RPSBLAST alignment of GI: 254780758 and protein with PDBid: 2fhx

>2fhx_A SPM-1; metallo-beta-lactamase, dinuclear zinc, antibiotic resistance, structure, hydrolase, metal binding protein; 1.90A {Pseudomonas aeruginosa} Length = 246
 Score = 61.6 bits (148), Expect = 1e-10
 Identities = 26/218 (11%), Positives = 56/218 (25%), Gaps = 21/218 (9%)

Query: 6   FHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSR----NFHVKQIWITHGH 61
           F +     +  N       +    V+V    +    + ++                TH H
Sbjct: 20  FVVTDRDFYSSNVLVAKMLDG-TVVIVSSPFENLGTQTLMDWVAKTMKPKKVVAINTHFH 78

Query: 62  VDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARN-----------AS 110
           +D  GG    K+  + T          +     ++ +      N              A 
Sbjct: 79  LDGTGGNEIYKKMGAETWSSDLTKQLRLEENKKDRIKAAEFYKNEDLKRRILSSHPVPAD 138

Query: 111 SDRWLQDGDTLLLGTHIFKVFHCPGHSPGHVIYVNFENNFA-HLGDTLFRSSIGRTDILH 169
           +   L+ G        + +V           + V F        G  +    +G      
Sbjct: 139 NVFDLKQGKVFSFSNELVEVSFPGPAHSPDNVVVYFPKKKLLFGGCMIKPKELGYLG--D 196

Query: 170 GDYQQLINSINNKILPLGDEISFVCGHGPNSTIGRERR 207
            + +   +S   ++     +I  + GHG         +
Sbjct: 197 ANVKAWPDSA-RRLKKFDAKI-VIPGHGEWGGPEMVNK 232