RPSBLAST alignment of GI: 254780758 and protein with PDBid: 2p97

>2p97_A Hypothetical protein; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.65A {Anabaena variabilis atcc 29413} SCOP: d.157.1.12 Length = 201
 Score = 74.2 bits (181), Expect = 2e-14
 Identities = 36/199 (18%), Positives = 61/199 (30%), Gaps = 32/199 (16%)

Query: 13  PFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLK 72
               N       E    +++DP    +     ++        +WI   + DHV  A ++ 
Sbjct: 21  NIDFNGFAWIRPE--GNILIDPVALSNHDWKHLE---SLGGVVWIVLTNSDHVRSAKEIA 75

Query: 73  EDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTHIFKVFH 132
           +     I GP  +        D                  RWL DGD         KV  
Sbjct: 76  DQTYTKIAGPVAEKENFPIYCD------------------RWLSDGDE---LVPGLKVME 114

Query: 133 CPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRT----DILHGDYQQLINSINNKILPLGD 188
             G      + +  E      GD +     G      D    + Q+++ S+  ++  L  
Sbjct: 115 LQGSKTPGELALLLEETTLITGDLVRAYRAGGLEILPDEKLMNKQKVVASV-RRLAALEK 173

Query: 189 EISFVCGHG-PNSTIGRER 206
             + + G G      GR+R
Sbjct: 174 VEAVLVGDGWSVFRDGRDR 192