RPS-BLAST 2.2.22 [Sep-27-2009]

Database: mmdb70 
           33,805 sequences; 4,956,049 total letters

Searching..................................................done

Query= gi|254780759|ref|YP_003065172.1| hypothetical protein
CLIBASIA_03230 [Candidatus Liberibacter asiaticus str. psy62]
         (162 letters)



>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid
           biosynthesis, malonyl/palmitoyl transferase,
           phosphopantetheine, transferase; HET: GVL FMN; 3.10A
           {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A*
           (A:861-925,A:953-978,A:1050-1287,A:1397-1568)
          Length = 501

 Score = 30.8 bits (68), Expect = 0.083
 Identities = 11/55 (20%), Positives = 20/55 (36%), Gaps = 3/55 (5%)

Query: 4   RIAMLISFLASGCVAHALLTKK---IESDTDSRHEKATISLSAHDKEGSKHTMNA 55
           R   + SF        A++        + T+ R+ +    +SA +K   K   N 
Sbjct: 437 RAVSITSFGFGQKGGQAIVVHPDYLYGAITEDRYNEYVAKVSAREKSAYKFFHNG 491


>2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase,
           enoyl reductase, ketoacyl synthase, ketoacyl reductase;
           3.1A {Thermomyces lanuginosus} PDB: 2uvb_A*
           (A:969-1019,A:1166-1395,A:1511-1683)
          Length = 454

 Score = 30.0 bits (66), Expect = 0.14
 Identities = 10/55 (18%), Positives = 20/55 (36%), Gaps = 3/55 (5%)

Query: 4   RIAMLISFLASGCVAHALLT--KKIESDTDSRHEKA-TISLSAHDKEGSKHTMNA 55
           +   + SF      A A+    K + +  D    +A  + + A  K+  +   N 
Sbjct: 389 KAFSVTSFGFGQKGAQAIGVHPKYLFATLDKAQYEAYCVKVQARQKKAYRFFHNG 443


>1ulv_A Glucodextranase; GH family 15, (alpha-alpha)6-barrel, SLH
           domain, hydrolase; HET: ACR; 2.42A {Arthrobacter
           globiformis} (A:688-773)
          Length = 86

 Score = 26.7 bits (59), Expect = 1.6
 Identities = 4/26 (15%), Positives = 7/26 (26%)

Query: 105 EFSVPKNDEKYTISACASDDKGNKST 130
              V     K  ++  A    G  + 
Sbjct: 53  SLDVALTGAKNKVTVAAVAADGGTAV 78


>1f6k_A N-acetylneuraminate lyase; beta barrel; 1.60A {Haemophilus
           influenzae} (A:)
          Length = 293

 Score = 25.5 bits (55), Expect = 4.0
 Identities = 10/50 (20%), Positives = 18/50 (36%)

Query: 102 MNAEFSVPKNDEKYTISACASDDKGNKSTLCVECPSPSTPGQYDLNHCAE 151
              E  +   +EK  I   A D+  ++  L  +  S +     +L   A 
Sbjct: 47  STGENFMLSTEEKKEIFRIAKDEAKDQIALIAQVGSVNLKEAVELGKYAT 96


>2ddb_A Pseudecin, channel blocker; crisp, snake venom, CNG channel,
           toxin; 1.90A {Pseudechis porphyriacus} PDB: 2epf_A
           2dda_A (A:1-175)
          Length = 175

 Score = 24.1 bits (51), Expect = 9.1
 Identities = 11/48 (22%), Positives = 16/48 (33%), Gaps = 5/48 (10%)

Query: 119 ACASDDKGNKSTLCVECPSPSTPGQYDLN-----HCAECENTTSKGLC 161
           A A         +C  CP+ +  G           CA+C +     LC
Sbjct: 121 ASAKCSSSKYLYVCQYCPAGNIRGSIATPYKSGPPCADCPSACVNRLC 168


>2o6p_A Iron-regulated surface determinant protein C; beta barrel,
           protein-heme complex, transport protein; HET: HEM; 1.50A
           {Staphylococcus aureus subsp} (A:)
          Length = 161

 Score = 24.1 bits (52), Expect = 9.1
 Identities = 13/78 (16%), Positives = 22/78 (28%), Gaps = 6/78 (7%)

Query: 44  HDKEGSKHTMNAEFSVP----KNDEKYTISSLTKKIESDTDFRREKATISLSAHDKEGSK 99
                     N  F+ P    K + K  +          T    E    ++ + +    +
Sbjct: 13  KYNTNDTSIANDYFNKPAKYIKKNGKLYVQITVNHSHWITGMSIEGHKENIISKNTAKDE 72

Query: 100 HTMNAEFSVPKNDEKYTI 117
            T   EF V K + K   
Sbjct: 73  RTS--EFEVSKLNGKIDG 88


  Database: mmdb70
    Posted date:  Jun 20, 2010  3:12 AM
  Number of letters in database: 4,956,049
  Number of sequences in database:  33,805
  
Lambda     K      H
   0.310    0.124    0.354 

Gapped
Lambda     K      H
   0.267   0.0625    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 33805
Number of Hits to DB: 1,022,649
Number of extensions: 39124
Number of successful extensions: 89
Number of sequences better than 10.0: 1
Number of HSP's gapped: 89
Number of HSP's successfully gapped: 18
Length of query: 162
Length of database: 4,956,049
Length adjustment: 82
Effective length of query: 80
Effective length of database: 2,184,039
Effective search space: 174723120
Effective search space used: 174723120
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 51 (23.6 bits)