RPSBLAST alignment of GI: 254780758 and protein with PDBid: 2gcu

>2gcu_A Putative hydroxyacylglutathione hydrolase 3; ethylmalonic encephalopathy, ETHE1, structural genomics, protein structure initiative; 1.48A {Arabidopsis thaliana} Length = 245
 Score = 76.9 bits (188), Expect = 3e-15
 Identities = 51/205 (24%), Positives = 73/205 (35%), Gaps = 32/205 (15%)

Query: 23  DEESLEAVVVDPGG-DLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLKEDLSLTIIG 81
                 A+++DP    +D    +I      +     TH H DHV G   LK  L      
Sbjct: 24  SHPDKPALLIDPVDKTVDRDLKLIDELGLKLIYAMNTHVHADHVTGTGLLKTKLPGVKSV 83

Query: 82  PHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFKVFHCPGHSPGHV 141
             K   +                       D +L+ GD + +G    +V   PGH+ G V
Sbjct: 84  ISKASGSKA---------------------DLFLEPGDKVSIGDIYLEVRATPGHTAGCV 122

Query: 142 IYVNFEN------NFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPLGDEISFVCG 195
            YV  E         A  GD +     GRTD   G   QL  S++++I  L  +      
Sbjct: 123 TYVTGEGADQPQPRMAFTGDAVLIRGCGRTDFQEGSSDQLYESVHSQIFTLPKDTLIYPA 182

Query: 196 HGPN----STIGRERRLNPFLKSNI 216
           H       ST+G E + NP L  + 
Sbjct: 183 HDYKGFEVSTVGEEMQHNPRLTKDK 207