RPSBLAST alignment of GI: 254780758 and protein with PDBid: 3iog

>3iog_A Beta-lactamase; hydrolase, antibiotic resistance, metal-binding, periplasm,; HET: SDF; 1.41A {Aeromonas hydrophila} PDB: 1x8i_A 3fai_A* 3iof_A* 1x8h_A 2qds_A* 2gkl_A* 1x8g_A* 3f9o_A Length = 227
 Score = 83.2 bits (205), Expect = 4e-17
 Identities = 26/201 (12%), Positives = 58/201 (28%), Gaps = 15/201 (7%)

Query: 6   FHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVI----QSRNFHVKQIWITHGH 61
           + +      ++N    F  +     VV      D  +++     +     V ++  T+ H
Sbjct: 13  YVVEDNYYVQENSMVYFGAK--GVTVVGATWTPDTARELHKLIKRVSRKPVLEVINTNYH 70

Query: 62  VDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASS----DRWLQD 117
            D  GG A  K       +   +    +M     +    + +               + D
Sbjct: 71  TDRAGGNAYWKSIG--AKVVSTRQTRDLMKSDWAEIVAFTRKGLPEYPDLPLVLPNVVHD 128

Query: 118 GDTLLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLIN 177
           GD  L    +   +  P H+P  +     +    + G  L        ++   D +    
Sbjct: 129 GDFTLQEGKVRAFYAGPAHTPDGIFVYFPDEQVLYGGCILKE---KLGNLSFADVKAYPQ 185

Query: 178 SINNKILPLGDEISFVCGHGP 198
           ++           + + GH  
Sbjct: 186 TLERLKAMKLPIKTVIGGHDS 206