RPSBLAST alignment of GI: 254780758 and protein with PDBid: 2zwr

>2zwr_A Metallo-beta-lactamase superfamily protein; hydrolase; 2.20A {Thermus thermophilus} Length = 207
 Score =  130 bits (327), Expect = 2e-31
 Identities = 69/206 (33%), Positives = 99/206 (48%), Gaps = 9/206 (4%)

Query: 7   HIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHGHVDHVG 66
             V + P ++N   +   E    V++DPG + + +  + Q+       I +TH H DHVG
Sbjct: 4   FPVTLGPLQENAYLVETGE--GPVLIDPGDEPEKLLALFQTTGLIPLAILLTHAHFDHVG 61

Query: 67  GAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGTH 126
             A L E L L +   H  D  +    D  AR   + +  +     R L++G        
Sbjct: 62  AVAPLVEALDLPVY-LHPLDLPLYEGADLAARAWGLAIP-KPPLPVRPLEEGMR----LF 115

Query: 127 IFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSINNKILPL 186
            F+V H PGHSPGHV + + E      GD LFR S+GR D+   D + L  S+  ++L L
Sbjct: 116 GFQVLHLPGHSPGHVAFYDPEGAQVFSGDLLFRGSVGRYDLPGADPKALFASL-KRLLSL 174

Query: 187 GDEISFVCGHGPNSTIGRERRLNPFL 212
             E     GHGP +T+G E R NPFL
Sbjct: 175 PPETRVHPGHGPGTTLGLEARTNPFL 200