BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= gi|254780759|ref|YP_003065172.1| hypothetical protein
CLIBASIA_03230 [Candidatus Liberibacter asiaticus str. psy62]
         (162 letters)

Database: las_proteome 
           1233 sequences; 328,796 total letters

Searching...................................................done



>gi|254780759|ref|YP_003065172.1| hypothetical protein CLIBASIA_03230 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 162

 Score =  333 bits (853), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 162/162 (100%), Positives = 162/162 (100%)

Query: 1   MNFRIAMLISFLASGCVAHALLTKKIESDTDSRHEKATISLSAHDKEGSKHTMNAEFSVP 60
           MNFRIAMLISFLASGCVAHALLTKKIESDTDSRHEKATISLSAHDKEGSKHTMNAEFSVP
Sbjct: 1   MNFRIAMLISFLASGCVAHALLTKKIESDTDSRHEKATISLSAHDKEGSKHTMNAEFSVP 60

Query: 61  KNDEKYTISSLTKKIESDTDFRREKATISLSAHDKEGSKHTMNAEFSVPKNDEKYTISAC 120
           KNDEKYTISSLTKKIESDTDFRREKATISLSAHDKEGSKHTMNAEFSVPKNDEKYTISAC
Sbjct: 61  KNDEKYTISSLTKKIESDTDFRREKATISLSAHDKEGSKHTMNAEFSVPKNDEKYTISAC 120

Query: 121 ASDDKGNKSTLCVECPSPSTPGQYDLNHCAECENTTSKGLCP 162
           ASDDKGNKSTLCVECPSPSTPGQYDLNHCAECENTTSKGLCP
Sbjct: 121 ASDDKGNKSTLCVECPSPSTPGQYDLNHCAECENTTSKGLCP 162


>gi|254780135|ref|YP_003064548.1| hypothetical protein CLIBASIA_00070 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 408

 Score = 24.3 bits (51), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 13/21 (61%), Gaps = 3/21 (14%)

Query: 106 FSV---PKNDEKYTISACASD 123
           FSV   P  D +YT+  CASD
Sbjct: 349 FSVGFSPDQDTRYTLRQCASD 369


>gi|254781007|ref|YP_003065420.1| hypothetical protein CLIBASIA_04540 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 411

 Score = 24.3 bits (51), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 13/21 (61%), Gaps = 3/21 (14%)

Query: 106 FSV---PKNDEKYTISACASD 123
           FSV   P  D +YT+  CASD
Sbjct: 349 FSVGFSPDQDTRYTLRQCASD 369


>gi|254780660|ref|YP_003065073.1| hypothetical protein CLIBASIA_02735 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 244

 Score = 24.3 bits (51), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 11/32 (34%), Positives = 16/32 (50%)

Query: 107 SVPKNDEKYTISACASDDKGNKSTLCVECPSP 138
           S+PK + +  I    SDD GN + +  E   P
Sbjct: 60  SMPKENIERAIKKAGSDDLGNYTNIRYEGYGP 91


>gi|254780929|ref|YP_003065342.1| hypothetical protein CLIBASIA_04140 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 408

 Score = 23.9 bits (50), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 13/21 (61%), Gaps = 3/21 (14%)

Query: 106 FSV---PKNDEKYTISACASD 123
           FSV   P  D +YT+  CASD
Sbjct: 349 FSVGFSPDQDTRYTLRQCASD 369


>gi|254780914|ref|YP_003065327.1| hypothetical protein CLIBASIA_04065 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 408

 Score = 23.9 bits (50), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 13/21 (61%), Gaps = 3/21 (14%)

Query: 106 FSV---PKNDEKYTISACASD 123
           FSV   P  D +YT+  CASD
Sbjct: 349 FSVGFSPDQDTRYTLRQCASD 369


>gi|254780277|ref|YP_003064690.1| DNA polymerase I [Candidatus Liberibacter asiaticus str. psy62]
          Length = 976

 Score = 22.3 bits (46), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 4/41 (9%)

Query: 68  ISSLTKKIESDTDFRREKATISLSAHDKEGS--KHTMNAEF 106
           IS+L +K   DT F+ E   I LS H  + S  K+T+  E 
Sbjct: 411 ISTLDQK--DDTSFKVETIFIDLSVHTSQDSTGKNTLTKEI 449


  Database: las_proteome
    Posted date:  Jun 5, 2011  6:30 PM
  Number of letters in database: 328,796
  Number of sequences in database:  1233
  
Lambda     K      H
   0.310    0.124    0.354 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 100,713
Number of Sequences: 1233
Number of extensions: 3774
Number of successful extensions: 15
Number of sequences better than 100.0: 8
Number of HSP's better than 100.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 2
Number of HSP's gapped (non-prelim): 8
length of query: 162
length of database: 328,796
effective HSP length: 67
effective length of query: 95
effective length of database: 246,185
effective search space: 23387575
effective search space used: 23387575
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 35 (18.1 bits)