RPSBLAST alignment of GI: 254780758 and protein with PDBid: 3hnn

>3hnn_A Putative diflavin flavoprotein A 5; PSI-2, protein structure initiative, northeast structural genomics consortium, NESG, NSR435A, DFA5; 1.80A {Nostoc SP} Length = 262
 Score = 59.0 bits (142), Expect = 7e-10
 Identities = 24/220 (10%), Positives = 61/220 (27%), Gaps = 41/220 (18%)

Query: 19  TFLFDEESLEAVVVDPGGD------LDIIKDVIQSRNFHVKQIWITHGHVDHVGGAAQLK 72
           +++ + +  +  ++DP  +      L+ ++  +  +   +  + + H   + +     L 
Sbjct: 45  SYVIEGD--KTAIIDPPVESFMKIYLEALQQTVNLKK--LDYVILGHFSPNRIPTFKALL 100

Query: 73  EDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDTLLLGT-HIFKVF 131
           E             A  +                 +  +   ++  +TL LG  H+ K  
Sbjct: 101 ELAPQITFVCSLPAAGDL-----------RAAFPDDNLNILPMRGKETLDLGKGHVLKFL 149

Query: 132 HCP-GHSPGHVIYVNFENNFAHLGDTLFRSSIGRT-----------------DILHGDYQ 173
             P    P  +   + +    +          G                   + L   + 
Sbjct: 150 PIPSPRWPAGLCTYDVQTQILYTDKIFGAHICGDDVFDDNWESFKEDQRYYFNCLMAPHA 209

Query: 174 QLINSINNKILPLGDEISFVCGHGPNSTIGRERRLNPFLK 213
             + +   KI  L   + +  GHGP            +  
Sbjct: 210 IHVEAALEKISDLQVRL-YAVGHGPLVRTSLIALTQAYAD 248