RPSBLAST alignment of GI: 254780758 and SCOP domain: d2cfua2

Alignment
>d2cfua2 d.157.1.13 (A:20-524) Alkylsulfatase SdsA1 {Pseudomonas aeruginosa [TaxId: 287]} Length = 505
 Score = 52.5 bits (125), Expect = 3e-08
 Identities = 34/232 (14%), Positives = 63/232 (27%), Gaps = 45/232 (19%)

Query: 17  NCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFH-----VKQIWITHGHVDHVGGAAQL 71
           N TF+  +     +VVD        +   +  +       ++ +  +H H DH GG   L
Sbjct: 105 NITFIRGDSGW--IVVDTLTTPATARAAYELVSRELGERPIRTVIYSHAHADHFGGVRGL 162

Query: 72  KEDLSL-----TIIGPHKDDAAMMGKVDEQARLLSIR----------------------- 103
            E   +      II P     A + +       +  R                       
Sbjct: 163 VEPQQVASGAVQIIAPAGFMEAAIKENVLAGNAMMRRATYQYGTQLPKGPQGQVDMAIGK 222

Query: 104 -----MNARNASSDRWLQDGDTLLLGTHIFKVFHCPG-HSPGHVIYVNFENNFAHLGDTL 157
                  +  A +     +G+ L+L    F   + PG  SP  +           + + +
Sbjct: 223 GLARGPLSLLAPTRLIEGEGEDLVLDGVPFTFQNTPGTESPAEMNIWLPRQKALLMAENV 282

Query: 158 FRSSIGRTDIL---HGDYQQLINSINNKILPLGDEISFVC-GHGPNSTIGRE 205
             +      +      D       IN  +   G +   +   H        E
Sbjct: 283 VGTLHNLYTLRGAEVRDALGWSKYINQALHRFGRQAEVMFAVHNWPRWGNAE 334

SCOP domain information

class: Alpha and beta proteins (a+b)
fold: Metallo-hydrolase/oxidoreductase
superfamily: Metallo-hydrolase/oxidoreductase
family: Alkylsulfatase-like
domain: Alkylsulfatase SdsA1
species: Pseudomonas aeruginosa [TaxId: 287]