>TIGR00103 TIGR00103 conserved hypothetical protein TIGR00103; InterPro: IPR004401 The function of this protein is unknown. It is restricted to bacteria and a few plants, such as Arabidopsis. The plant form contains an additional N-terminal region that may serve as a transit peptide and shows a close relationship to the cyanobacterial member, suggesting that it is a chloroplast protein. Members of this family are found in a single copy per bacterial genome, but are broadly distributed. A crystal structure of one member, YbaB from Haemophilus influenzae, revealed a core structure consisting of two layers, alpha/beta; YbaB forms a tight dimer with a 3-layer structure, beta/alpha/beta . YbaB is co-transcribed with recR, which appears to protect DNA strands of the replilcation fork when it is blocked by DNA damage. A deletion of the YbaB operon resulted in increased sensitivity to DNA-damaging agents compared with the wild-type strain..

Probab=99.94 E-value=3e-26 Score=188.56 Aligned_cols=101 Identities=43% Similarity=0.656 Sum_probs=99.9 Q ss_pred CHHHHHHHHHHHHHHHHHHHHHHHHEEEEEEECCCEEEEEEECCCCEEEEEECHHHCCCCHHHHHHHHHHHHHHHHHHHH Q ss_conf 17999999999999999999998530899997698499999648307468864788291006899999999999999999 Q gi|254780763|r 3 NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKKI 82 (107) Q Consensus 3 nm~~llkqaq~mq~~m~~~q~eL~~~~v~g~sg~g~V~V~~~G~~~i~~i~Id~~~l~~~d~e~Ledli~~A~N~A~~k~ 82 (107) T Consensus 12 ~l~~~m~~a~~~q~~~~~l~eE~~~~~~~gksG~GlV~v~~~G~~~~~~~~Id~~l~d~~D~~~Le~~i~~A~NdA~~~v 91 (112) T TIGR00103 12 NLGELMKQAQKVQEKMKKLQEEIAKLEVTGKSGAGLVTVTINGNLELKSIEIDPSLLDPEDKEALEDLITEALNDAVKKV 91 (112) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHEECCCCCCCEEEEEEECCCCCEEEECCHHHCCCCCHHHHHHHHHHHHHHHHHHH T ss_conf 79999999999999899999888721316423773578886368652021035533286664889999999999999999 Q ss_pred HHHHHHHHHHHHCCCCCCCCC Q ss_conf 999999999974489989999 Q gi|254780763|r 83 EDLVATKTQEITEGLPIPPGL 103 (107) Q Consensus 83 ~~~~~~~m~~~tggl~lp~g~ 103 (107) T Consensus 92 ~e~~~~kM~~~~~~l~~~PGl 112 (112) T TIGR00103 92 KEKYKEKMALVTKGLPLVPGL 112 (112) T ss_pred HHHHHHHHHHHHHHCCCCCCC T ss_conf 999988899999752789899

HHsearch alignment for GI: 254780763 and conserved domain: TIGR00103