RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254780759|ref|YP_003065172.1| hypothetical protein CLIBASIA_03230 [Candidatus Liberibacter asiaticus str. psy62] (162 letters) >3k1f_M Transcription initiation factor IIB; RNA polymerase II, TFIIB, transcription factor, DNA-binding, DNA-directed RNA polymerase; 4.30A {Saccharomyces cerevisiae} Length = 197 Score = 30.7 bits (69), Expect = 0.16 Identities = 8/38 (21%), Positives = 11/38 (28%), Gaps = 7/38 (18%) Query: 122 SDDKG---NKSTLCVECPSPSTPGQYDLNH----CAEC 152 + +G N C EC + CA C Sbjct: 11 AGRRGPNLNIVLTCPECKVYPPKIVERFSEGDVVCALC 48 >1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Score = 30.4 bits (67), Expect = 0.21 Identities = 12/42 (28%), Positives = 18/42 (42%), Gaps = 16/42 (38%) Query: 64 EKYTISSLTKKIESDTDFRREKATISLSAHDKEGS---KHTM 102 EK +L KK++ A++ L A D + K TM Sbjct: 18 EK---QAL-KKLQ---------ASLKLYADDSAPALAIKATM 46 Score = 30.0 bits (66), Expect = 0.28 Identities = 11/38 (28%), Positives = 16/38 (42%), Gaps = 14/38 (36%) Query: 19 HALLTKKIESDTDSRHEKATISLSAHDKEGS---KHTM 53 AL KK++ A++ L A D + K TM Sbjct: 20 QAL--KKLQ---------ASLKLYADDSAPALAIKATM 46 >2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Length = 2512 Score = 27.0 bits (59), Expect = 2.2 Identities = 8/48 (16%), Positives = 11/48 (22%), Gaps = 3/48 (6%) Query: 4 RIAMLISFLASGCVAHALLTKKIESDTDSRHEKAT---ISLSAHDKEG 48 + SF G H +L A + S E Sbjct: 386 GNVGINSFGFGGSNVHVILQPNSRPAPPPAQHAALPRLLQASGRTLEA 433 >1gen_A Gelatinase A; hydrolase, hemopexin domain, metalloprotease, hydrolase (metalloprotease); 2.15A {Homo sapiens} SCOP: b.66.1.1 PDB: 1rtg_A Length = 218 Score = 26.0 bits (57), Expect = 4.4 Identities = 8/72 (11%), Positives = 20/72 (27%), Gaps = 11/72 (15%) Query: 61 KNDEKYTISSLTKKIESDTDFRREKATISLSAHDKEGSKHTMNAEFSVPKNDEKYTISAC 120 D+ + + + KK++ A ++A + Y Sbjct: 142 AGDKFWRYNEVKKKMDPGFPKLIADAW--------NAIPDNLDAVVDLQGGGHSYFFKGA 193 Query: 121 AS---DDKGNKS 129 +++ KS Sbjct: 194 YYLKLENQSLKS 205 >3cfu_A Uncharacterized lipoprotein YJHA; YJHA_bacsu, SR562, NESG, structural genomics, PSI-2, protein structure initiative; 2.40A {Bacillus subtilis} Length = 159 Score = 25.7 bits (56), Expect = 5.5 Identities = 8/60 (13%), Positives = 23/60 (38%), Gaps = 9/60 (15%) Query: 63 DEKYTISSLTKKIESDTDFRREKATISLSAHDKE--------GSKHTMNAEFSVPKNDEK 114 ++ + + + + D + + + S+ + G K T + +PK ++K Sbjct: 60 EDSISYNFIGFDLR-DKNDQSVRPVFSIEEKGRILMGGTLVSGKKVTGVLSYVIPKGEQK 118 >2qi2_A Pelota, cell division protein pelota related protein; DOM34, cell cycle; 2.90A {Thermoplasma acidophilum} SCOP: b.38.4.1 c.55.4.2 d.79.3.2 Length = 347 Score = 24.9 bits (54), Expect = 8.0 Identities = 10/81 (12%), Positives = 25/81 (30%), Gaps = 2/81 (2%) Query: 24 KKIESD--TDSRHEKATISLSAHDKEGSKHTMNAEFSVPKNDEKYTISSLTKKIESDTDF 81 +KIE + T+ D +G ++ + K ++ TD Sbjct: 68 EKIEFQDFDNRLRILGTVIEGPEDTKGKHQSITVTVDSEISITKEWDDQHIDLLKEATDE 127 Query: 82 RREKATISLSAHDKEGSKHTM 102 + +++ + E + Sbjct: 128 KYVTVYTAVAMDEDEAQIFLI 148 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.310 0.124 0.354 Gapped Lambda K H 0.267 0.0455 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 1,166,881 Number of extensions: 45969 Number of successful extensions: 136 Number of sequences better than 10.0: 1 Number of HSP's gapped: 136 Number of HSP's successfully gapped: 22 Length of query: 162 Length of database: 5,693,230 Length adjustment: 85 Effective length of query: 77 Effective length of database: 3,632,490 Effective search space: 279701730 Effective search space used: 279701730 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits) S2: 53 (24.9 bits)