERRLNPFLKSNI 216
           KILPL  E   + GH     P STI RE+  NP+++  I
Sbjct: 180 KILPLPGETIILPGHDYGPAPTSTIAREKANNPYIRDFI 218


>gi|325297808|ref|YP_004257725.1| beta-lactamase domain-containing protein [Bacteroides salanitronis
           DSM 18170]
 gi|324317361|gb|ADY35252.1| beta-lactamase domain protein [Bacteroides salanitronis DSM 18170]
          Length = 212

 Score =  154 bits (390), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 69/214 (32%), Positives = 107/214 (50%), Gaps = 6/214 (2%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGG----DLDIIKDVIQSRNFHVKQIWITH 59
           +     +   F  NC  L DE + EAVV+D G     +   +K  I   +  +K +  TH
Sbjct: 1   MIIKRFEFNMFPVNCYVLSDE-TGEAVVIDAGCYYPEEQQKLKQYINGNHLRIKHLLNTH 59

Query: 60  GHVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGD 119
            H+DHV G   +  + +L      KD+  ++ ++  Q        N        ++ DGD
Sbjct: 60  LHLDHVFGNPFMLREFNLRAEANRKDE-FLLDRLPAQCHAFGFPPNEPPVPLGGYVSDGD 118

Query: 120 TLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSI 179
            +  G    K  H PGHSPG ++Y +  ++ A  GD LFR SIGR D+  GD+ +L++ I
Sbjct: 119 IIRFGNTELKAIHVPGHSPGSIVYYDAAHSCAFSGDVLFRGSIGRADLEGGDFGELMDGI 178

Query: 180 NNKILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
            +K+  L DE     GHG ++TIG+E+  NP+ K
Sbjct: 179 VSKLFTLPDETVVYPGHGDSTTIGKEKIDNPYFK 212


>gi|153006430|ref|YP_001380755.1| beta-lactamase domain-containing protein [Anaeromyxobacter sp.
           Fw109-5]
 gi|152030003|gb|ABS27771.1| beta-lactamase domain protein [Anaeromyxobacter sp. Fw109-5]
          Length = 217

 Score =  154 bits (390), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 73/203 (35%), Positives = 105/203 (51%), Gaps = 3/203 (1%)

Query: 10  QVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAA 69
            V PF  N      + + EA++VDPGG+   +  +++   + V +I  THGH+DHV GAA
Sbjct: 8   VVGPFAANAYVAACDRTGEALLVDPGGETARVLALVEP-GWRVVRIVCTHGHIDHVAGAA 66

Query: 70  QLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFK 129
           + KE     +   H  DA  +  +  QA +         A       DG++  +G    +
Sbjct: 67  EAKEATGAPVS-LHAGDAGWLEALPRQAEMFGFEPVVAPAVDHHP-GDGESFRVGASEGR 124

Query: 130 VFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDE 189
           V H PGHSPG +     +      GDTLF  S+GRTD+  GD+  L  SI  K+ PLGD+
Sbjct: 125 VIHTPGHSPGSICLFFPQERLLFSGDTLFAGSVGRTDLPGGDFDALHASITGKLFPLGDD 184

Query: 190 ISFVCGHGPNSTIGRERRLNPFL 212
           + F+ GHGP   +G ER  NPF+
Sbjct: 185 VRFLPGHGPAGVVGEERLSNPFV 207


>gi|256391559|ref|YP_003113123.1| beta-lactamase domain-containing protein [Catenulispora acidiphila
           DSM 44928]
 gi|256357785|gb|ACU71282.1| beta-lactamase domain protein [Catenulispora acidiphila DSM 44928]
          Length = 231

 Score =  154 bits (390), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 64/219 (29%), Positives = 93/219 (42%), Gaps = 11/219 (5%)

Query: 4   LSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDL-DIIKDVIQSRNFHVKQIWITHGHV 62
           +            NC  +      + V++DPG D    ++D ++        I +THGHV
Sbjct: 1   MLVAGFPAGSLGANCYLVAPAAGEQCVIIDPGEDAVPGVEDAVREHGLQPVAILLTHGHV 60

Query: 63  DHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARL-----LSIRMNARNASSDRWLQD 117
           DH      +  D  +     H  D  M+    +   +     +  +      S  + L D
Sbjct: 61  DHTMSVVPVCGDYGVP-AYIHPGDREMLTDPQKWLGIAPGTKVFGQSKFVEPSDVKELTD 119

Query: 118 GDTLLLGTHIFKVFHCPGHSPGHVIYVNFENNFA----HLGDTLFRSSIGRTDILHGDYQ 173
           G  L L      V H PGH+ G V +   E        + GD LF  ++GR D+  GD  
Sbjct: 120 GVVLNLAGLEITVDHTPGHTKGSVTFRTPEQQDIPQVLYTGDLLFAGAVGRWDLPGGDRD 179

Query: 174 QLINSINNKILPLGDEISFVCGHGPNSTIGRERRLNPFL 212
           +L+ S+    LPL DE   + GHGP +TIGRER  NPFL
Sbjct: 180 ELLASLARVCLPLPDETVVLSGHGPQTTIGRERATNPFL 218


>gi|15615383|ref|NP_243686.1| hypothetical protein BH2820 [Bacillus halodurans C-125]
 gi|10175441|dbj|BAB06539.1| BH2820 [Bacillus halodurans C-125]
          Length = 211

 Score =  154 bits (390), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 59/209 (28%), Positives = 107/209 (51%), Gaps = 1/209 (0%)

Qu