RPSBLAST alignment of GI: 254780758 and protein with PDBid: 2qed

>2qed_A Hydroxyacylglutathione hydrolase; metallo-B- lactamase superfamily; 1.45A {Salmonella typhimurium LT2} SCOP: d.157.1.2 Length = 258
 Score = 83.0 bits (204), Expect = 5e-17
 Identities = 54/247 (21%), Positives = 88/247 (35%), Gaps = 62/247 (25%)

Query: 5   SFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDH 64
           S ++  +  F+ N  ++   +    V+VDPG    ++   I    +  + I++TH H DH
Sbjct: 7   SMNLNSIPAFQDNYIWVLTNDEGRCVIVDPGEAAPVL-KAIAEHKWMPEAIFLTHHHHDH 65

Query: 65  VGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLG 124
           VGG  +L +      +    +                         +   + DGDT+ + 
Sbjct: 66  VGGVKELLQHFPQMTVYGPAETQDKG--------------------ATHLVGDGDTIRVL 105

Query: 125 THIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKIL 184
              F +F  PGH+ GHV Y  F   +   GDTLF    GR  +  G   Q+  S+  KI 
Sbjct: 106 GEKFTLFATPGHTLGHVCY--FSRPYLFCGDTLFSGGCGR--LFEGTPSQMYQSL-MKIN 160

Query: 185 PLGDEISFVCGHGPN------------------------------------STIGRERRL 208
            L D+    C H                                         +  ER++
Sbjct: 161 SLPDDTLICCAHEYTLANIKFALSILPHDSFINEYYRKVKELRVKKQMTLPVILKNERKI 220

Query: 209 NPFLKSN 215
           N FL++ 
Sbjct: 221 NLFLRTE 227