RPSBLAST alignment for GI: 254780758 and conserved domain: pfam00753

>gnl|CDD|144377 pfam00753, Lactamase_B, Metallo-beta-lactamase superfamily. Length = 148
 Score = 77.8 bits (191), Expect = 2e-15
 Identities = 40/151 (26%), Positives = 62/151 (41%), Gaps = 8/151 (5%)

Query: 11  VTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFH---VKQIWITHGHVDHVGG 67
                 N   +  +    A+++D G   D    ++ +       +  I +TH H DH+GG
Sbjct: 1   GGGVGSNSYLVEGDG--GAILIDTGLGADDALLLLAALGLDPKDIDAIILTHAHADHIGG 58

Query: 68  AAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHI 127
             +LKE     ++   +D AA++    + A L   R        D  L+ GD +L G  +
Sbjct: 59  LPELKEATPAPVVAAPEDAAALLRLGLDDAEL---RKLVDVLPPDVDLEGGDGILGGGTL 115

Query: 128 FKVFHCPGHSPGHVIYVNFENNFAHLGDTLF 158
             V   PGH PGHV+           GD LF
Sbjct: 116 LFVTPHPGHGPGHVVVYLPGGKVLFTGDLLF 146