RPSBLAST alignment of GI: 254780758 and protein with PDBid: 1ycg

>1ycg_A Nitric oxide reductase; DIIRON site, oxidoreductase; HET: FMN; 2.80A {Moorella thermoacetica} SCOP: c.23.5.1 d.157.1.3 PDB: 1ycf_A* 1ych_A* Length = 398
 Score = 67.9 bits (165), Expect = 2e-12
 Identities = 25/227 (11%), Positives = 57/227 (25%), Gaps = 43/227 (18%)

Query: 17  NCTFLFDEESLEAVVVDPGGD------LDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQ 70
           N   + D++     +VD   +      +  +K +       +  + + H   DH G    
Sbjct: 37  NAYLIVDDK---TALVDTVYEPFKEELIAKLKQIKDPVK--LDYLVVNHTESDHAGAFPA 91

Query: 71  LKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFKV 130
           + E      +   +     +               +    +   ++ G ++ LG      
Sbjct: 92  IMELCPDAHVLCTQRAFDSL-----------KAHYSHIDFNYTIVKTGTSVSLGKRSLTF 140

Query: 131 FHCP-GHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDI-------------------LHG 170
              P  H P  +     E       D   +                           +  
Sbjct: 141 IEAPMLHWPDSMFTYVPEEALLLPNDAFGQHIATSVRFDDQVDAGLIMDEAAKYYANILM 200

Query: 171 DYQQLINSINNKILPLGDEISFVC-GHGPNSTIGRERRLNPFLKSNI 216
            +  LI    ++I  +   I  +   HG        R +  + +   
Sbjct: 201 PFSNLITKKLDEIQKINLAIKTIAPSHGIIWRKDPGRIIEAYARWAE 247