BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780763|ref|YP_003065176.1| hypothetical protein
CLIBASIA_03260 [Candidatus Liberibacter asiaticus str. psy62]
         (107 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780763|ref|YP_003065176.1| hypothetical protein CLIBASIA_03260 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040440|gb|ACT57236.1| hypothetical protein CLIBASIA_03260 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 107

 Score =  214 bits (546), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 107/107 (100%), Positives = 107/107 (100%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF
Sbjct: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF
Sbjct: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107


>gi|315121978|ref|YP_004062467.1| hypothetical protein CKC_01140 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495380|gb|ADR51979.1| hypothetical protein CKC_01140 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 106

 Score =  160 bits (405), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 79/105 (75%), Positives = 89/105 (84%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           NIMKM+GQFKEIQGKMEKMK SI +LE EGNAGGGMV VR+NGK+ML  VKI+ SLL ++
Sbjct: 2   NIMKMMGQFKEIQGKMEKMKSSIMALEVEGNAGGGMVRVRLNGKHMLLEVKIEDSLLCKE 61

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           N EILEDLI+AAH+DAHKKIEDLVA KTQE T GL +PPGL  P 
Sbjct: 62  NSEILEDLIVAAHNDAHKKIEDLVAEKTQEATAGLSLPPGLNLPL 106


>gi|325291539|ref|YP_004277403.1| hypothetical protein AGROH133_02945 [Agrobacterium sp. H13-3]
 gi|325059392|gb|ADY63083.1| hypothetical protein AGROH133_02945 [Agrobacterium sp. H13-3]
          Length = 107

 Score =  136 bits (343), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 65/107 (60%), Positives = 85/107 (79%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M +IM M+G+ KE+Q KMEKM+  I +LE EG +GGG+V+V++NGK  L G+KID SL  
Sbjct: 1   MRDIMGMMGKVKEMQAKMEKMQADIAALEVEGKSGGGLVTVKLNGKGSLLGLKIDPSLFK 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+VEILEDLI+AAH+DA ++ E + A KT+EIT GLPIPPG+K PF
Sbjct: 61  EDDVEILEDLIVAAHNDAKERAEAITAEKTKEITAGLPIPPGMKLPF 107


>gi|222147107|ref|YP_002548064.1| hypothetical protein Avi_0111 [Agrobacterium vitis S4]
 gi|221734097|gb|ACM35060.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 107

 Score =  131 bits (330), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 64/107 (59%), Positives = 81/107 (75%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M +IM M+G+ KE+Q KMEKM+E I SL+ EG +GGG+V+V + GK  L G+KID SL  
Sbjct: 1   MRDIMGMMGKVKEMQAKMEKMQEEIASLQVEGKSGGGLVTVTMTGKGELKGLKIDPSLFK 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+VEILEDLI+AAH DA  K E + A KT+++T GLPIPPG K PF
Sbjct: 61  EDDVEILEDLIVAAHKDAKDKAEAIAAEKTKDMTAGLPIPPGFKLPF 107


>gi|163757648|ref|ZP_02164737.1| hypothetical protein HPDFL43_19597 [Hoeflea phototrophica DFL-43]
 gi|162285150|gb|EDQ35432.1| hypothetical protein HPDFL43_19597 [Hoeflea phototrophica DFL-43]
          Length = 107

 Score =  131 bits (330), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 85/107 (79%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M +IM M+G+ K++Q KME M+E I ++E EG +GGGMV+V+++GK  + G+KID S+  
Sbjct: 1   MKDIMGMMGKIKDMQAKMESMQEEIATMECEGVSGGGMVTVKLSGKGQMLGLKIDPSMFK 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+VEILEDLIIAAH+DA  K E ++A +T+E+T GLPIPPG+K PF
Sbjct: 61  EDDVEILEDLIIAAHNDAKVKAETMMAERTKELTAGLPIPPGMKLPF 107


>gi|222084335|ref|YP_002542864.1| hypothetical protein Arad_0185 [Agrobacterium radiobacter K84]
 gi|221721783|gb|ACM24939.1| conserved hypothetical protein [Agrobacterium radiobacter K84]
          Length = 107

 Score =  130 bits (327), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 62/107 (57%), Positives = 80/107 (74%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M +IM M+G+ KE+Q KMEKM+  I  +  EG AGGG+V+V +NGK ++ G+KID SL  
Sbjct: 1   MRDIMGMMGKVKEMQAKMEKMQAEIADIRVEGKAGGGLVTVTVNGKGLMLGIKIDPSLFK 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+VEILEDLI+AA+ DA  K E + A KT+E+T GLPIPPG K PF
Sbjct: 61  EDDVEILEDLIVAANKDAQDKAEAITAEKTRELTAGLPIPPGFKMPF 107


>gi|150398619|ref|YP_001329086.1| hypothetical protein Smed_3433 [Sinorhizobium medicae WSM419]
 gi|150030134|gb|ABR62251.1| conserved hypothetical protein 103 [Sinorhizobium medicae WSM419]
          Length = 107

 Score =  129 bits (324), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 62/107 (57%), Positives = 82/107 (76%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M +IM M+G+ KE+Q KMEKM+  I +LE +G +GGG+V+VR++GK  +  +KID SL  
Sbjct: 1   MRDIMGMMGKVKEMQAKMEKMQAEIAALEIDGASGGGLVTVRLDGKGHMKSLKIDPSLFK 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+VEILEDLI+AAH DA  K E + A KT+E+T GLPIPPG+K PF
Sbjct: 61  EDDVEILEDLIVAAHKDAKDKAEAVQAEKTRELTAGLPIPPGMKLPF 107


>gi|15963984|ref|NP_384337.1| hypothetical protein SMc02906 [Sinorhizobium meliloti 1021]
 gi|307306396|ref|ZP_07586140.1| conserved hypothetical protein [Sinorhizobium meliloti BL225C]
 gi|307319283|ref|ZP_07598712.1| conserved hypothetical protein [Sinorhizobium meliloti AK83]
 gi|21264115|sp|Q92SX1|Y231_RHIME RecName: Full=UPF0133 protein R00231
 gi|15073160|emb|CAC41668.1| Conserved hypothetical protein [Sinorhizobium meliloti 1021]
 gi|306895119|gb|EFN25876.1| conserved hypothetical protein [Sinorhizobium meliloti AK83]
 gi|306902238|gb|EFN32835.1| conserved hypothetical protein [Sinorhizobium meliloti BL225C]
          Length = 107

 Score =  129 bits (324), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 82/107 (76%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M +IM M+G+ KE+Q KMEKM+  I +LE +G +GGG+V+VR++GK  +  +K+D SL  
Sbjct: 1   MRDIMGMMGKVKEMQAKMEKMQAEIAALEIDGTSGGGLVTVRLDGKGHMKSLKVDPSLFK 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+VEILEDLI+AAH DA  K E + A KT+E+T GLPIPPG+K PF
Sbjct: 61  EDDVEILEDLIVAAHKDAKDKAEAVQAEKTRELTAGLPIPPGMKLPF 107


>gi|227824062|ref|YP_002828035.1| hypothetical protein NGR_c35590 [Sinorhizobium fredii NGR234]
 gi|227343064|gb|ACP27282.1| conserved hypothetical protein [Sinorhizobium fredii NGR234]
          Length = 107

 Score =  129 bits (323), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 83/107 (77%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M +I+ M+G+ KE+Q KMEK++  I +LE +G +GGG+V+VR++GK  L  +KID SL  
Sbjct: 1   MRDIIGMMGKVKEMQAKMEKLQAEIAALEVDGTSGGGLVTVRLDGKGHLKSLKIDPSLFK 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+VEILEDLI+AAH DA +K E + A KT+E+T GLPIPPG+K PF
Sbjct: 61  EDDVEILEDLIVAAHKDAKEKAEAVQAEKTRELTAGLPIPPGMKLPF 107


>gi|241207077|ref|YP_002978173.1| hypothetical protein Rleg_4396 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240860967|gb|ACS58634.1| conserved hypothetical protein [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 107

 Score =  128 bits (321), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 64/107 (59%), Positives = 78/107 (72%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M +IM M+G+ KE+Q KME+M+  I  L AEG AGGG+V+V I+GK  L  +KID SL  
Sbjct: 1   MRDIMGMMGKVKEMQAKMEQMQAEIAELTAEGKAGGGLVAVVISGKGELKSLKIDPSLFK 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+VEILEDLI+AAH DA  K E L A KT+ +T GLPIPPG K PF
Sbjct: 61  EDDVEILEDLIVAAHKDAKDKAEALAAEKTKALTAGLPIPPGFKLPF 107


>gi|86355785|ref|YP_467677.1| hypothetical protein RHE_CH00125 [Rhizobium etli CFN 42]
 gi|190889794|ref|YP_001976336.1| hypothetical protein RHECIAT_CH0000162 [Rhizobium etli CIAT 652]
 gi|218660623|ref|ZP_03516553.1| hypothetical protein RetlI_14019 [Rhizobium etli IE4771]
 gi|218683024|ref|ZP_03530625.1| hypothetical protein RetlC8_30038 [Rhizobium etli CIAT 894]
 gi|86279887|gb|ABC88950.1| hypothetical conserved protein [Rhizobium etli CFN 42]
 gi|190695073|gb|ACE89158.1| hypothetical conserved protein [Rhizobium etli CIAT 652]
 gi|327190226|gb|EGE57329.1| hypothetical protein RHECNPAF_441002 [Rhizobium etli CNPAF512]
          Length = 107

 Score =  128 bits (321), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 64/107 (59%), Positives = 78/107 (72%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M +IM M+G+ KE+Q KME+M+  I  L AEG AGGG+V+V I+GK  L  +KID SL  
Sbjct: 1   MRDIMGMMGKVKEMQAKMEQMQAEIAELTAEGKAGGGLVTVVISGKGELKSLKIDPSLFK 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+VEILEDLI+AAH DA  K E L A KT+ +T GLPIPPG K PF
Sbjct: 61  EDDVEILEDLIVAAHKDAKDKAEALAAEKTKALTAGLPIPPGFKLPF 107


>gi|116249900|ref|YP_765738.1| hypothetical protein RL0133 [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115254548|emb|CAK05622.1| conserved hypothetical protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 107

 Score =  127 bits (320), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 64/107 (59%), Positives = 78/107 (72%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M +IM M+G+ KE+Q KME+M+  I  L AEG AGGG+V+V I+GK  L  +KID SL  
Sbjct: 1   MRDIMGMMGKVKEMQAKMEQMQAEIAELTAEGKAGGGLVTVLISGKGDLKSLKIDPSLFK 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+VEILEDLI+AAH DA  K E L A KT+ +T GLPIPPG K PF
Sbjct: 61  EDDVEILEDLIVAAHKDAKDKAEALAAEKTKALTAGLPIPPGFKLPF 107


>gi|209551647|ref|YP_002283564.1| hypothetical protein Rleg2_4076 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209537403|gb|ACI57338.1| conserved hypothetical protein [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 107

 Score =  127 bits (320), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 64/107 (59%), Positives = 78/107 (72%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M +IM M+G+ KE+Q KME+M+  I  L AEG AGGG+V+V I+GK  L  +KID SL  
Sbjct: 1   MRDIMGMMGKVKEMQAKMEQMQAEIAELTAEGKAGGGLVTVIISGKGELKSLKIDPSLFK 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+VEILEDLI+AAH DA  K E L A KT+ +T GLPIPPG K PF
Sbjct: 61  EDDVEILEDLIVAAHKDAKDKAEALAAEKTKALTAGLPIPPGFKLPF 107


>gi|218670305|ref|ZP_03519976.1| hypothetical protein RetlG_00940 [Rhizobium etli GR56]
          Length = 107

 Score =  126 bits (317), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 63/107 (58%), Positives = 78/107 (72%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M +IM M+G+ KE+Q KME+M+  I  L AEG AGGG+V+V ++GK  L  +KID SL  
Sbjct: 1   MRDIMGMMGKVKEMQAKMEQMQAEIAELTAEGKAGGGLVTVVMSGKGELKSLKIDPSLFK 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+VEILEDLI+AAH DA  K E L A KT+ +T GLPIPPG K PF
Sbjct: 61  EDDVEILEDLIVAAHKDAKDKAEALAAEKTKALTAGLPIPPGFKLPF 107


>gi|17988192|ref|NP_540826.1| hypothetical protein BMEI1909 [Brucella melitensis bv. 1 str. 16M]
 gi|23500948|ref|NP_697075.1| hypothetical protein BR0033 [Brucella suis 1330]
 gi|62289021|ref|YP_220814.1| hypothetical protein BruAb1_0033 [Brucella abortus bv. 1 str.
           9-941]
 gi|82698959|ref|YP_413533.1| hypothetical protein BAB1_0030 [Brucella melitensis biovar Abortus
           2308]
 gi|148560040|ref|YP_001258080.1| hypothetical protein BOV_0033 [Brucella ovis ATCC 25840]
 gi|161618023|ref|YP_001591910.1| hypothetical protein BCAN_A0034 [Brucella canis ATCC 23365]
 gi|163842309|ref|YP_001626713.1| hypothetical protein BSUIS_A0035 [Brucella suis ATCC 23445]
 gi|189023297|ref|YP_001934065.1| hypothetical protein BAbS19_I00290 [Brucella abortus S19]
 gi|225626582|ref|ZP_03784621.1| conserved hypothetical protein [Brucella ceti str. Cudo]
 gi|237814508|ref|ZP_04593506.1| conserved hypothetical protein [Brucella abortus str. 2308 A]
 gi|254690347|ref|ZP_05153601.1| hypothetical protein Babob68_09277 [Brucella abortus bv. 6 str.
           870]
 gi|254694836|ref|ZP_05156664.1| hypothetical protein Babob3T_09272 [Brucella abortus bv. 3 str.
           Tulya]
 gi|254696465|ref|ZP_05158293.1| hypothetical protein Babob28_01790 [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254700848|ref|ZP_05162676.1| hypothetical protein Bsuib55_08312 [Brucella suis bv. 5 str. 513]
 gi|254705215|ref|ZP_05167043.1| hypothetical protein Bsuib36_15101 [Brucella suis bv. 3 str. 686]
 gi|254707265|ref|ZP_05169093.1| hypothetical protein BpinM_09893 [Brucella pinnipedialis
           M163/99/10]
 gi|254709193|ref|ZP_05171004.1| hypothetical protein BpinB_02772 [Brucella pinnipedialis B2/94]
 gi|254713382|ref|ZP_05175193.1| hypothetical protein BcetM6_08517 [Brucella ceti M644/93/1]
 gi|254716260|ref|ZP_05178071.1| hypothetical protein BcetM_07470 [Brucella ceti M13/05/1]
 gi|254731377|ref|ZP_05189955.1| hypothetical protein Babob42_09302 [Brucella abortus bv. 4 str.
           292]
 gi|256030717|ref|ZP_05444331.1| hypothetical protein BpinM2_08692 [Brucella pinnipedialis
           M292/94/1]
 gi|256045824|ref|ZP_05448700.1| hypothetical protein Bmelb1R_15064 [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256060176|ref|ZP_05450356.1| hypothetical protein Bneo5_07435 [Brucella neotomae 5K33]
 gi|256112541|ref|ZP_05453462.1| hypothetical protein Bmelb3E_07660 [Brucella melitensis bv. 3 str.
           Ether]
 gi|256158723|ref|ZP_05456598.1| hypothetical protein BcetM4_07598 [Brucella ceti M490/95/1]
 gi|256254121|ref|ZP_05459657.1| hypothetical protein BcetB_07450 [Brucella ceti B1/94]
 gi|260169620|ref|ZP_05756431.1| hypothetical protein BruF5_14923 [Brucella sp. F5/99]
 gi|260546315|ref|ZP_05822055.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260563115|ref|ZP_05833601.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|260567318|ref|ZP_05837788.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
 gi|260755889|ref|ZP_05868237.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
 gi|260759113|ref|ZP_05871461.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260760838|ref|ZP_05873181.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|261215164|ref|ZP_05929445.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
 gi|261218036|ref|ZP_05932317.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261221263|ref|ZP_05935544.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|261314748|ref|ZP_05953945.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261316693|ref|ZP_05955890.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261321114|ref|ZP_05960311.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261324153|ref|ZP_05963350.1| conserved hypothetical protein [Brucella neotomae 5K33]
 gi|261751358|ref|ZP_05995067.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|261755923|ref|ZP_05999632.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|261759149|ref|ZP_06002858.1| conserved hypothetical protein [Brucella sp. F5/99]
 gi|265987763|ref|ZP_06100320.1| hypothetical protein BALG_00340 [Brucella pinnipedialis M292/94/1]
 gi|265992237|ref|ZP_06104794.1| hypothetical protein BAMG_02729 [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265993980|ref|ZP_06106537.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|265997224|ref|ZP_06109781.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|294851442|ref|ZP_06792115.1| hypothetical protein BAZG_00343 [Brucella sp. NVSL 07-0026]
 gi|54039878|sp|P67261|Y033_BRUSU RecName: Full=UPF0133 protein BR0033
 gi|54042685|sp|P67260|Y1909_BRUME RecName: Full=UPF0133 protein BMEI1909
 gi|75497555|sp|Q57FY1|Y033_BRUAB RecName: Full=UPF0133 protein BruAb1_0033
 gi|123546964|sp|Q2YPM9|Y030_BRUA2 RecName: Full=UPF0133 protein BAB1_0030
 gi|166227776|sp|A5VMY3|Y033_BRUO2 RecName: Full=UPF0133 protein BOV_0033
 gi|189030203|sp|A9M6N8|Y034_BRUC2 RecName: Full=UPF0133 protein BCAN_A0034
 gi|189030204|sp|B0CI53|Y035_BRUSI RecName: Full=UPF0133 protein BSUIS_A0035
 gi|238689400|sp|B2S7T7|Y290_BRUA1 RecName: Full=UPF0133 protein BAbS19_I00290
 gi|17983954|gb|AAL53090.1| hypothetical transcriptional regulatory protein [Brucella
           melitensis bv. 1 str. 16M]
 gi|23346804|gb|AAN28990.1| conserved hypothetical protein TIGR00103 [Brucella suis 1330]
 gi|62195153|gb|AAX73453.1| conserved hypothetical protein TIGR00103 [Brucella abortus bv. 1
           str. 9-941]
 gi|82615060|emb|CAJ09986.1| Conserved hypothetical protein 103 [Brucella melitensis biovar
           Abortus 2308]
 gi|148371297|gb|ABQ61276.1| conserved hypothetical protein TIGR00103 [Brucella ovis ATCC 25840]
 gi|161334834|gb|ABX61139.1| conserved hypothetical protein [Brucella canis ATCC 23365]
 gi|163673032|gb|ABY37143.1| conserved hypothetical protein [Brucella suis ATCC 23445]
 gi|189018869|gb|ACD71591.1| Conserved hypothetical protein 103 [Brucella abortus S19]
 gi|225618239|gb|EEH15282.1| conserved hypothetical protein [Brucella ceti str. Cudo]
 gi|237789345|gb|EEP63555.1| conserved hypothetical protein [Brucella abortus str. 2308 A]
 gi|260096422|gb|EEW80298.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260153131|gb|EEW88223.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|260156836|gb|EEW91916.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
 gi|260669431|gb|EEX56371.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260671270|gb|EEX58091.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260675997|gb|EEX62818.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
 gi|260916771|gb|EEX83632.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
 gi|260919847|gb|EEX86500.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|260923125|gb|EEX89693.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261293804|gb|EEX97300.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261295916|gb|EEX99412.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261300133|gb|EEY03630.1| conserved hypothetical protein [Brucella neotomae 5K33]
 gi|261303774|gb|EEY07271.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261739133|gb|EEY27129.1| conserved hypothetical protein [Brucella sp. F5/99]
 gi|261741111|gb|EEY29037.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|261745676|gb|EEY33602.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|262551692|gb|EEZ07682.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|262764961|gb|EEZ10882.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|263003303|gb|EEZ15596.1| hypothetical protein BAMG_02729 [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|264659960|gb|EEZ30221.1| hypothetical protein BALG_00340 [Brucella pinnipedialis M292/94/1]
 gi|294820031|gb|EFG37030.1| hypothetical protein BAZG_00343 [Brucella sp. NVSL 07-0026]
          Length = 107

 Score =  125 bits (314), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 81/107 (75%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M ++M M+ Q KE+Q KM+ M++ I ++EA  ++GGG+V+V ++GK  L+ +KID SL+ 
Sbjct: 1   MRDMMGMMKQAKELQAKMKAMQDEIATMEASASSGGGLVTVTLSGKGTLSALKIDPSLMK 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED VEILEDLIIAAH+DA  K+E  +A KTQ +T GLPIPPG K PF
Sbjct: 61  EDEVEILEDLIIAAHNDAKAKLEAAMAEKTQSLTAGLPIPPGFKLPF 107


>gi|254718254|ref|ZP_05180065.1| hypothetical protein Bru83_01681 [Brucella sp. 83/13]
 gi|265983214|ref|ZP_06095949.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|306839996|ref|ZP_07472790.1| conserved hypothetical protein [Brucella sp. NF 2653]
 gi|264661806|gb|EEZ32067.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|306404960|gb|EFM61245.1| conserved hypothetical protein [Brucella sp. NF 2653]
          Length = 107

 Score =  125 bits (314), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 82/107 (76%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M ++M M+ Q KE+Q KM+ M++ I ++EA  ++GGG+V++ ++GK  L+ +KID SL+ 
Sbjct: 1   MRDMMGMMKQAKELQAKMKAMQDEIATMEASASSGGGLVTITLSGKGTLSALKIDPSLMK 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED VEILEDLIIAAH+DA  K+E  +A KTQ +T+GLPIPPG K PF
Sbjct: 61  EDEVEILEDLIIAAHNDAKAKLEAAMAEKTQSLTDGLPIPPGFKLPF 107


>gi|256258601|ref|ZP_05464137.1| hypothetical protein Babob9C_14887 [Brucella abortus bv. 9 str.
           C68]
 gi|260884913|ref|ZP_05896527.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|297247440|ref|ZP_06931158.1| conserved hypothetical protein [Brucella abortus bv. 5 str. B3196]
 gi|260874441|gb|EEX81510.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|297174609|gb|EFH33956.1| conserved hypothetical protein [Brucella abortus bv. 5 str. B3196]
          Length = 107

 Score =  125 bits (313), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 81/107 (75%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M ++M M+ Q KE+Q KM+ M++ I ++EA  ++GGG+V+V ++GK  L+ +KID SL+ 
Sbjct: 1   MRDMMGMMKQAKELQAKMKAMQDEIATMEASASSGGGLVTVTLSGKGTLSALKIDPSLIK 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED VEILEDLIIAAH+DA  K+E  +A KTQ +T GLPIPPG K PF
Sbjct: 61  EDEVEILEDLIIAAHNDAKAKLEAAMAEKTQSLTAGLPIPPGFKLPF 107


>gi|306843633|ref|ZP_07476234.1| conserved hypothetical protein [Brucella sp. BO1]
 gi|306276324|gb|EFM58024.1| conserved hypothetical protein [Brucella sp. BO1]
          Length = 107

 Score =  124 bits (312), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 81/107 (75%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M ++M M+ Q KE+Q KM+ M++ I ++EA  ++GGG+V++ ++GK  L+ +KID SL+ 
Sbjct: 1   MRDMMGMMKQAKELQAKMKAMQDEIATMEASASSGGGLVTITLSGKGTLSALKIDPSLMK 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED VEILEDLIIAAH+DA  K+E  +A KTQ +T GLPIPPG K PF
Sbjct: 61  EDEVEILEDLIIAAHNDAKAKLEAAMAEKTQSLTAGLPIPPGFKLPF 107


>gi|306842674|ref|ZP_07475318.1| conserved hypothetical protein [Brucella sp. BO2]
 gi|306287183|gb|EFM58682.1| conserved hypothetical protein [Brucella sp. BO2]
          Length = 107

 Score =  124 bits (312), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 81/107 (75%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M ++M M+ Q KE+Q KM+ M++ I ++EA  ++GGG+V++ ++GK  L+ +KID SL+ 
Sbjct: 1   MRDMMGMMKQAKELQAKMKAMQDEIATMEASASSGGGLVTITLSGKGTLSALKIDPSLMK 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED VEILEDLIIAAH+DA  K+E  +A KTQ +T GLPIPPG K PF
Sbjct: 61  EDEVEILEDLIIAAHNDAKTKLEAAMAEKTQSLTAGLPIPPGFKLPF 107


>gi|225851576|ref|YP_002731809.1| hypothetical protein BMEA_A0033 [Brucella melitensis ATCC 23457]
 gi|256264912|ref|ZP_05467444.1| conserved hypothetical protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|254799463|sp|C0RG97|Y033_BRUMB RecName: Full=UPF0133 protein BMEA_A0033
 gi|225639941|gb|ACN99854.1| conserved hypothetical protein [Brucella melitensis ATCC 23457]
 gi|263095397|gb|EEZ18998.1| conserved hypothetical protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|326408045|gb|ADZ65110.1| conserved hypothetical protein [Brucella melitensis M28]
 gi|326537762|gb|ADZ85977.1| conserved hypothetical protein [Brucella melitensis M5-90]
          Length = 107

 Score =  123 bits (308), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 80/107 (74%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M ++M M+ Q KE+Q KM+ M++ I ++EA  ++GGG+V+V ++GK  L+ +KID SL+ 
Sbjct: 1   MRDMMGMMKQAKELQAKMKAMQDEIATMEASASSGGGLVTVTLSGKGTLSALKIDPSLMK 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED VEILEDLIIAAH+D   K+E  +A KTQ +T GLPIPPG K PF
Sbjct: 61  EDEVEILEDLIIAAHNDGKAKLEAAMAEKTQSLTAGLPIPPGFKLPF 107


>gi|153007367|ref|YP_001368582.1| hypothetical protein Oant_0022 [Ochrobactrum anthropi ATCC 49188]
 gi|166227769|sp|A6WUU9|Y022_OCHA4 RecName: Full=UPF0133 protein Oant_0022
 gi|151559255|gb|ABS12753.1| conserved hypothetical protein 103 [Ochrobactrum anthropi ATCC
           49188]
          Length = 107

 Score =  122 bits (307), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 81/107 (75%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M ++M M+ Q KE+Q KM+ M++ I ++EA  ++GGG+V++ ++GK  L+ +KID SL+ 
Sbjct: 1   MRDMMGMMKQAKELQAKMKAMQDEIATMEASASSGGGLVTITLSGKGTLSALKIDPSLMK 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           E+ VEILEDLIIAAH+DA  K+E  +A KTQ +T GLPIPPG K PF
Sbjct: 61  EEEVEILEDLIIAAHNDAKAKLEAAMAEKTQSLTAGLPIPPGFKLPF 107


>gi|15887449|ref|NP_353130.1| hypothetical protein Atu0095 [Agrobacterium tumefaciens str. C58]
 gi|25009584|sp|Q8UJ43|Y095_AGRT5 RecName: Full=UPF0133 protein Atu0095
 gi|15154964|gb|AAK85915.1| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 107

 Score =  122 bits (305), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 79/107 (73%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M +IM M+G+ KE+Q KMEK+++ I +LE EG AGGG+V+V +NGK  + G+KID SL  
Sbjct: 1   MRDIMGMMGKVKEMQSKMEKVQQEIAALEIEGRAGGGLVTVILNGKGEMRGLKIDPSLFK 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED VEILEDLI+AAH DA +K E     K  ++T GLP+PPG+K PF
Sbjct: 61  EDEVEILEDLIVAAHKDAKEKGEAQAQEKMADLTAGLPLPPGMKLPF 107


>gi|239830866|ref|ZP_04679195.1| conserved hypothetical protein [Ochrobactrum intermedium LMG 3301]
 gi|239823133|gb|EEQ94701.1| conserved hypothetical protein [Ochrobactrum intermedium LMG 3301]
          Length = 107

 Score =  122 bits (305), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 81/107 (75%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M ++M M+ Q KE+Q KM+ M++ I +LEA  ++GGG+V++ ++GK  L+ +KID +L+ 
Sbjct: 1   MRDMMGMMKQAKELQAKMKAMQDEIANLEASASSGGGLVTITLSGKGTLSALKIDPTLMK 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           E+ VEILEDLIIAAH+DA  K+E  +A KTQ +T GLPIPPG K PF
Sbjct: 61  EEEVEILEDLIIAAHNDAKAKLEAAMAEKTQSLTAGLPIPPGFKLPF 107


>gi|319408026|emb|CBI81680.1| conserved hypothetical protein [Bartonella schoenbuchensis R1]
          Length = 107

 Score =  120 bits (302), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 81/107 (75%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M ++M M+ + KE+Q KM++M++ + +L   G AGGG+VS+ +NGKN+++ +KID SL+ 
Sbjct: 1   MRDMMGMMKKAKEMQEKMQQMQDDLANLHITGTAGGGLVSITLNGKNIISAIKIDPSLIN 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            + VEILEDLI+AAH++A  KIE  +A KTQ IT GLPIPPG K PF
Sbjct: 61  PEEVEILEDLIMAAHNEAKAKIETAIAEKTQSITAGLPIPPGFKLPF 107


>gi|319779806|ref|YP_004139282.1| hypothetical protein Mesci_0058 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317165694|gb|ADV09232.1| Uncharacterized protein family UPF0133 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 107

 Score =  117 bits (294), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 80/107 (74%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M +++ ++G+ KE+Q K + M++ I +LEA G AGGG+V+V + GK  +  +KID SL  
Sbjct: 1   MKDLLGLMGKAKEMQAKFQAMQDEIATLEASGQAGGGLVNVTLTGKFEMKSLKIDPSLFK 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+VEILEDL++AAH+DA  K+E ++  KT+ +T GLPIPPG+K PF
Sbjct: 61  EDDVEILEDLVLAAHNDAKTKVEQIMQEKTKALTAGLPIPPGMKLPF 107


>gi|260462018|ref|ZP_05810263.1| conserved hypothetical protein [Mesorhizobium opportunistum
           WSM2075]
 gi|259032265|gb|EEW33531.1| conserved hypothetical protein [Mesorhizobium opportunistum
           WSM2075]
          Length = 107

 Score =  115 bits (288), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 52/107 (48%), Positives = 80/107 (74%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M +++ ++G+ KE+Q K + M++ I ++EA G +GGG+VSV + GK  +  +KID SL  
Sbjct: 1   MKDLLGLMGKAKEMQAKFQAMQDEIATVEAAGQSGGGLVSVTLTGKFEMKSLKIDPSLFK 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+VE+LEDL++AAH+DA  K+E ++  KT+ +T GLPIPPG+K PF
Sbjct: 61  EDDVEVLEDLLLAAHNDARVKVEQIMQEKTKALTAGLPIPPGMKLPF 107


>gi|13474590|ref|NP_106159.1| hypothetical protein mlr5504 [Mesorhizobium loti MAFF303099]
 gi|21264163|sp|Q98BM7|Y5504_RHILO RecName: Full=UPF0133 protein mlr5504
 gi|14025344|dbj|BAB51945.1| mlr5504 [Mesorhizobium loti MAFF303099]
          Length = 107

 Score =  115 bits (287), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 80/107 (74%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M +++ ++G+ KE+Q K + M++ I ++E+ G AGGG+VSV ++GK  +  +KID SL  
Sbjct: 1   MKDLLGLMGKAKEMQAKFQAMQDEIATVESVGQAGGGLVSVILSGKFEMKSLKIDPSLFK 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED VEILEDLI+AAH+DA  K+E ++  KT+ +T GLPIPPG+K PF
Sbjct: 61  EDEVEILEDLILAAHNDAKAKVEQIMQEKTKALTSGLPIPPGMKLPF 107


>gi|110636380|ref|YP_676588.1| hypothetical protein Meso_4056 [Mesorhizobium sp. BNC1]
 gi|110287364|gb|ABG65423.1| conserved hypothetical protein [Chelativorans sp. BNC1]
          Length = 107

 Score =  114 bits (286), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 53/107 (49%), Positives = 77/107 (71%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M ++M ++G+ KE+Q K + M+E I  LE++G +GGG V V ++GK  +  ++ID SL  
Sbjct: 1   MRDLMNLMGKAKEMQAKFQAMQEEIAQLESDGQSGGGAVKVTLSGKMEMKKLQIDPSLFK 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           E  VEILEDLI+AAH+DA  K+E  +  +TQE+T GLP+PPG+K PF
Sbjct: 61  EGEVEILEDLILAAHNDAKTKVEQTIQQRTQEMTAGLPLPPGMKLPF 107


>gi|49473885|ref|YP_031927.1| hypothetical protein BQ02190 [Bartonella quintana str. Toulouse]
 gi|81647250|sp|Q6G0M7|Y219_BARQU RecName: Full=UPF0133 protein BQ02190
 gi|49239388|emb|CAF25722.1| hypothetical protein BQ02190 [Bartonella quintana str. Toulouse]
          Length = 108

 Score =  114 bits (286), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 80/107 (74%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M ++M M+ + KEIQ KM++++E +T+L+  G AGGG+++V +NGKN +T +KID SLL 
Sbjct: 1   MRDMMSMMKKAKEIQEKMQQIQEEMTNLQMIGTAGGGLINVTLNGKNTITAIKIDPSLLK 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            +  EILEDLI+AAH+DA  KIE  +  KT+ +T GLP+P G KFPF
Sbjct: 61  PEESEILEDLIMAAHNDAKTKIEIAMEEKTKSMTAGLPLPSGFKFPF 107


>gi|304392341|ref|ZP_07374282.1| conserved hypothetical protein [Ahrensia sp. R2A130]
 gi|303295445|gb|EFL89804.1| conserved hypothetical protein [Ahrensia sp. R2A130]
          Length = 107

 Score =  114 bits (285), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 72/107 (67%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M +IM M+G+ KE+Q KME M+  +   E  G A  G+V+V +NGK  + G+ ID SL  
Sbjct: 1   MKDIMGMMGKVKEMQEKMETMQAELADAETVGQAAAGLVTVTLNGKGAMRGLHIDPSLFK 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED VEILEDLI+AAH+ A    ED+   KT E+T GLPIPPG+K PF
Sbjct: 61  EDGVEILEDLILAAHNQAKAASEDMAREKTAELTAGLPIPPGMKLPF 107


>gi|319406561|emb|CBI80203.1| conserved hypothetical protein [Bartonella sp. 1-1C]
          Length = 108

 Score =  113 bits (282), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 50/107 (46%), Positives = 80/107 (74%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M ++M ++ + KE+Q KM++M+  + +L+A G AGGG+V + +NG+N ++ + ID SL+ 
Sbjct: 1   MRDMMNIMKKAKEMQTKMQQMQSELANLQATGIAGGGLVKITLNGQNTISAINIDTSLMN 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
             +VEILEDLIIAA++DA  KI+ ++  KT+ +T G+PIPPG +FPF
Sbjct: 61  PKDVEILEDLIIAAYTDAKSKIDVIIEEKTKSVTAGMPIPPGFQFPF 107


>gi|121602892|ref|YP_989488.1| hypothetical protein BARBAKC583_1239 [Bartonella bacilliformis
           KC583]
 gi|166200317|sp|A1UU35|Y1239_BARBK RecName: Full=UPF0133 protein BARBAKC583_1239
 gi|120615069|gb|ABM45670.1| conserved hypothetical protein TIGR00103 [Bartonella bacilliformis
           KC583]
          Length = 108

 Score =  113 bits (282), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 81/107 (75%), Gaps = 3/107 (2%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M+NIMK   + KE+Q KM+++++ + +L+  G AGGG+VS+ +NG+N+++ VKID SL+ 
Sbjct: 4   MTNIMK---KAKEMQQKMQQIQDEMVNLKVTGTAGGGLVSITLNGQNIISEVKIDPSLIK 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            +  EILEDLI+AAH++A +KI   +A KTQ IT GLPIPPG K PF
Sbjct: 61  PEESEILEDLIMAAHNEAKEKISTAMAEKTQNITAGLPIPPGFKLPF 107


>gi|319405115|emb|CBI78721.1| conserved hypothetical protein [Bartonella sp. AR 15-3]
          Length = 108

 Score =  112 bits (281), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 50/107 (46%), Positives = 79/107 (73%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M ++M ++ + KE+Q KM++M+  + +L A G AGGG+V + ING+N ++ +KID SL+ 
Sbjct: 1   MRDMMNIMKKAKEMQTKMQQMQSELANLTATGIAGGGLVKITINGQNTISAIKIDTSLMN 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
             +VEILEDL+IAA+ DA  K++ ++  KT+ +T G+PIPPG +FPF
Sbjct: 61  PKDVEILEDLVIAAYKDAKSKLDVIIKEKTKSVTAGMPIPPGFQFPF 107


>gi|49475043|ref|YP_033084.1| hypothetical protein BH02310 [Bartonella henselae str. Houston-1]
 gi|81648270|sp|Q6G4V1|Y231_BARHE RecName: Full=UPF0133 protein BH02310
 gi|49237848|emb|CAF27043.1| hypothetical protein BH02310 [Bartonella henselae str. Houston-1]
          Length = 108

 Score =  112 bits (280), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 53/107 (49%), Positives = 79/107 (73%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M ++M M+ + KE+Q KM+K++E + +L+  G AGGG+VS+ +NGKN +T +KID SLL 
Sbjct: 1   MRDMMNMMKKAKEMQEKMQKIQEEMANLQVTGTAGGGLVSITLNGKNTITAIKIDPSLLK 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            + +EILEDLI+AA+++A  KIE  +  KT+ +T GLP+PP  K PF
Sbjct: 61  PEEIEILEDLIMAAYNEAKTKIEIAMQEKTKSMTAGLPLPPDFKLPF 107


>gi|240849896|ref|YP_002971285.1| hypothetical protein Bgr_02410 [Bartonella grahamii as4aup]
 gi|240267019|gb|ACS50607.1| hypothetical protein Bgr_02410 [Bartonella grahamii as4aup]
          Length = 107

 Score =  112 bits (279), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 53/107 (49%), Positives = 79/107 (73%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M  +M M+ + KE+Q KM+K++E I +L+A G AGGG+V++ +NGKN++T ++ID SLL 
Sbjct: 1   MREMMSMMKKAKEMQEKMQKIQEEIANLQATGTAGGGLVNITLNGKNIITAIQIDPSLLK 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            +  EILEDLI+AA+++A  KIE  +  KT+ IT G+P+P G K PF
Sbjct: 61  PEEAEILEDLIMAAYNEARTKIEIAIEEKTKSITAGIPLPSGFKLPF 107


>gi|319403645|emb|CBI77230.1| conserved hypothetical protein [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 107

 Score =  111 bits (278), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 49/107 (45%), Positives = 80/107 (74%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M ++M ++ + KE+Q KM++M+  + +L+A G AGGG+V + +NG+N ++ + ID SL+ 
Sbjct: 1   MRDMMNIMKKAKEMQTKMQQMQSELANLQATGIAGGGLVKITLNGQNTISAINIDTSLMN 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
             +VEILEDL+IAA++DA  KI+ ++  KT+ +T G+PIPPG +FPF
Sbjct: 61  PKDVEILEDLMIAAYTDAKSKIDVIIEEKTKSVTAGMPIPPGFQFPF 107


>gi|312114328|ref|YP_004011924.1| hypothetical protein Rvan_1573 [Rhodomicrobium vannielii ATCC
           17100]
 gi|311219457|gb|ADP70825.1| Uncharacterized protein family UPF0133 [Rhodomicrobium vannielii
           ATCC 17100]
          Length = 106

 Score =  111 bits (277), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 51/105 (48%), Positives = 77/105 (73%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M NIM M+ Q +E+Q KM +++  + +++ EG +GGG+V VR+ GK ++ G+ +D SL+ 
Sbjct: 1   MKNIMSMMKQAQELQTKMAELQTELETMQVEGTSGGGLVKVRLTGKGVMAGLSVDPSLIK 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKF 105
            +  EILEDLI+AAH+DA +K E ++A K QE+T GLP+PPGLK 
Sbjct: 61  PEESEILEDLIVAAHNDAKQKSEHVMAEKMQELTAGLPLPPGLKL 105


>gi|307942776|ref|ZP_07658121.1| conserved hypothetical protein [Roseibium sp. TrichSKD4]
 gi|307773572|gb|EFO32788.1| conserved hypothetical protein [Roseibium sp. TrichSKD4]
          Length = 106

 Score =  108 bits (271), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 75/105 (71%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           + MKM+ Q K++Q +M  ++E IT +EAEG +GGG+V V +NGK  L  +KID SL  ED
Sbjct: 2   DFMKMMKQAKQMQEQMGSLQEQITEIEAEGTSGGGLVKVTLNGKGELKSLKIDPSLFKED 61

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           +VEILEDLIIAAH+D   KI+  +  KTQ++  GL +P G+K PF
Sbjct: 62  DVEILEDLIIAAHTDGRVKIDAGIQEKTQDMMGGLGLPAGMKLPF 106


>gi|163867527|ref|YP_001608726.1| hypothetical protein Btr_0257 [Bartonella tribocorum CIP 105476]
 gi|189039824|sp|A9IMY0|Y257_BART1 RecName: Full=UPF0133 protein BT_0257
 gi|161017173|emb|CAK00731.1| conserved hypothetical protein [Bartonella tribocorum CIP 105476]
          Length = 107

 Score =  108 bits (271), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 50/107 (46%), Positives = 79/107 (73%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M  +M M+ + KE+Q +M+K++E + +L+A G AGG +VS+ +NGKN++T ++ID SLL 
Sbjct: 1   MREMMSMMKKAKEMQERMQKIQEEMANLQATGTAGGDLVSITLNGKNIITAIQIDPSLLK 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            +  EILEDLI+AA+++A  KI++ +  KT+ +T GLP+P G K PF
Sbjct: 61  PEEAEILEDLIMAAYNEARAKIDNALEEKTKSMTAGLPLPSGFKLPF 107


>gi|90419787|ref|ZP_01227696.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90335828|gb|EAS49576.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 107

 Score =  108 bits (270), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 52/107 (48%), Positives = 74/107 (69%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M ++M M+ Q KE+Q KM  ++E I S+   G AGGG+VSV + GK  + G+ ID SLL 
Sbjct: 1   MKDLMGMMKQAKEMQAKMAGLQEEIASITVTGQAGGGVVSVTLTGKGEMQGIAIDPSLLK 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED  +I+EDL++AAH+DA  K++  +  KTQE+T GL +PPG+  PF
Sbjct: 61  EDEKDIVEDLVMAAHNDAKGKLDAAIQEKTQELTAGLQLPPGMSLPF 107


>gi|319898353|ref|YP_004158446.1| hypothetical protein BARCL_0175 [Bartonella clarridgeiae 73]
 gi|319402317|emb|CBI75856.1| conserved protein of unknown function [Bartonella clarridgeiae 73]
          Length = 108

 Score =  108 bits (269), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 48/107 (44%), Positives = 80/107 (74%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M ++M ++ + KE+Q KM++++  + +LEA G AGGG+V++ ING+N ++ +KID SL+ 
Sbjct: 1   MRDMMNIIKKAKEMQTKMQQIQSELATLEATGIAGGGLVNITINGQNTISSIKIDTSLMN 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
             +VEILEDL+IAA++DA  K++ ++  KT+ +T G+PIP   +FPF
Sbjct: 61  PKDVEILEDLVIAAYNDAKIKLDVIIEEKTKSVTAGMPIPSNFQFPF 107


>gi|254471019|ref|ZP_05084422.1| conserved hypothetical protein TIGR00103 [Pseudovibrio sp. JE062]
 gi|211960161|gb|EEA95358.1| conserved hypothetical protein TIGR00103 [Pseudovibrio sp. JE062]
          Length = 108

 Score =  107 bits (268), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 52/105 (49%), Positives = 76/105 (72%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           + +KM+ Q K++Q KM +++E++  L  EG +G GMV+V +NGK  +TG+KID SL+  D
Sbjct: 2   DFLKMMKQAKQMQEKMGELQETVNELSVEGTSGAGMVTVTLNGKGEMTGLKIDPSLINAD 61

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            VEILEDLI+AAH+DA  K E LV  +TQ++  G+ +P G+K PF
Sbjct: 62  EVEILEDLILAAHNDAKAKGEALVQERTQDMMSGMGLPAGMKLPF 106


>gi|114704406|ref|ZP_01437314.1| hypothetical protein FP2506_05716 [Fulvimarina pelagi HTCC2506]
 gi|114539191|gb|EAU42311.1| hypothetical protein FP2506_05716 [Fulvimarina pelagi HTCC2506]
          Length = 107

 Score =  106 bits (265), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 50/107 (46%), Positives = 74/107 (69%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M ++M ++ Q K +Q KM  ++E +  +   G +GGG+V+V + GK  +TG+ IDRSLL 
Sbjct: 1   MKDVMNIMKQAKAMQEKMAGLQEEMAGMTVSGQSGGGVVTVTLTGKGDMTGLSIDRSLLK 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED  +I+EDL+IAAH+DA  K+E  +  KTQ +T GL +PPG+K PF
Sbjct: 61  EDEGDIVEDLVIAAHADAKTKLEAAIQEKTQAMTAGLGLPPGMKLPF 107


>gi|328541814|ref|YP_004301923.1| hypothetical protein SL003B_0190 [polymorphum gilvum SL003B-26A1]
 gi|326411566|gb|ADZ68629.1| hypothetical protein SL003B_0190 [Polymorphum gilvum SL003B-26A1]
          Length = 106

 Score =  103 bits (258), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 51/105 (48%), Positives = 74/105 (70%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           + +KM+ Q K++Q KM  ++E I ++E  G++G G+V+V + GK  + G+KID SL  ED
Sbjct: 2   DFLKMMKQAKQMQEKMGSLQEEIAAIEVTGSSGAGLVTVTLTGKGDMKGLKIDPSLFKED 61

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            VEILEDLI+AAH+DA  K E L+  KTQ++  GL +P G+K PF
Sbjct: 62  EVEILEDLILAAHADAKAKGEALMQEKTQDLMSGLGLPAGMKLPF 106


>gi|298294412|ref|YP_003696351.1| hypothetical protein Snov_4475 [Starkeya novella DSM 506]
 gi|296930923|gb|ADH91732.1| conserved hypothetical protein [Starkeya novella DSM 506]
          Length = 106

 Score =  102 bits (254), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 50/105 (47%), Positives = 70/105 (66%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M +++ M+ + KE+Q +ME++   + + E EG AGG +V V ++ K  + G+ ID SLL 
Sbjct: 1   MKDLLGMMSKMKEMQARMEQLHADLEATEVEGAAGGDLVKVTLSAKGAMRGISIDPSLLN 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKF 105
            D  EILEDLI+AAH +A  K E +V  KTQ +T GLPIPPGLK 
Sbjct: 61  PDEAEILEDLIVAAHKEAFSKGERVVQEKTQALTAGLPIPPGLKL 105


>gi|220924617|ref|YP_002499919.1| hypothetical protein Mnod_4751 [Methylobacterium nodulans ORS 2060]
 gi|219949224|gb|ACL59616.1| conserved hypothetical protein [Methylobacterium nodulans ORS 2060]
          Length = 107

 Score =  100 bits (249), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 49/107 (45%), Positives = 70/107 (65%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M +IM ++ Q + +Q KM  ++  + ++E  G AGGG VSV +  K ++ GV ID SL+ 
Sbjct: 1   MRDIMGLMKQAQAMQQKMADLQNELDAVEVSGAAGGGAVSVTMTAKGVVKGVSIDASLMV 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            D  EILEDLI+AA +DA  K E     + QE+T+GLP+PPG+K PF
Sbjct: 61  PDEKEILEDLIVAAMNDARAKGERAAQERMQELTKGLPLPPGMKLPF 107


>gi|304320349|ref|YP_003853992.1| hypothetical protein PB2503_03877 [Parvularcula bermudensis
           HTCC2503]
 gi|303299251|gb|ADM08850.1| hypothetical protein PB2503_03877 [Parvularcula bermudensis
           HTCC2503]
          Length = 108

 Score =  100 bits (248), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 49/107 (45%), Positives = 69/107 (64%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N   M+ Q   +Q KME+++  +  LEA G+AG G+VSV +NGK   + V ID  L  
Sbjct: 2   MKNFSDMMKQAAGLQKKMEEIQTQMAGLEASGSAGAGLVSVTLNGKGYASKVSIDPKLFA 61

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED  E+LEDL+ AA +DA  K+E+  A + + +TEG P+PPG+K PF
Sbjct: 62  EDEKEVLEDLVTAAINDAKAKLEEKSAEQMKSLTEGFPLPPGMKLPF 108


>gi|46204298|ref|ZP_00050199.2| COG0718: Uncharacterized protein conserved in bacteria
           [Magnetospirillum magnetotacticum MS-1]
          Length = 107

 Score =  100 bits (248), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 48/107 (44%), Positives = 69/107 (64%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M ++M ++ Q + +Q KM  ++  + ++E  G +GGG VSVR+  K  + GV ID SL+ 
Sbjct: 1   MRDLMGIMKQAQAMQEKMASLQSELEAVEVSGASGGGAVSVRMTAKGQVLGVSIDPSLMV 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            D  EILEDLI+AA +DA  K E     K  E+T+GLP+PPG+K PF
Sbjct: 61  ADEREILEDLIVAACNDARAKAEATAQEKMAELTKGLPLPPGMKLPF 107


>gi|254503273|ref|ZP_05115424.1| conserved hypothetical protein TIGR00103 [Labrenzia alexandrii
           DFL-11]
 gi|222439344|gb|EEE46023.1| conserved hypothetical protein TIGR00103 [Labrenzia alexandrii
           DFL-11]
          Length = 106

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 50/105 (47%), Positives = 72/105 (68%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           + +KM+ Q KE+Q +M  ++  I  +EAEG++G G+V+VR+NGK  L  + ID SL+ E 
Sbjct: 2   DFLKMMKQAKEMQEQMGSLQGQIEDIEAEGSSGAGLVTVRLNGKGELKSLTIDPSLMKEG 61

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
             EILEDLI+AAH+D   KI+  +  KTQE+  GL +P G+K PF
Sbjct: 62  EGEILEDLIVAAHTDGRVKIDQAIQEKTQEMMGGLGLPAGMKLPF 106


>gi|240138440|ref|YP_002962912.1| UPF0133 protein [Methylobacterium extorquens AM1]
 gi|240008409|gb|ACS39635.1| UPF0133 protein [Methylobacterium extorquens AM1]
          Length = 107

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 48/107 (44%), Positives = 69/107 (64%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M ++M ++ Q + +Q KM  ++  + ++E  G +GGG V+VR+  K  + GV ID SL+ 
Sbjct: 1   MRDLMGIMKQAQAMQEKMASVQSELEAVEVSGASGGGAVTVRMTAKGQVLGVSIDPSLMV 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            D  EILEDLI+AA SDA  K E     K  E+T+GLP+PPG+K PF
Sbjct: 61  ADEREILEDLIVAACSDARGKAEATAQEKMAELTKGLPLPPGMKLPF 107


>gi|188581064|ref|YP_001924509.1| hypothetical protein Mpop_1811 [Methylobacterium populi BJ001]
 gi|179344562|gb|ACB79974.1| conserved hypothetical protein [Methylobacterium populi BJ001]
          Length = 107

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 48/107 (44%), Positives = 69/107 (64%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M ++M ++ Q + +Q KM  ++  + S+E  G +GGG VSVR+  K  + GV ID SL+ 
Sbjct: 1   MRDLMGIMKQAQAMQEKMASLQSELDSVEVAGASGGGAVSVRMTAKGQVLGVSIDPSLMV 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            D  EILEDLI+AA +DA  K E     +  E+T+GLP+PPG+K PF
Sbjct: 61  ADEREILEDLIVAACNDARGKAEATAQERMAELTKGLPLPPGMKLPF 107


>gi|217976469|ref|YP_002360616.1| hypothetical protein Msil_0275 [Methylocella silvestris BL2]
 gi|254801459|sp|B8EP16|Y275_METSB RecName: Full=UPF0133 protein Msil_0275
 gi|217501845|gb|ACK49254.1| conserved hypothetical protein [Methylocella silvestris BL2]
          Length = 107

 Score = 98.2 bits (243), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 48/107 (44%), Positives = 69/107 (64%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M +++ ++ Q + +Q K+++M+  I  LE EG +GGGMV V ++ K  L  + ID  L+ 
Sbjct: 1   MRDMLGLMKQAQAMQEKIQQMQAEIERLEVEGQSGGGMVRVTLSAKGQLRNLAIDDQLIK 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            D  +ILEDLII AH DA KK E L+  K Q +T GL +PPG+K PF
Sbjct: 61  ADEKQILEDLIITAHEDARKKAERLMEEKMQGVTAGLALPPGMKLPF 107


>gi|114326924|ref|YP_744081.1| hypothetical protein GbCGDNIH1_0260 [Granulibacter bethesdensis
           CGDNIH1]
 gi|122328091|sp|Q0BVJ4|Y260_GRABC RecName: Full=UPF0133 protein GbCGDNIH1_0260
 gi|114315098|gb|ABI61158.1| hypothetical transcriptional regulatory protein [Granulibacter
           bethesdensis CGDNIH1]
          Length = 107

 Score = 98.2 bits (243), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 49/107 (45%), Positives = 72/107 (67%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+  ++ Q  ++Q KM +M+  + ++EAEG+AG GMV+V +NGK  L  + ID  L  
Sbjct: 1   MKNLAGLMKQASQMQAKMGEMQAKLETVEAEGSAGAGMVTVTLNGKGDLRRLHIDPKLAD 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
               E+LEDLI+AAH+DA KKIE + A + Q++T GL +P G+K PF
Sbjct: 61  PAETEMLEDLIVAAHNDAKKKIETMAAEEMQKVTGGLNLPAGMKLPF 107


>gi|170742370|ref|YP_001771025.1| hypothetical protein M446_4242 [Methylobacterium sp. 4-46]
 gi|168196644|gb|ACA18591.1| conserved hypothetical protein [Methylobacterium sp. 4-46]
          Length = 107

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 47/107 (43%), Positives = 71/107 (66%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M +IM ++ Q + +Q KM  ++  + ++E  G AGGG V+V +  K ++ GV +D SLL 
Sbjct: 1   MRDIMGLMKQAQAMQQKMADLQNELDAVEVSGAAGGGAVTVTMTAKGVMKGVTLDPSLLV 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            ++ EILEDLI+AA +DA  K E     + QE+T+GLP+PPG+K PF
Sbjct: 61  REDKEILEDLIVAAVNDARAKGERAAQERMQELTKGLPLPPGMKLPF 107


>gi|163851287|ref|YP_001639330.1| hypothetical protein Mext_1860 [Methylobacterium extorquens PA1]
 gi|218530154|ref|YP_002420970.1| hypothetical protein Mchl_2195 [Methylobacterium chloromethanicum
           CM4]
 gi|254560986|ref|YP_003068081.1| hypothetical protein METDI2546 [Methylobacterium extorquens DM4]
 gi|163662892|gb|ABY30259.1| conserved hypothetical protein [Methylobacterium extorquens PA1]
 gi|218522457|gb|ACK83042.1| conserved hypothetical protein [Methylobacterium chloromethanicum
           CM4]
 gi|254268264|emb|CAX24199.1| UPF0133 protein [Methylobacterium extorquens DM4]
          Length = 107

 Score = 97.8 bits (242), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 47/107 (43%), Positives = 69/107 (64%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M ++M ++ Q + +Q KM  ++  + ++E  G +GGG V+VR+  K  + GV ID SL+ 
Sbjct: 1   MRDLMGIMKQAQAMQEKMASVQSELEAVEVSGASGGGAVTVRMTAKGQVLGVSIDPSLMV 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            D  EILEDLI+AA +DA  K E     K  E+T+GLP+PPG+K PF
Sbjct: 61  ADEREILEDLIVAACNDARGKAEATAQEKMAELTKGLPLPPGMKLPF 107


>gi|148258530|ref|YP_001243115.1| hypothetical protein BBta_7345 [Bradyrhizobium sp. BTAi1]
 gi|166228849|sp|A5ESR5|Y7345_BRASB RecName: Full=UPF0133 protein BBta_7345
 gi|146410703|gb|ABQ39209.1| hypothetical protein BBta_7345 [Bradyrhizobium sp. BTAi1]
          Length = 106

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 49/105 (46%), Positives = 69/105 (65%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M++ + M+ Q  ++Q KM+ M+E + SLE EG +GGG+V+VR+  K  + G+KID SLL 
Sbjct: 1   MADFLGMMKQAAQLQSKMQAMQEELGSLEVEGISGGGLVAVRMTAKMEVKGIKIDPSLLK 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKF 105
            D  EILEDL++ AH DA +K E  +  K Q IT  L +PPG  F
Sbjct: 61  PDEAEILEDLLVTAHGDARRKAEAAMQEKMQAITGKLGLPPGFGF 105


>gi|158421768|ref|YP_001523060.1| hypothetical protein AZC_0144 [Azorhizobium caulinodans ORS 571]
 gi|158328657|dbj|BAF86142.1| conserved hypothetical protein [Azorhizobium caulinodans ORS 571]
          Length = 106

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 51/105 (48%), Positives = 77/105 (73%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M ++M M+ Q KE+QG+M++++E + + E +G +GGG+V+VR++ K     V+ID SL+ 
Sbjct: 1   MRDLMGMMKQAKELQGRMQQVQEELENTEVDGASGGGLVTVRVSAKGATKSVRIDPSLMK 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKF 105
            + VEILEDLI+AA +DA  K E ++A K QE+T GLP+PPGLK 
Sbjct: 61  PEEVEILEDLIVAALADARAKAEKVMAEKMQELTGGLPLPPGLKL 105


>gi|258541157|ref|YP_003186590.1| hypothetical protein APA01_00530 [Acetobacter pasteurianus IFO
           3283-01]
 gi|256632235|dbj|BAH98210.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-01]
 gi|256635292|dbj|BAI01261.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-03]
 gi|256638347|dbj|BAI04309.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-07]
 gi|256641401|dbj|BAI07356.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-22]
 gi|256644456|dbj|BAI10404.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-26]
 gi|256647511|dbj|BAI13452.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-32]
 gi|256650564|dbj|BAI16498.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256653555|dbj|BAI19482.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-12]
          Length = 107

 Score = 94.7 bits (234), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 73/107 (68%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+  ++ Q  ++Q KME M+ ++ ++  EG+AG GMV V ++GK  +  +KID  L  
Sbjct: 1   MKNLASLMKQATQMQSKMEAMQSTLEAMNIEGSAGAGMVQVVLSGKGDMRSIKIDPKLAD 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            + +E+L+DLI+AA +DA KK+++  A + Q++T GL +PPG+K PF
Sbjct: 61  PEEMEMLQDLIVAACADARKKLDEKAAEEMQKVTGGLNLPPGMKLPF 107


>gi|30995376|ref|NP_438603.2| hypothetical protein HI0442 [Haemophilus influenzae Rd KW20]
 gi|145630381|ref|ZP_01786162.1| hypothetical protein CGSHi22421_07277 [Haemophilus influenzae
           R3021]
 gi|145632687|ref|ZP_01788421.1| predicted gluconate transport-associated protein [Haemophilus
           influenzae 3655]
 gi|145634561|ref|ZP_01790270.1| hypothetical protein CGSHiAA_05031 [Haemophilus influenzae PittAA]
 gi|145636289|ref|ZP_01791958.1| hypothetical protein CGSHiHH_07426 [Haemophilus influenzae PittHH]
 gi|145640409|ref|ZP_01795993.1| predicted gluconate transport-associated protein [Haemophilus
           influenzae R3021]
 gi|229844398|ref|ZP_04464538.1| hypothetical protein CGSHi6P18H1_08750 [Haemophilus influenzae
           6P18H1]
 gi|229846528|ref|ZP_04466636.1| hypothetical protein CGSHi7P49H1_07645 [Haemophilus influenzae
           7P49H1]
 gi|319775631|ref|YP_004138119.1| hypothetical protein HICON_09730 [Haemophilus influenzae F3047]
 gi|1175545|sp|P44711|Y442_HAEIN RecName: Full=UPF0133 protein HI_0442
 gi|144984116|gb|EDJ91553.1| hypothetical protein CGSHi22421_07277 [Haemophilus influenzae
           R3021]
 gi|144986882|gb|EDJ93434.1| predicted gluconate transport-associated protein [Haemophilus
           influenzae 3655]
 gi|145268106|gb|EDK08101.1| hypothetical protein CGSHiAA_05031 [Haemophilus influenzae PittAA]
 gi|145270454|gb|EDK10388.1| hypothetical protein CGSHiHH_07426 [Haemophilus influenzae PittHH]
 gi|145274995|gb|EDK14857.1| predicted gluconate transport-associated protein [Haemophilus
           influenzae 22.4-21]
 gi|229810621|gb|EEP46339.1| hypothetical protein CGSHi7P49H1_07645 [Haemophilus influenzae
           7P49H1]
 gi|229812647|gb|EEP48336.1| hypothetical protein CGSHi6P18H1_08750 [Haemophilus influenzae
           6P18H1]
 gi|301169142|emb|CBW28739.1| conserved protein [Haemophilus influenzae 10810]
 gi|309750142|gb|ADO80126.1| Conserved hypothetical protein [Haemophilus influenzae R2866]
 gi|309972401|gb|ADO95602.1| Conserved hypothetical protein [Haemophilus influenzae R2846]
 gi|317450222|emb|CBY86438.1| conserved hypothetical protein [Haemophilus influenzae F3047]
          Length = 109

 Score = 94.4 bits (233), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 46/98 (46%), Positives = 67/98 (68%), Gaps = 1/98 (1%)

Query: 10  QFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILED 69
           Q +++Q KM+KM+E I  LE  G +G G+V + ING +    + ID SL+ ED+ E+LED
Sbjct: 13  QAQQMQEKMQKMQEEIAQLEVTGESGAGLVKITINGAHNCRRIDIDPSLM-EDDKEMLED 71

Query: 70  LIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           LI AA +DA ++ E+L   K   +T G+P+PPG+KFPF
Sbjct: 72  LIAAAFNDAVRRAEELQKEKMASVTAGMPLPPGMKFPF 109


>gi|163795452|ref|ZP_02189419.1| hypothetical protein BAL199_15077 [alpha proteobacterium BAL199]
 gi|159179438|gb|EDP63969.1| hypothetical protein BAL199_15077 [alpha proteobacterium BAL199]
          Length = 107

 Score = 94.4 bits (233), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 46/107 (42%), Positives = 71/107 (66%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+ +++ Q +E+QGK+++M+E +++LE  G +GGGMV V + GK     V IDR+L+ 
Sbjct: 1   MKNLGQLMKQAQEMQGKVQEMQERLSALEVTGRSGGGMVEVVLTGKGEARKVTIDRALVD 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
               E+LEDL++AA +DA  K +   A + Q +T GL +PPG K PF
Sbjct: 61  PAETEVLEDLLVAAINDARGKADARSAEEMQSLTGGLSLPPGFKLPF 107


>gi|148825278|ref|YP_001290031.1| hypothetical protein CGSHiEE_00780 [Haemophilus influenzae PittEE]
 gi|148827638|ref|YP_001292391.1| hypothetical protein CGSHiGG_05435 [Haemophilus influenzae PittGG]
 gi|166227322|sp|A5UGV2|Y5435_HAEIG RecName: Full=UPF0133 protein CGSHiGG_05435
 gi|166228864|sp|A5UA47|Y780_HAEIE RecName: Full=UPF0133 protein CGSHiEE_00780
 gi|148715438|gb|ABQ97648.1| hypothetical protein CGSHiEE_00780 [Haemophilus influenzae PittEE]
 gi|148718880|gb|ABR00008.1| predicted gluconate transport-associated protein [Haemophilus
           influenzae PittGG]
          Length = 109

 Score = 94.4 bits (233), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 46/98 (46%), Positives = 67/98 (68%), Gaps = 1/98 (1%)

Query: 10  QFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILED 69
           Q +++Q KM+KM+E I  LE  G +G G+V + ING +    + ID SL+ ED+ E+LED
Sbjct: 13  QAQQMQEKMQKMQEEIAQLEVTGESGAGLVKIAINGAHNCRRIDIDPSLM-EDDKEMLED 71

Query: 70  LIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           LI AA +DA ++ E+L   K   +T G+P+PPG+KFPF
Sbjct: 72  LIAAAFNDAVRRAEELQKEKMASVTAGMPLPPGMKFPF 109


>gi|68249042|ref|YP_248154.1| hypothetical protein NTHI0569 [Haemophilus influenzae 86-028NP]
 gi|260580495|ref|ZP_05848323.1| recombinational DNA repair protein [Haemophilus influenzae RdAW]
 gi|329122320|ref|ZP_08250908.1| hypothetical protein HMPREF9095_0126 [Haemophilus aegyptius ATCC
           11116]
 gi|1573418|gb|AAC22101.1| conserved hypothetical protein [Haemophilus influenzae Rd KW20]
 gi|68057241|gb|AAX87494.1| conserved hypothetical protein [Haemophilus influenzae 86-028NP]
 gi|260092837|gb|EEW76772.1| recombinational DNA repair protein [Haemophilus influenzae RdAW]
 gi|327473881|gb|EGF19298.1| hypothetical protein HMPREF9095_0126 [Haemophilus aegyptius ATCC
           11116]
          Length = 121

 Score = 94.4 bits (233), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 46/98 (46%), Positives = 67/98 (68%), Gaps = 1/98 (1%)

Query: 10  QFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILED 69
           Q +++Q KM+KM+E I  LE  G +G G+V + ING +    + ID SL+ ED+ E+LED
Sbjct: 25  QAQQMQEKMQKMQEEIAQLEVTGESGAGLVKITINGAHNCRRIDIDPSLM-EDDKEMLED 83

Query: 70  LIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           LI AA +DA ++ E+L   K   +T G+P+PPG+KFPF
Sbjct: 84  LIAAAFNDAVRRAEELQKEKMASVTAGMPLPPGMKFPF 121


>gi|154246110|ref|YP_001417068.1| hypothetical protein Xaut_2167 [Xanthobacter autotrophicus Py2]
 gi|154160195|gb|ABS67411.1| conserved hypothetical protein [Xanthobacter autotrophicus Py2]
          Length = 106

 Score = 94.0 bits (232), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 46/105 (43%), Positives = 69/105 (65%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M ++M M+ Q KE+Q +M++M+  +  +E EG +GGG+V+VR+  K     V+ID SL+ 
Sbjct: 1   MRDLMGMMKQAKELQDRMQQMQAELEQVEVEGASGGGLVTVRVTAKGECKAVRIDPSLVK 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKF 105
            D VEILEDL++AA  DA  K E ++  K + +T GL +PPGL  
Sbjct: 61  PDEVEILEDLLVAALGDARVKAERVMQEKMKSLTGGLALPPGLNL 105


>gi|260582292|ref|ZP_05850085.1| conserved hypothetical protein [Haemophilus influenzae NT127]
 gi|260094660|gb|EEW78555.1| conserved hypothetical protein [Haemophilus influenzae NT127]
          Length = 121

 Score = 93.6 bits (231), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 46/101 (45%), Positives = 69/101 (68%), Gaps = 1/101 (0%)

Query: 7   MVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEI 66
           ++ Q +++Q KM+KM+E I  LE  G +G G+V + ING +    + ID SL+ ED+ E+
Sbjct: 22  LMKQAQQMQEKMQKMQEEIAQLEVTGESGAGLVKITINGAHNCRRIDIDPSLM-EDDKEM 80

Query: 67  LEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           LEDLI AA +DA ++ E+L   K   +T G+P+PPG+KFPF
Sbjct: 81  LEDLIAAAFNDAVRRAEELQKEKMASVTAGMPLPPGMKFPF 121


>gi|319898037|ref|YP_004136234.1| hypothetical protein HIBPF18900 [Haemophilus influenzae F3031]
 gi|317433543|emb|CBY81927.1| conserved hypothetical protein [Haemophilus influenzae F3031]
          Length = 109

 Score = 93.6 bits (231), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 46/98 (46%), Positives = 67/98 (68%), Gaps = 1/98 (1%)

Query: 10  QFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILED 69
           Q +++Q KM+KM+E I  LE  G +G G+V + ING +    + ID SL+ ED+ E+LED
Sbjct: 13  QAQQMQEKMQKMQEEIAQLEVTGESGAGLVKIIINGAHNCRRIDIDPSLM-EDDKEMLED 71

Query: 70  LIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           LI AA +DA ++ E+L   K   +T G+P+PPG+KFPF
Sbjct: 72  LIAAAFNDAVRRAEELQKEKMASVTAGMPLPPGMKFPF 109


>gi|23016071|ref|ZP_00055831.1| COG0718: Uncharacterized protein conserved in bacteria
           [Magnetospirillum magnetotacticum MS-1]
          Length = 107

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 46/107 (42%), Positives = 72/107 (67%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+  ++ Q +++Q KM +M+ ++  +E  G+AG GM+ V +NGK  L  VKID SL+ 
Sbjct: 1   MKNLGNLMKQAQQMQSKMAEMQATMAEMEVTGSAGAGMLQVTLNGKYELKKVKIDPSLVD 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            ++VE+LEDL++AA +DA  K E  +A +  ++T GL +PPG K PF
Sbjct: 61  PNDVEVLEDLLLAAFNDAKTKAETAMAEEMAKMTGGLNLPPGFKLPF 107


>gi|329114767|ref|ZP_08243524.1| UPF0133 protein [Acetobacter pomorum DM001]
 gi|326695898|gb|EGE47582.1| UPF0133 protein [Acetobacter pomorum DM001]
          Length = 108

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 73/107 (68%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+  ++ Q  ++Q KME M+ ++ ++  +G+AG GMV V ++GK  +  +KID  L  
Sbjct: 2   MKNLASLMKQATQMQSKMEAMQSTLEAMNIDGSAGAGMVQVVLSGKGDMRSIKIDPKLAD 61

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            + +E+L+DLI+AA +DA KK+++  A + Q++T GL +PPG+K PF
Sbjct: 62  PEEMEMLQDLIVAACADARKKLDEKAAEEMQKVTGGLNLPPGMKLPF 108


>gi|52425562|ref|YP_088699.1| hypothetical protein MS1507 [Mannheimia succiniciproducens MBEL55E]
 gi|81386887|sp|Q65SE6|Y1507_MANSM RecName: Full=UPF0133 protein MS1507
 gi|52307614|gb|AAU38114.1| unknown [Mannheimia succiniciproducens MBEL55E]
          Length = 109

 Score = 92.8 bits (229), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 48/107 (44%), Positives = 71/107 (66%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           + N+MK   Q +++Q +M+KM+E I  LE  G +G G+V V ING +    V+ID SL+ 
Sbjct: 7   LGNLMK---QAQQMQERMQKMQEEIAQLEVTGESGAGLVKVTINGAHNCRRVEIDPSLM- 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ ++LEDLI AA +DA ++ ++L   K   +T G+PIPPG K PF
Sbjct: 63  EDDKDMLEDLIAAAFNDAARRADELQKEKMASVTAGMPIPPGFKMPF 109


>gi|170749548|ref|YP_001755808.1| hypothetical protein Mrad2831_3143 [Methylobacterium radiotolerans
           JCM 2831]
 gi|170656070|gb|ACB25125.1| conserved hypothetical protein [Methylobacterium radiotolerans JCM
           2831]
          Length = 107

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 67/107 (62%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M ++M ++ Q + +Q KM  ++  +  +E  G +GGG V V +  K  + GV ID SL+ 
Sbjct: 1   MRDLMGIMKQAQAMQEKMANLQSEMDEIEVSGASGGGSVRVTMTAKGQMKGVSIDPSLMV 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            D  EILEDLI+AA +DA  K E  +  +  E+T+GLP+PPG+K PF
Sbjct: 61  ADEREILEDLIVAACNDARGKAEATMQERMAELTKGLPLPPGMKLPF 107


>gi|325579176|ref|ZP_08149132.1| hypothetical protein HMPREF9417_1873 [Haemophilus parainfluenzae
           ATCC 33392]
 gi|301155601|emb|CBW15069.1| conserved protein [Haemophilus parainfluenzae T3T1]
 gi|325159411|gb|EGC71545.1| hypothetical protein HMPREF9417_1873 [Haemophilus parainfluenzae
           ATCC 33392]
          Length = 109

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 45/98 (45%), Positives = 67/98 (68%), Gaps = 1/98 (1%)

Query: 10  QFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILED 69
           Q +++Q KM+KM+E I  LE  G +G G+V + ING +    ++ID SL+ ED+ E+LED
Sbjct: 13  QAQQMQEKMQKMQEEIAQLEVTGESGAGLVKITINGAHNCRRIEIDPSLM-EDDKEMLED 71

Query: 70  LIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           LI AA +DA ++ E+L   K   +T G+P+PPG+K PF
Sbjct: 72  LIAAAFNDAVRRAEELQKEKMASVTAGMPLPPGMKLPF 109


>gi|294012156|ref|YP_003545616.1| hypothetical protein SJA_C1-21700 [Sphingobium japonicum UT26S]
 gi|292675486|dbj|BAI97004.1| conserved hypothetical protein [Sphingobium japonicum UT26S]
          Length = 107

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 70/107 (65%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M ++ +++G    +Q ++++ +E++  LE EG AGGG+V VR + K  + GV ID SLL 
Sbjct: 1   MKDLNEILGMASRVQEELQRAQENLDRLEVEGTAGGGLVKVRASAKGRILGVAIDDSLLA 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
               ++LEDLI AA +DA KK +++   +  ++T GLP+PPG K PF
Sbjct: 61  PSEKQMLEDLITAAFNDARKKADEVSNAEMGKMTAGLPLPPGFKLPF 107


>gi|315633851|ref|ZP_07889140.1| conserved hypothetical protein [Aggregatibacter segnis ATCC 33393]
 gi|315477101|gb|EFU67844.1| conserved hypothetical protein [Aggregatibacter segnis ATCC 33393]
          Length = 109

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 47/107 (43%), Positives = 70/107 (65%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           + N+MK   Q +++Q +M+KM+E I  LE  G +G G+V + ING +    + ID SL+ 
Sbjct: 7   LGNLMK---QAQQMQDRMQKMQEEIAQLEVTGESGAGLVKITINGAHNCRRIDIDPSLM- 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ E+LEDLI AA +DA ++ E+L   K   +T G+P+PPG K PF
Sbjct: 63  EDDKEMLEDLIAAAFNDAVRRAEELQKEKMASVTAGMPLPPGFKMPF 109


>gi|323144819|ref|ZP_08079390.1| DNA-binding protein, YbaB/EbfC family [Succinatimonas hippei YIT
           12066]
 gi|322415406|gb|EFY06169.1| DNA-binding protein, YbaB/EbfC family [Succinatimonas hippei YIT
           12066]
          Length = 106

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 46/107 (42%), Positives = 70/107 (65%), Gaps = 1/107 (0%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+  M+ Q + +Q +++K +E I +LE  G AG G+V V +NG + +  V+ID S+ F
Sbjct: 1   MFNMGNMMKQAQMLQERLKKAQEEIAALEVTGEAGAGLVKVTVNGSHQVRRVEIDDSV-F 59

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            D+ EI EDLI AA +DA +++ED    K Q +T G+ +PPG+K PF
Sbjct: 60  SDDKEICEDLIAAAFNDAARRLEDATKEKMQAVTGGMQLPPGMKMPF 106


>gi|268591259|ref|ZP_06125480.1| putative cytoplasmic protein [Providencia rettgeri DSM 1131]
 gi|291313230|gb|EFE53683.1| putative cytoplasmic protein [Providencia rettgeri DSM 1131]
          Length = 109

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 49/107 (45%), Positives = 71/107 (66%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           + N+MK   Q +++Q KM+K++E I  LEA G +G G+V V ING +    V+ID SLL 
Sbjct: 7   LGNLMK---QAQQMQDKMQKVQEEIAQLEATGESGAGLVKVTINGSHNCRRVEIDPSLL- 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ E+LEDLI AA +DA ++IE+    K   ++ G+ +PPG K PF
Sbjct: 63  EDDKEMLEDLIAAAFNDAARRIEETQKEKMASVSSGMQLPPGFKMPF 109


>gi|59712293|ref|YP_205069.1| hypothetical protein VF_1686 [Vibrio fischeri ES114]
 gi|197335531|ref|YP_002156505.1| hypothetical protein VFMJ11_1810 [Vibrio fischeri MJ11]
 gi|75353710|sp|Q5E465|Y1686_VIBF1 RecName: Full=UPF0133 protein VF_1686
 gi|238690293|sp|B5FFM5|Y1810_VIBFM RecName: Full=UPF0133 protein VFMJ11_1810
 gi|59480394|gb|AAW86181.1| conserved protein [Vibrio fischeri ES114]
 gi|197317021|gb|ACH66468.1| conserved hypothetical protein [Vibrio fischeri MJ11]
          Length = 111

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 47/107 (43%), Positives = 70/107 (65%), Gaps = 3/107 (2%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+MK   Q +++Q +M+KM+E I ++E  G +G G+V V I G + +  V+ID SL+ 
Sbjct: 8   MGNLMK---QAQQMQDRMQKMQEEIANMEVTGESGAGLVKVTITGSHSVRRVEIDPSLME 64

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED  E+LEDLI AA +DA ++IE+    K   +T G+ +PPG K PF
Sbjct: 65  EDEKEMLEDLIAAAFNDASRRIEETQKEKMASVTGGMQMPPGFKMPF 111


>gi|37527700|ref|NP_931044.1| hypothetical protein plu3840 [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|47117426|sp|Q7N0P1|Y3840_PHOLL RecName: Full=UPF0133 protein plu3840
 gi|36787135|emb|CAE16212.1| unnamed protein product [Photorhabdus luminescens subsp. laumondii
           TTO1]
          Length = 109

 Score = 92.0 bits (227), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 50/107 (46%), Positives = 71/107 (66%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           + N+MK   Q +++Q KM+KM+E I SLE  G +G G+V V ING +    V+ID SL+ 
Sbjct: 7   LGNLMK---QAQQMQDKMQKMQEEIASLEVTGESGAGLVKVTINGAHNCRRVEIDPSLM- 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ E+LEDLI AA +DA ++IE+    K   I+ G+ +PPG K PF
Sbjct: 63  EDDKEMLEDLIAAAFNDAARRIEETQKEKMAGISSGMQLPPGFKMPF 109


>gi|307129959|ref|YP_003881975.1| hypothetical protein Dda3937_03290 [Dickeya dadantii 3937]
 gi|306527488|gb|ADM97418.1| conserved protein [Dickeya dadantii 3937]
          Length = 109

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 48/107 (44%), Positives = 71/107 (66%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           + N+MK   Q +++Q KM+K +E I SLE  G +G G+V V ING +    V+ID SL+ 
Sbjct: 7   LGNLMK---QAQQMQEKMQKAQEEIASLEVTGESGAGLVKVTINGAHNCRRVEIDPSLM- 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ E+LEDLI AA +DA ++I ++   K   ++ G+P+PPG K PF
Sbjct: 63  EDDKEMLEDLIAAAFNDAARRIAEVQQEKMASVSSGIPLPPGFKMPF 109


>gi|183600058|ref|ZP_02961551.1| hypothetical protein PROSTU_03590 [Providencia stuartii ATCC 25827]
 gi|188022343|gb|EDU60383.1| hypothetical protein PROSTU_03590 [Providencia stuartii ATCC 25827]
          Length = 109

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 49/107 (45%), Positives = 72/107 (67%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           + N+MK   Q +++Q KM+K++E I +LEA G +G G+V V ING +    V+ID SLL 
Sbjct: 7   LGNLMK---QAQQMQEKMQKVQEEIANLEATGESGAGLVKVTINGSHNCRRVEIDPSLL- 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ E+LEDLI AA +DA ++IE+    K   ++ G+ +PPG K PF
Sbjct: 63  EDDKEMLEDLIAAAFNDAARRIEETQKEKMASVSSGMQLPPGFKMPF 109


>gi|271499626|ref|YP_003332651.1| hypothetical protein Dd586_1062 [Dickeya dadantii Ech586]
 gi|270343181|gb|ACZ75946.1| conserved hypothetical protein [Dickeya dadantii Ech586]
          Length = 109

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 48/107 (44%), Positives = 71/107 (66%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           + N+MK   Q +++Q KM+K +E I +LE  G +G GMV V ING +    V+ID SL+ 
Sbjct: 7   LGNLMK---QAQQMQEKMQKAQEEIANLEVTGESGAGMVKVTINGAHNCRRVEIDPSLM- 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ E+LEDLI AA +DA ++I ++   K   ++ G+P+PPG K PF
Sbjct: 63  EDDKEMLEDLIAAAFNDAARRIAEVQQEKMASVSSGIPLPPGFKMPF 109


>gi|33151561|ref|NP_872914.1| hypothetical protein HD0326 [Haemophilus ducreyi 35000HP]
 gi|47117475|sp|Q7VNZ1|Y326_HAEDU RecName: Full=UPF0133 protein HD_0326
 gi|33147781|gb|AAP95303.1| conserved hypothetical protein [Haemophilus ducreyi 35000HP]
          Length = 109

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 46/107 (42%), Positives = 71/107 (66%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           + N+MK   Q +++Q +M+KM+E I  LE  G +G G+V V ING +    ++ID SL+ 
Sbjct: 7   LGNLMK---QAQQMQERMQKMQEEIAQLEVTGESGAGLVKVTINGAHNCRRIEIDASLM- 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ E++EDL+ AA +DA ++ EDL   K   +T G+ +PPG+K PF
Sbjct: 63  EDDKEMVEDLVAAAFNDAVRRAEDLQKEKMASVTSGMQLPPGMKLPF 109


>gi|307292718|ref|ZP_07572564.1| Uncharacterized protein family UPF0133 [Sphingobium
           chlorophenolicum L-1]
 gi|306880784|gb|EFN12000.1| Uncharacterized protein family UPF0133 [Sphingobium
           chlorophenolicum L-1]
          Length = 107

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 71/107 (66%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M ++ +++G    +Q ++++ ++++  LE EG+AGGG+V VR + K  + GV ID SLL 
Sbjct: 1   MKDLNEILGMASRVQEELQRAQDNLDKLEVEGSAGGGLVKVRASAKGRILGVAIDDSLLA 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
               ++LEDLI AA +DA KK +++   +  ++T GLP+PPG K PF
Sbjct: 61  PTEKQMLEDLITAAFNDARKKADEVSNAEMGKMTAGLPLPPGFKLPF 107


>gi|206578120|ref|YP_002240027.1| conserved hypothetical protein TIGR00103 [Klebsiella pneumoniae
           342]
 gi|288936780|ref|YP_003440839.1| hypothetical protein Kvar_3928 [Klebsiella variicola At-22]
 gi|290510165|ref|ZP_06549535.1| conserved hypothetical protein [Klebsiella sp. 1_1_55]
 gi|238058728|sp|B5Y0N6|Y4227_KLEP3 RecName: Full=UPF0133 protein KPK_4227
 gi|206567178|gb|ACI08954.1| conserved hypothetical protein TIGR00103 [Klebsiella pneumoniae
           342]
 gi|288891489|gb|ADC59807.1| conserved hypothetical protein [Klebsiella variicola At-22]
 gi|289776881|gb|EFD84879.1| conserved hypothetical protein [Klebsiella sp. 1_1_55]
          Length = 110

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 48/107 (44%), Positives = 70/107 (65%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           + N+MK   Q +++Q KM+KM+E I  LE  G +G G+V V ING +    V+ID SLL 
Sbjct: 8   LGNLMK---QAQQMQDKMQKMQEEIAQLEVTGESGAGLVKVTINGAHNCRRVEIDPSLL- 63

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ E+LEDL+ AA +DA ++IE+    K   ++ G+ +PPG K PF
Sbjct: 64  EDDKEMLEDLVAAAFNDAARRIEETQKEKMASVSAGMQLPPGFKMPF 110


>gi|94497480|ref|ZP_01304050.1| hypothetical protein SKA58_07995 [Sphingomonas sp. SKA58]
 gi|94423111|gb|EAT08142.1| hypothetical protein SKA58_07995 [Sphingomonas sp. SKA58]
          Length = 107

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 70/107 (65%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M ++ +++G    +Q ++++ ++++  LE EG AGGG+V VR + K  + GV ID SLL 
Sbjct: 1   MKDLNEILGMASRVQEELQRAQDNLDKLEVEGAAGGGLVKVRASAKGRILGVSIDDSLLA 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
               ++LEDLI AA +DA  K +++  T+  ++T GLP+PPG K PF
Sbjct: 61  PSEKQMLEDLITAAFNDARSKADEVSNTEMGKMTAGLPLPPGFKLPF 107


>gi|15800200|ref|NP_286212.1| hypothetical protein Z0588 [Escherichia coli O157:H7 EDL933]
 gi|15829778|ref|NP_308551.1| hypothetical protein ECs0524 [Escherichia coli O157:H7 str. Sakai]
 gi|16128455|ref|NP_415004.1| conserved protein [Escherichia coli str. K-12 substr. MG1655]
 gi|16759464|ref|NP_455081.1| hypothetical protein STY0529 [Salmonella enterica subsp. enterica
           serovar Typhi str. CT18]
 gi|16763865|ref|NP_459480.1| hypothetical protein STM0485 [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|29142764|ref|NP_806106.1| hypothetical protein t2375 [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|30061971|ref|NP_836142.1| hypothetical protein S0423 [Shigella flexneri 2a str. 2457T]
 gi|56479670|ref|NP_706364.2| hypothetical protein SF0416 [Shigella flexneri 2a str. 301]
 gi|62179096|ref|YP_215513.1| hypothetical protein SC0526 [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|74311050|ref|YP_309469.1| hypothetical protein SSON_0458 [Shigella sonnei Ss046]
 gi|82542964|ref|YP_406911.1| hypothetical protein SBO_0371 [Shigella boydii Sb227]
 gi|82775798|ref|YP_402145.1| hypothetical protein SDY_0448 [Shigella dysenteriae Sd197]
 gi|89107340|ref|AP_001120.1| hypothetical protein [Escherichia coli str. K-12 substr. W3110]
 gi|110640732|ref|YP_668460.1| hypothetical protein ECP_0532 [Escherichia coli 536]
 gi|110804498|ref|YP_688018.1| hypothetical protein SFV_0444 [Shigella flexneri 5 str. 8401]
 gi|117622728|ref|YP_851641.1| hypothetical protein APECO1_1544 [Escherichia coli APEC O1]
 gi|157159998|ref|YP_001457316.1| hypothetical protein EcHS_A0548 [Escherichia coli HS]
 gi|161504340|ref|YP_001571452.1| hypothetical protein SARI_02449 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|161615317|ref|YP_001589282.1| hypothetical protein SPAB_03087 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|167550988|ref|ZP_02344744.1| conserved hypothetical protein TIGR00103 [Salmonella enterica
           subsp. enterica serovar Saintpaul str. SARA29]
 gi|167990472|ref|ZP_02571572.1| conserved hypothetical protein TIGR00103 [Salmonella enterica
           subsp. enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|168231476|ref|ZP_02656534.1| conserved hypothetical protein TIGR00103 [Salmonella enterica
           subsp. enterica serovar Kentucky str. CDC 191]
 gi|168237602|ref|ZP_02662660.1| conserved hypothetical protein TIGR00103 [Salmonella enterica
           subsp. enterica serovar Schwarzengrund str. SL480]
 gi|168240316|ref|ZP_02665248.1| conserved hypothetical protein TIGR00103 [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL486]
 gi|168261076|ref|ZP_02683049.1| conserved hypothetical protein TIGR00103 [Salmonella enterica
           subsp. enterica serovar Hadar str. RI_05P066]
 gi|168465582|ref|ZP_02699464.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|168818898|ref|ZP_02830898.1| conserved hypothetical protein TIGR00103 [Salmonella enterica
           subsp. enterica serovar Weltevreden str. HI_N05-537]
 gi|170021141|ref|YP_001726095.1| hypothetical protein EcolC_3145 [Escherichia coli ATCC 8739]
 gi|170080056|ref|YP_001729376.1| hypothetical protein ECDH10B_0427 [Escherichia coli str. K-12
           substr. DH10B]
 gi|170682138|ref|YP_001742615.1| hypothetical protein EcSMS35_0514 [Escherichia coli SMS-3-5]
 gi|187734110|ref|YP_001879180.1| hypothetical protein SbBS512_E0403 [Shigella boydii CDC 3083-94]
 gi|187776370|ref|ZP_02802176.2| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4196]
 gi|188024620|ref|ZP_02772873.2| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4113]
 gi|188493430|ref|ZP_03000700.1| conserved hypothetical protein TIGR00103 [Escherichia coli 53638]
 gi|189010025|ref|ZP_02803973.2| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4076]
 gi|189402031|ref|ZP_02779585.2| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4401]
 gi|189403123|ref|ZP_02793435.2| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4486]
 gi|189403806|ref|ZP_02785379.2| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4501]
 gi|189404804|ref|ZP_02811331.2| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC869]
 gi|189405611|ref|ZP_02823044.2| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC508]
 gi|191167520|ref|ZP_03029333.1| conserved hypothetical protein [Escherichia coli B7A]
 gi|191173657|ref|ZP_03035181.1| conserved hypothetical protein [Escherichia coli F11]
 gi|193064199|ref|ZP_03045283.1| conserved hypothetical protein [Escherichia coli E22]
 gi|193067685|ref|ZP_03048652.1| conserved hypothetical protein [Escherichia coli E110019]
 gi|194429003|ref|ZP_03061535.1| conserved hypothetical protein [Escherichia coli B171]
 gi|194432725|ref|ZP_03065010.1| conserved hypothetical protein [Shigella dysenteriae 1012]
 gi|194437385|ref|ZP_03069482.1| conserved hypothetical protein [Escherichia coli 101-1]
 gi|194444967|ref|YP_002039728.1| hypothetical protein SNSL254_A0536 [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194448141|ref|YP_002044518.1| hypothetical protein SeHA_C0590 [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|194470565|ref|ZP_03076549.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|194735445|ref|YP_002113516.1| hypothetical protein SeSA_A0546 [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|195936034|ref|ZP_03081416.1| hypothetical protein EscherichcoliO157_06141 [Escherichia coli
           O157:H7 str. EC4024]
 gi|197248840|ref|YP_002145468.1| hypothetical protein SeAg_B0530 [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|197265505|ref|ZP_03165579.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|198242833|ref|YP_002214438.1| hypothetical protein SeD_A0530 [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|200390240|ref|ZP_03216851.1| conserved hypothetical protein TIGR00103 [Salmonella enterica
           subsp. enterica serovar Virchow str. SL491]
 gi|204930620|ref|ZP_03221550.1| conserved hypothetical protein TIGR00103 [Salmonella enterica
           subsp. enterica serovar Javiana str. GA_MM04042433]
 gi|205351793|ref|YP_002225594.1| hypothetical protein SG0495 [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|207855964|ref|YP_002242615.1| hypothetical protein SEN0466 [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|208809548|ref|ZP_03251885.1| conserved hypothetical protein TIGR00103 [Escherichia coli O157:H7
           str. EC4206]
 gi|208814920|ref|ZP_03256099.1| conserved hypothetical protein TIGR00103 [Escherichia coli O157:H7
           str. EC4045]
 gi|208823056|ref|ZP_03263374.1| conserved hypothetical protein TIGR00103 [Escherichia coli O157:H7
           str. EC4042]
 gi|209398093|ref|YP_002269121.1| conserved hypothetical protein TIGR00103 [Escherichia coli O157:H7
           str. EC4115]
 gi|209917687|ref|YP_002291771.1| hypothetical protein ECSE_0496 [Escherichia coli SE11]
 gi|213421305|ref|ZP_03354371.1| hypothetical protein Salmonentericaenterica_27679 [Salmonella
           enterica subsp. enterica serovar Typhi str. E01-6750]
 gi|213615955|ref|ZP_03371781.1| hypothetical protein SentesTyp_16389 [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-2068]
 gi|213650777|ref|ZP_03380830.1| hypothetical protein SentesTy_28246 [Salmonella enterica subsp.
           enterica serovar Typhi str. J185]
 gi|213865425|ref|ZP_03387544.1| hypothetical protein SentesT_37068 [Salmonella enterica subsp.
           enterica serovar Typhi str. M223]
 gi|215485551|ref|YP_002327982.1| hypothetical protein E2348C_0406 [Escherichia coli O127:H6 str.
           E2348/69]
 gi|217324198|ref|ZP_03440282.1| conserved hypothetical protein TIGR00103 [Escherichia coli O157:H7
           str. TW14588]
 gi|218549861|ref|YP_002383652.1| hypothetical protein EFER_2546 [Escherichia fergusonii ATCC 35469]
 gi|218557381|ref|YP_002390294.1| hypothetical protein ECS88_0468 [Escherichia coli S88]
 gi|218688334|ref|YP_002396546.1| hypothetical protein ECED1_0494 [Escherichia coli ED1a]
 gi|218693933|ref|YP_002401600.1| hypothetical protein EC55989_0484 [Escherichia coli 55989]
 gi|218698617|ref|YP_002406246.1| hypothetical protein ECIAI39_0200 [Escherichia coli IAI39]
 gi|218703754|ref|YP_002411273.1| hypothetical protein ECUMN_0510 [Escherichia coli UMN026]
 gi|224582322|ref|YP_002636120.1| hypothetical protein SPC_0499 [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|227884516|ref|ZP_04002321.1| conserved hypothetical protein [Escherichia coli 83972]
 gi|237707531|ref|ZP_04538012.1| ybaB [Escherichia sp. 3_2_53FAA]
 gi|238899758|ref|YP_002925554.1| hypothetical protein BWG_0352 [Escherichia coli BW2952]
 gi|238911385|ref|ZP_04655222.1| hypothetical protein SentesTe_09635 [Salmonella enterica subsp.
           enterica serovar Tennessee str. CDC07-0191]
 gi|253774539|ref|YP_003037370.1| hypothetical protein ECBD_3185 [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254160540|ref|YP_003043648.1| hypothetical protein ECB_00422 [Escherichia coli B str. REL606]
 gi|254791654|ref|YP_003076491.1| hypothetical protein ECSP_0538 [Escherichia coli O157:H7 str.
           TW14359]
 gi|256020442|ref|ZP_05434307.1| hypothetical protein ShiD9_16100 [Shigella sp. D9]
 gi|256023911|ref|ZP_05437776.1| hypothetical protein E4_11098 [Escherichia sp. 4_1_40B]
 gi|260842671|ref|YP_003220449.1| hypothetical protein ECO103_0447 [Escherichia coli O103:H2 str.
           12009]
 gi|260853694|ref|YP_003227585.1| hypothetical protein ECO26_0506 [Escherichia coli O26:H11 str.
           11368]
 gi|260866632|ref|YP_003233034.1| hypothetical protein ECO111_0506 [Escherichia coli O111:H- str.
           11128]
 gi|261223953|ref|ZP_05938234.1| hypothetical protein EscherichiacoliO157_05012 [Escherichia coli
           O157:H7 str. FRIK2000]
 gi|261256333|ref|ZP_05948866.1| hypothetical protein EscherichiacoliO157EcO_10934 [Escherichia coli
           O157:H7 str. FRIK966]
 gi|289828678|ref|ZP_06546477.1| hypothetical protein Salmonellentericaenterica_19411 [Salmonella
           enterica subsp. enterica serovar Typhi str. E98-3139]
 gi|291281377|ref|YP_003498195.1| hypothetical protein G2583_0583 [Escherichia coli O55:H7 str.
           CB9615]
 gi|293403592|ref|ZP_06647683.1| hypothetical protein ECGG_04308 [Escherichia coli FVEC1412]
 gi|293408620|ref|ZP_06652459.1| hypothetical protein ECEG_03563 [Escherichia coli B354]
 gi|293413724|ref|ZP_06656373.1| hypothetical protein ECDG_00266 [Escherichia coli B185]
 gi|293418540|ref|ZP_06660975.1| hypothetical protein ECCG_03423 [Escherichia coli B088]
 gi|298379202|ref|ZP_06989083.1| ybaB protein [Escherichia coli FVEC1302]
 gi|300818195|ref|ZP_07098406.1| conserved hypothetical protein TIGR00103 [Escherichia coli MS
           107-1]
 gi|300820282|ref|ZP_07100434.1| conserved hypothetical protein TIGR00103 [Escherichia coli MS
           119-7]
 gi|300900545|ref|ZP_07118712.1| conserved hypothetical protein TIGR00103 [Escherichia coli MS
           198-1]
 gi|300903258|ref|ZP_07121187.1| hypothetical protein HMPREF9536_01393 [Escherichia coli MS 84-1]
 gi|300919876|ref|ZP_07136343.1| conserved hypothetical protein TIGR00103 [Escherichia coli MS
           115-1]
 gi|300924199|ref|ZP_07140191.1| hypothetical protein HMPREF9548_02364 [Escherichia coli MS 182-1]
 gi|300930224|ref|ZP_07145638.1| conserved hypothetical protein TIGR00103 [Escherichia coli MS
           187-1]
 gi|300935751|ref|ZP_07150716.1| conserved hypothetical protein TIGR00103 [Escherichia coli MS 21-1]
 gi|300947872|ref|ZP_07162022.1| conserved hypothetical protein TIGR00103 [Escherichia coli MS
           116-1]
 gi|300958040|ref|ZP_07170204.1| hypothetical protein HMPREF9547_03761 [Escherichia coli MS 175-1]
 gi|300987889|ref|ZP_07178438.1| conserved hypothetical protein TIGR00103 [Escherichia coli MS 45-1]
 gi|300997165|ref|ZP_07181661.1| hypothetical protein HMPREF9553_05131 [Escherichia coli MS 200-1]
 gi|301022522|ref|ZP_07186396.1| conserved hypothetical protein TIGR00103 [Escherichia coli MS 69-1]
 gi|301023020|ref|ZP_07186830.1| conserved hypothetical protein TIGR00103 [Escherichia coli MS
           196-1]
 gi|301049680|ref|ZP_07196628.1| conserved hypothetical protein TIGR00103 [Escherichia coli MS
           185-1]
 gi|301330661|ref|ZP_07223263.1| conserved hypothetical protein TIGR00103 [Escherichia coli MS 78-1]
 gi|301647400|ref|ZP_07247210.1| conserved hypothetical protein TIGR00103 [Escherichia coli MS
           146-1]
 gi|306813062|ref|ZP_07447255.1| hypothetical protein ECNC101_14157 [Escherichia coli NC101]
 gi|307137115|ref|ZP_07496471.1| hypothetical protein EcolH7_03150 [Escherichia coli H736]
 gi|307314968|ref|ZP_07594557.1| conserved hypothetical protein [Escherichia coli W]
 gi|309786054|ref|ZP_07680683.1| conserved hypothetical protein [Shigella dysenteriae 1617]
 gi|309794793|ref|ZP_07689214.1| conserved hypothetical protein TIGR00103 [Escherichia coli MS
           145-7]
 gi|312964464|ref|ZP_07778758.1| conserved hypothetical protein [Escherichia coli 2362-75]
 gi|312970570|ref|ZP_07784751.1| conserved hypothetical protein [Escherichia coli 1827-70]
 gi|331640995|ref|ZP_08342130.1| conserved hypothetical protein [Escherichia coli H736]
 gi|331645657|ref|ZP_08346760.1| conserved hypothetical protein [Escherichia coli M605]
 gi|331651411|ref|ZP_08352436.1| conserved hypothetical protein [Escherichia coli M718]
 gi|331656529|ref|ZP_08357491.1| conserved hypothetical protein [Escherichia coli TA206]
 gi|331661854|ref|ZP_08362777.1| conserved hypothetical protein [Escherichia coli TA143]
 gi|331666831|ref|ZP_08367705.1| conserved hypothetical protein [Escherichia coli TA271]
 gi|331676145|ref|ZP_08376857.1| conserved hypothetical protein [Escherichia coli H591]
 gi|331681866|ref|ZP_08382499.1| conserved hypothetical protein [Escherichia coli H299]
 gi|332281623|ref|ZP_08394036.1| conserved hypothetical protein [Shigella sp. D9]
 gi|67475997|sp|P0A8B5|YBAB_ECOLI RecName: Full=UPF0133 protein ybaB
 gi|67475998|sp|P0A8B6|YBAB_ECOL6 RecName: Full=UPF0133 protein ybaB
 gi|67476001|sp|P0A8B7|YBAB_ECO57 RecName: Full=UPF0133 protein ybaB
 gi|67476002|sp|P0A8B8|YBAB_SALTY RecName: Full=UPF0133 protein ybaB
 gi|67476003|sp|P0A8B9|YBAB_SALTI RecName: Full=UPF0133 protein ybaB
 gi|67476004|sp|P0A8C0|YBAB_SHIFL RecName: Full=UPF0133 protein ybaB
 gi|75484548|sp|Q57S79|YBAB_SALCH RecName: Full=UPF0133 protein ybaB
 gi|122958520|sp|Q0TKH0|YBAB_ECOL5 RecName: Full=UPF0133 protein ybaB
 gi|123147207|sp|Q0T7B3|YBAB_SHIF8 RecName: Full=UPF0133 protein ybaB
 gi|123560411|sp|Q325C5|YBAB_SHIBS RecName: Full=UPF0133 protein ybaB
 gi|123563328|sp|Q32J51|YBAB_SHIDS RecName: Full=UPF0133 protein ybaB
 gi|123617862|sp|Q3Z4S8|YBAB_SHISS RecName: Full=UPF0133 protein ybaB
 gi|166227562|sp|A1A8D7|YBAB_ECOK1 RecName: Full=UPF0133 protein ybaB
 gi|166919061|sp|A7ZXC9|YBAB_ECOHS RecName: Full=UPF0133 protein ybaB
 gi|189041065|sp|B1IZC3|YBAB_ECOLC RecName: Full=UPF0133 protein ybaB
 gi|189041066|sp|A9MLY8|YBAB_SALAR RecName: Full=UPF0133 protein ybaB
 gi|189041067|sp|A9MW90|YBAB_SALPB RecName: Full=UPF0133 protein ybaB
 gi|226708987|sp|B7MDZ3|YBAB_ECO45 RecName: Full=UPF0133 protein ybaB
 gi|226708988|sp|B7NIF9|YBAB_ECO7I RecName: Full=UPF0133 protein ybaB
 gi|226708990|sp|B7N924|YBAB_ECOLU RecName: Full=UPF0133 protein ybaB
 gi|226708991|sp|B1LJM8|YBAB_ECOSM RecName: Full=UPF0133 protein ybaB
 gi|226708992|sp|B7LLP9|YBAB_ESCF3 RecName: Full=UPF0133 protein ybaB
 gi|229484922|sp|B1XFQ8|YBAB_ECODH RecName: Full=UPF0133 protein ybaB
 gi|238058961|sp|B5Z3Y1|YBAB_ECO5E RecName: Full=UPF0133 protein ybaB
 gi|238058962|sp|B6I0C3|YBAB_ECOSE RecName: Full=UPF0133 protein ybaB
 gi|238689518|sp|B2U4S4|YBAB_SHIB3 RecName: Full=UPF0133 protein ybaB
 gi|238690002|sp|B5EXM7|YBAB_SALA4 RecName: Full=UPF0133 protein ybaB
 gi|238690234|sp|B4T9H8|YBAB_SALHS RecName: Full=UPF0133 protein ybaB
 gi|238690326|sp|B5FKY9|YBAB_SALDC RecName: Full=UPF0133 protein ybaB
 gi|238690392|sp|B5QU74|YBAB_SALEP RecName: Full=UPF0133 protein ybaB
 gi|238690473|sp|B5R609|YBAB_SALG2 RecName: Full=UPF0133 protein ybaB
 gi|238690700|sp|B4TMG3|YBAB_SALSV RecName: Full=UPF0133 protein ybaB
 gi|238693546|sp|B4SWX8|YBAB_SALNS RecName: Full=UPF0133 protein ybaB
 gi|254807357|sp|B7UKF1|YBAB_ECO27 RecName: Full=UPF0133 protein ybaB
 gi|254807358|sp|B7L796|YBAB_ECO55 RecName: Full=UPF0133 protein ybaB
 gi|254807359|sp|B7MQI6|YBAB_ECO81 RecName: Full=UPF0133 protein ybaB
 gi|254807360|sp|C0Q809|YBAB_SALPC RecName: Full=UPF0133 protein ybaB
 gi|259710205|sp|C4ZUS5|YBAB_ECOBW RecName: Full=UPF0133 protein ybaB
 gi|25302539|pir||AH0562 conserved hypothetical protein STY0529 [imported] - Salmonella
           enterica subsp. enterica serovar Typhi (strain CT18)
 gi|33358150|pdb|1PUG|A Chain A, Structure Of E. Coli Ybab
 gi|33358151|pdb|1PUG|B Chain B, Structure Of E. Coli Ybab
 gi|33358152|pdb|1PUG|C Chain C, Structure Of E. Coli Ybab
 gi|33358153|pdb|1PUG|D Chain D, Structure Of E. Coli Ybab
 gi|12513341|gb|AAG54820.1|AE005226_3 orf, hypothetical protein [Escherichia coli O157:H7 str. EDL933]
 gi|145298|gb|AAA23458.1| orf12 ORF [Escherichia coli]
 gi|1786677|gb|AAC73573.1| conserved protein [Escherichia coli str. K-12 substr. MG1655]
 gi|13359981|dbj|BAB33947.1| hypothetical protein [Escherichia coli O157:H7 str. Sakai]
 gi|16418993|gb|AAL19439.1| putative cytoplasmic protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|16501756|emb|CAD04970.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Typhi]
 gi|29138396|gb|AAO69966.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|30040215|gb|AAP15948.1| hypothetical protein S0423 [Shigella flexneri 2a str. 2457T]
 gi|56383221|gb|AAN42071.2| orf, conserved hypothetical protein [Shigella flexneri 2a str. 301]
 gi|62126729|gb|AAX64432.1| Hypothetical UPF0133 protein ybaB [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|73854527|gb|AAZ87234.1| conserved hypothetical protein [Shigella sonnei Ss046]
 gi|81239946|gb|ABB60656.1| conserved hypothetical protein [Shigella dysenteriae Sd197]
 gi|81244375|gb|ABB65083.1| conserved hypothetical protein [Shigella boydii Sb227]
 gi|85674610|dbj|BAE76250.1| conserved hypothetical protein [Escherichia coli str. K12 substr.
           W3110]
 gi|110342324|gb|ABG68561.1| hypothetical UPF0133 protein YbaB [Escherichia coli 536]
 gi|110614046|gb|ABF02713.1| conserved hypothetical protein [Shigella flexneri 5 str. 8401]
 gi|115511852|gb|ABI99926.1| conserved hypothetical protein [Escherichia coli APEC O1]
 gi|157065678|gb|ABV04933.1| conserved hypothetical protein TIGR00103 [Escherichia coli HS]
 gi|160865687|gb|ABX22310.1| hypothetical protein SARI_02449 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
 gi|161364681|gb|ABX68449.1| hypothetical protein SPAB_03087 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|169756069|gb|ACA78768.1| conserved hypothetical protein [Escherichia coli ATCC 8739]
 gi|169887891|gb|ACB01598.1| conserved protein [Escherichia coli str. K-12 substr. DH10B]
 gi|170519856|gb|ACB18034.1| conserved hypothetical protein [Escherichia coli SMS-3-5]
 gi|187431102|gb|ACD10376.1| conserved hypothetical protein [Shigella boydii CDC 3083-94]
 gi|187767560|gb|EDU31404.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4196]
 gi|188017591|gb|EDU55713.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4113]
 gi|188488629|gb|EDU63732.1| conserved hypothetical protein TIGR00103 [Escherichia coli 53638]
 gi|189002891|gb|EDU71877.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4076]
 gi|189358065|gb|EDU76484.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4401]
 gi|189362488|gb|EDU80907.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4486]
 gi|189369059|gb|EDU87475.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4501]
 gi|189373470|gb|EDU91886.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC869]
 gi|189379256|gb|EDU97672.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC508]
 gi|190902476|gb|EDV62212.1| conserved hypothetical protein [Escherichia coli B7A]
 gi|190906015|gb|EDV65630.1| conserved hypothetical protein [Escherichia coli F11]
 gi|192929228|gb|EDV82838.1| conserved hypothetical protein [Escherichia coli E22]
 gi|192959097|gb|EDV89533.1| conserved hypothetical protein [Escherichia coli E110019]
 gi|194403630|gb|ACF63852.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194406445|gb|ACF66664.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|194412940|gb|EDX29230.1| conserved hypothetical protein [Escherichia coli B171]
 gi|194418987|gb|EDX35071.1| conserved hypothetical protein [Shigella dysenteriae 1012]
 gi|194423554|gb|EDX39544.1| conserved hypothetical protein [Escherichia coli 101-1]
 gi|194456929|gb|EDX45768.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|194710947|gb|ACF90168.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|195632035|gb|EDX50555.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|197212543|gb|ACH49940.1| conserved hypothetical protein TIGR00103 [Salmonella enterica
           subsp. enterica serovar Agona str. SL483]
 gi|197243760|gb|EDY26380.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|197289577|gb|EDY28940.1| conserved hypothetical protein TIGR00103 [Salmonella enterica
           subsp. enterica serovar Schwarzengrund str. SL480]
 gi|197937349|gb|ACH74682.1| conserved hypothetical protein TIGR00103 [Salmonella enterica
           subsp. enterica serovar Dublin str. CT_02021853]
 gi|199602685|gb|EDZ01231.1| conserved hypothetical protein TIGR00103 [Salmonella enterica
           subsp. enterica serovar Virchow str. SL491]
 gi|204320554|gb|EDZ05757.1| conserved hypothetical protein TIGR00103 [Salmonella enterica
           subsp. enterica serovar Javiana str. GA_MM04042433]
 gi|205271574|emb|CAR36394.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|205324172|gb|EDZ12011.1| conserved hypothetical protein TIGR00103 [Salmonella enterica
           subsp. enterica serovar Saintpaul str. SARA29]
 gi|205331043|gb|EDZ17807.1| conserved hypothetical protein TIGR00103 [Salmonella enterica
           subsp. enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|205334010|gb|EDZ20774.1| conserved hypothetical protein TIGR00103 [Salmonella enterica
           subsp. enterica serovar Kentucky str. CDC 191]
 gi|205339885|gb|EDZ26649.1| conserved hypothetical protein TIGR00103 [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL486]
 gi|205344092|gb|EDZ30856.1| conserved hypothetical protein TIGR00103 [Salmonella enterica
           subsp. enterica serovar Weltevreden str. HI_N05-537]
 gi|205349942|gb|EDZ36573.1| conserved hypothetical protein TIGR00103 [Salmonella enterica
           subsp. enterica serovar Hadar str. RI_05P066]
 gi|206707767|emb|CAR32052.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|208729349|gb|EDZ78950.1| conserved hypothetical protein TIGR00103 [Escherichia coli O157:H7
           str. EC4206]
 gi|208731568|gb|EDZ80256.1| conserved hypothetical protein TIGR00103 [Escherichia coli O157:H7
           str. EC4045]
 gi|208737249|gb|EDZ84933.1| conserved hypothetical protein TIGR00103 [Escherichia coli O157:H7
           str. EC4042]
 gi|209159493|gb|ACI36926.1| conserved hypothetical protein TIGR00103 [Escherichia coli O157:H7
           str. EC4115]
 gi|209778378|gb|ACI87501.1| hypothetical protein ECs0524 [Escherichia coli]
 gi|209778380|gb|ACI87502.1| hypothetical protein ECs0524 [Escherichia coli]
 gi|209778382|gb|ACI87503.1| hypothetical protein ECs0524 [Escherichia coli]
 gi|209778384|gb|ACI87504.1| hypothetical protein ECs0524 [Escherichia coli]
 gi|209778386|gb|ACI87505.1| hypothetical protein ECs0524 [Escherichia coli]
 gi|209910946|dbj|BAG76020.1| conserved hypothetical protein [Escherichia coli SE11]
 gi|215263623|emb|CAS07954.1| predicted protein [Escherichia coli O127:H6 str. E2348/69]
 gi|217320419|gb|EEC28843.1| conserved hypothetical protein TIGR00103 [Escherichia coli O157:H7
           str. TW14588]
 gi|218350665|emb|CAU96357.1| conserved hypothetical protein [Escherichia coli 55989]
 gi|218357402|emb|CAQ90041.1| conserved hypothetical protein [Escherichia fergusonii ATCC 35469]
 gi|218364150|emb|CAR01815.1| conserved hypothetical protein [Escherichia coli S88]
 gi|218368603|emb|CAR16340.1| conserved hypothetical protein [Escherichia coli IAI39]
 gi|218425898|emb|CAR06704.1| conserved hypothetical protein [Escherichia coli ED1a]
 gi|218430851|emb|CAR11725.1| conserved hypothetical protein [Escherichia coli UMN026]
 gi|222032265|emb|CAP75004.1| UPF0133 protein ybaB [Escherichia coli LF82]
 gi|224466849|gb|ACN44679.1| hypothetical protein SPC_0499 [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|226898741|gb|EEH85000.1| ybaB [Escherichia sp. 3_2_53FAA]
 gi|227838602|gb|EEJ49068.1| conserved hypothetical protein [Escherichia coli 83972]
 gi|238860442|gb|ACR62440.1| conserved protein [Escherichia coli BW2952]
 gi|242376253|emb|CAQ30944.1| conserved DNA-binding protein [Escherichia coli BL21(DE3)]
 gi|253325583|gb|ACT30185.1| conserved hypothetical protein [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|253972441|gb|ACT38112.1| hypothetical protein ECB_00422 [Escherichia coli B str. REL606]
 gi|253976651|gb|ACT42321.1| hypothetical protein ECD_00422 [Escherichia coli BL21(DE3)]
 gi|254591054|gb|ACT70415.1| conserved protein [Escherichia coli O157:H7 str. TW14359]
 gi|257752343|dbj|BAI23845.1| conserved predicted protein [Escherichia coli O26:H11 str. 11368]
 gi|257757818|dbj|BAI29315.1| conserved predicted protein [Escherichia coli O103:H2 str. 12009]
 gi|257762988|dbj|BAI34483.1| conserved predicted protein [Escherichia coli O111:H- str. 11128]
 gi|260450343|gb|ACX40765.1| conserved hypothetical protein [Escherichia coli DH1]
 gi|267992202|gb|ACY87087.1| hypothetical protein STM14_0570 [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 14028S]
 gi|281177641|dbj|BAI53971.1| conserved hypothetical protein [Escherichia coli SE15]
 gi|281599810|gb|ADA72794.1| protein ybaB [Shigella flexneri 2002017]
 gi|284920280|emb|CBG33339.1| conserved hypothetical protein [Escherichia coli 042]
 gi|290761250|gb|ADD55211.1| UPF0133 protein ybaB [Escherichia coli O55:H7 str. CB9615]
 gi|291325068|gb|EFE64483.1| hypothetical protein ECCG_03423 [Escherichia coli B088]
 gi|291429445|gb|EFF02465.1| hypothetical protein ECGG_04308 [Escherichia coli FVEC1412]
 gi|291433782|gb|EFF06755.1| hypothetical protein ECDG_00266 [Escherichia coli B185]
 gi|291471798|gb|EFF14281.1| hypothetical protein ECEG_03563 [Escherichia coli B354]
 gi|294492005|gb|ADE90761.1| conserved hypothetical protein TIGR00103 [Escherichia coli IHE3034]
 gi|298280315|gb|EFI21819.1| ybaB protein [Escherichia coli FVEC1302]
 gi|299880983|gb|EFI89194.1| conserved hypothetical protein TIGR00103 [Escherichia coli MS
           196-1]
 gi|300298573|gb|EFJ54958.1| conserved hypothetical protein TIGR00103 [Escherichia coli MS
           185-1]
 gi|300304300|gb|EFJ58820.1| hypothetical protein HMPREF9553_05131 [Escherichia coli MS 200-1]
 gi|300315307|gb|EFJ65091.1| hypothetical protein HMPREF9547_03761 [Escherichia coli MS 175-1]
 gi|300356026|gb|EFJ71896.1| conserved hypothetical protein TIGR00103 [Escherichia coli MS
           198-1]
 gi|300397483|gb|EFJ81021.1| conserved hypothetical protein TIGR00103 [Escherichia coli MS 69-1]
 gi|300404697|gb|EFJ88235.1| hypothetical protein HMPREF9536_01393 [Escherichia coli MS 84-1]
 gi|300407629|gb|EFJ91167.1| conserved hypothetical protein TIGR00103 [Escherichia coli MS 45-1]
 gi|300413092|gb|EFJ96402.1| conserved hypothetical protein TIGR00103 [Escherichia coli MS
           115-1]
 gi|300419652|gb|EFK02963.1| hypothetical protein HMPREF9548_02364 [Escherichia coli MS 182-1]
 gi|300452550|gb|EFK16170.1| conserved hypothetical protein TIGR00103 [Escherichia coli MS
           116-1]
 gi|300459051|gb|EFK22544.1| conserved hypothetical protein TIGR00103 [Escherichia coli MS 21-1]
 gi|300461879|gb|EFK25372.1| conserved hypothetical protein TIGR00103 [Escherichia coli MS
           187-1]
 gi|300527067|gb|EFK48136.1| conserved hypothetical protein TIGR00103 [Escherichia coli MS
           119-7]
 gi|300529086|gb|EFK50148.1| conserved hypothetical protein TIGR00103 [Escherichia coli MS
           107-1]
 gi|300843322|gb|EFK71082.1| conserved hypothetical protein TIGR00103 [Escherichia coli MS 78-1]
 gi|301074455|gb|EFK89261.1| conserved hypothetical protein TIGR00103 [Escherichia coli MS
           146-1]
 gi|301157094|emb|CBW16578.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. SL1344]
 gi|305853825|gb|EFM54264.1| hypothetical protein ECNC101_14157 [Escherichia coli NC101]
 gi|306905607|gb|EFN36138.1| conserved hypothetical protein [Escherichia coli W]
 gi|307552377|gb|ADN45152.1| putative cytoplasmic protein [Escherichia coli ABU 83972]
 gi|307628060|gb|ADN72364.1| hypothetical protein UM146_15005 [Escherichia coli UM146]
 gi|308121446|gb|EFO58708.1| conserved hypothetical protein TIGR00103 [Escherichia coli MS
           145-7]
 gi|308926165|gb|EFP71643.1| conserved hypothetical protein [Shigella dysenteriae 1617]
 gi|309700731|emb|CBJ00027.1| conserved hypothetical protein [Escherichia coli ETEC H10407]
 gi|310337219|gb|EFQ02357.1| conserved hypothetical protein [Escherichia coli 1827-70]
 gi|312290941|gb|EFR18817.1| conserved hypothetical protein [Escherichia coli 2362-75]
 gi|312911517|dbj|BAJ35491.1| hypothetical protein STMDT12_C05480 [Salmonella enterica subsp.
           enterica serovar Typhimurium str. T000240]
 gi|312945048|gb|ADR25875.1| hypothetical protein NRG857_02230 [Escherichia coli O83:H1 str. NRG
           857C]
 gi|313646899|gb|EFS11356.1| hypothetical protein SF2457T_4683 [Shigella flexneri 2a str. 2457T]
 gi|315059750|gb|ADT74077.1| conserved protein [Escherichia coli W]
 gi|315135152|dbj|BAJ42311.1| hypothetical protein ECDH1ME8569_0455 [Escherichia coli DH1]
 gi|315256301|gb|EFU36269.1| putative cytoplasmic protein [Escherichia coli MS 85-1]
 gi|315289906|gb|EFU49296.1| conserved hypothetical protein TIGR00103 [Escherichia coli MS
           110-3]
 gi|315294237|gb|EFU53588.1| conserved hypothetical protein TIGR00103 [Escherichia coli MS
           153-1]
 gi|315297999|gb|EFU57269.1| conserved hypothetical protein TIGR00103 [Escherichia coli MS 16-3]
 gi|315616587|gb|EFU97204.1| conserved hypothetical protein [Escherichia coli 3431]
 gi|320084760|emb|CBY94550.1| UPF0133 protein VF_1686 [Salmonella enterica subsp. enterica
           serovar Weltevreden str. 2007-60-3289-1]
 gi|320176555|gb|EFW51599.1| hypothetical protein SDB_00924 [Shigella dysenteriae CDC 74-1112]
 gi|320181086|gb|EFW56006.1| hypothetical protein SGB_01726 [Shigella boydii ATCC 9905]
 gi|320184089|gb|EFW58908.1| hypothetical protein SGF_03723 [Shigella flexneri CDC 796-83]
 gi|320192889|gb|EFW67529.1| hypothetical protein ECoD_00136 [Escherichia coli O157:H7 str.
           EC1212]
 gi|320197052|gb|EFW71671.1| hypothetical protein EcoM_00707 [Escherichia coli WV_060327]
 gi|320201717|gb|EFW76293.1| hypothetical protein ECoL_00944 [Escherichia coli EC4100B]
 gi|320638465|gb|EFX08179.1| hypothetical protein ECO5101_18300 [Escherichia coli O157:H7 str.
           G5101]
 gi|320643846|gb|EFX12969.1| hypothetical protein ECO9389_22666 [Escherichia coli O157:H- str.
           493-89]
 gi|320649197|gb|EFX17775.1| hypothetical protein ECO2687_23713 [Escherichia coli O157:H- str. H
           2687]
 gi|320656090|gb|EFX24006.1| hypothetical protein ECO7815_11478 [Escherichia coli O55:H7 str.
           3256-97 TW 07815]
 gi|320661240|gb|EFX28671.1| hypothetical protein ECO5905_16453 [Escherichia coli O55:H7 str.
           USDA 5905]
 gi|320665216|gb|EFX32309.1| hypothetical protein ECOSU61_23190 [Escherichia coli O157:H7 str.
           LSU-61]
 gi|321226063|gb|EFX51114.1| hypothetical protein co-occurring with RecR [Salmonella enterica
           subsp. enterica serovar Typhimurium str. TN061786]
 gi|322614761|gb|EFY11690.1| hypothetical protein SEEM315_19050 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315996572]
 gi|322618868|gb|EFY15756.1| hypothetical protein SEEM971_12144 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-1]
 gi|322623575|gb|EFY20414.1| hypothetical protein SEEM973_07166 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-3]
 gi|322629126|gb|EFY25905.1| hypothetical protein SEEM974_09263 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-4]
 gi|322631847|gb|EFY28601.1| hypothetical protein SEEM201_08434 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-1]
 gi|322637416|gb|EFY34118.1| hypothetical protein SEEM202_20209 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-2]
 gi|322642101|gb|EFY38711.1| hypothetical protein SEEM954_03155 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 531954]
 gi|322645875|gb|EFY42396.1| hypothetical protein SEEM054_08998 [Salmonella enterica subsp.
           enterica serovar Montevideo str. NC_MB110209-0054]
 gi|322652337|gb|EFY48692.1| hypothetical protein SEEM675_10385 [Salmonella enterica subsp.
           enterica serovar Montevideo str. OH_2009072675]
 gi|322653240|gb|EFY49573.1| hypothetical protein SEEM965_18304 [Salmonella enterica subsp.
           enterica serovar Montevideo str. CASC_09SCPH15965]
 gi|322660611|gb|EFY56847.1| hypothetical protein SEEM19N_21118 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 19N]
 gi|322664763|gb|EFY60956.1| hypothetical protein SEEM801_07612 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 81038-01]
 gi|322669184|gb|EFY65334.1| hypothetical protein SEEM507_00235 [Salmonella enterica subsp.
           enterica serovar Montevideo str. MD_MDA09249507]
 gi|322670729|gb|EFY66862.1| hypothetical protein SEEM877_05987 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 414877]
 gi|322679032|gb|EFY75087.1| hypothetical protein SEEM867_13370 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 366867]
 gi|322682061|gb|EFY78086.1| hypothetical protein SEEM180_17438 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 413180]
 gi|322685110|gb|EFY81107.1| hypothetical protein SEEM600_20847 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 446600]
 gi|322713557|gb|EFZ05128.1| hypothetical protein SCA50_0562 [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. A50]
 gi|323128804|gb|ADX16234.1| hypothetical protein STM474_0505 [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 4/74]
 gi|323153373|gb|EFZ39628.1| hypothetical protein ECEPECA14_4631 [Escherichia coli EPECa14]
 gi|323160527|gb|EFZ46474.1| hypothetical protein ECE128010_3230 [Escherichia coli E128010]
 gi|323164277|gb|EFZ50084.1| hypothetical protein SS53G_5565 [Shigella sonnei 53G]
 gi|323170567|gb|EFZ56217.1| hypothetical protein ECLT68_4631 [Escherichia coli LT-68]
 gi|323178254|gb|EFZ63832.1| hypothetical protein ECOK1180_2765 [Escherichia coli 1180]
 gi|323184698|gb|EFZ70069.1| hypothetical protein ECOK1357_1825 [Escherichia coli 1357]
 gi|323191137|gb|EFZ76401.1| hypothetical protein ECRN5871_0425 [Escherichia coli RN587/1]
 gi|323192996|gb|EFZ78219.1| hypothetical protein SEEM581_05863 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609458-1]
 gi|323196922|gb|EFZ82064.1| hypothetical protein SEEM501_12591 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556150-1]
 gi|323203907|gb|EFZ88924.1| hypothetical protein SEEM460_00910 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609460]
 gi|323207008|gb|EFZ91961.1| hypothetical protein SEEM020_03649 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 507440-20]
 gi|323214211|gb|EFZ98969.1| hypothetical protein SEEM6152_08257 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556152]
 gi|323214465|gb|EFZ99216.1| hypothetical protein SEEM0077_17525 [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB101509-0077]
 gi|323219192|gb|EGA03689.1| hypothetical protein SEEM0047_16248 [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB102109-0047]
 gi|323226971|gb|EGA11152.1| hypothetical protein SEEM0055_12612 [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB110209-0055]
 gi|323230211|gb|EGA14331.1| hypothetical protein SEEM0052_02397 [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB111609-0052]
 gi|323233949|gb|EGA18038.1| hypothetical protein SEEM3312_08053 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009083312]
 gi|323238357|gb|EGA22415.1| hypothetical protein SEEM5258_08857 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009085258]
 gi|323244044|gb|EGA28053.1| hypothetical protein SEEM1156_08780 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315731156]
 gi|323246632|gb|EGA30606.1| hypothetical protein SEEM9199_17145 [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2009159199]
 gi|323251831|gb|EGA35694.1| hypothetical protein SEEM8282_13712 [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008282]
 gi|323257827|gb|EGA41506.1| hypothetical protein SEEM8283_03026 [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008283]
 gi|323261159|gb|EGA44751.1| hypothetical protein SEEM8284_06427 [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008284]
 gi|323264911|gb|EGA48410.1| hypothetical protein SEEM8285_19489 [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008285]
 gi|323272474|gb|EGA55881.1| hypothetical protein SEEM8287_14264 [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008287]
 gi|323379685|gb|ADX51953.1| Uncharacterized protein family UPF0133 [Escherichia coli KO11]
 gi|323938657|gb|EGB34906.1| ybaB [Escherichia coli E1520]
 gi|323943276|gb|EGB39432.1| hypothetical protein ERDG_00247 [Escherichia coli E482]
 gi|323945254|gb|EGB41311.1| ybaB [Escherichia coli H120]
 gi|323952918|gb|EGB48786.1| hypothetical protein ERKG_00691 [Escherichia coli H252]
 gi|323958539|gb|EGB54243.1| hypothetical protein ERLG_00247 [Escherichia coli H263]
 gi|323963460|gb|EGB59022.1| hypothetical protein ERGG_00228 [Escherichia coli H489]
 gi|323965157|gb|EGB60616.1| hypothetical protein ERJG_03515 [Escherichia coli M863]
 gi|323972325|gb|EGB67535.1| hypothetical protein ERHG_01760 [Escherichia coli TA007]
 gi|323976045|gb|EGB71138.1| hypothetical protein ERFG_02977 [Escherichia coli TW10509]
 gi|324010052|gb|EGB79271.1| hypothetical protein HMPREF9532_00233 [Escherichia coli MS 57-2]
 gi|324010643|gb|EGB79862.1| conserved hypothetical protein TIGR00103 [Escherichia coli MS 60-1]
 gi|324016729|gb|EGB85948.1| hypothetical protein HMPREF9542_04620 [Escherichia coli MS 117-3]
 gi|324114696|gb|EGC08664.1| hypothetical protein ERIG_00690 [Escherichia fergusonii B253]
 gi|324116959|gb|EGC10872.1| hypothetical protein ERBG_03188 [Escherichia coli E1167]
 gi|325498241|gb|EGC96100.1| hypothetical protein ECD227_2338 [Escherichia fergusonii ECD227]
 gi|326341237|gb|EGD65029.1| hypothetical protein ECoA_03726 [Escherichia coli O157:H7 str.
           1044]
 gi|326345988|gb|EGD69727.1| hypothetical protein ECF_00815 [Escherichia coli O157:H7 str. 1125]
 gi|326622185|gb|EGE28530.1| hypothetical protein SD3246_0514 [Salmonella enterica subsp.
           enterica serovar Dublin str. 3246]
 gi|326626829|gb|EGE33172.1| hypothetical protein SG9_0506 [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 9]
 gi|327254798|gb|EGE66414.1| hypothetical protein ECSTEC7V_0554 [Escherichia coli STEC_7v]
 gi|330910266|gb|EGH38776.1| hypothetical protein co-occurring with RecR [Escherichia coli AA86]
 gi|331037793|gb|EGI10013.1| conserved hypothetical protein [Escherichia coli H736]
 gi|331044409|gb|EGI16536.1| conserved hypothetical protein [Escherichia coli M605]
 gi|331051152|gb|EGI23204.1| conserved hypothetical protein [Escherichia coli M718]
 gi|331054777|gb|EGI26786.1| conserved hypothetical protein [Escherichia coli TA206]
 gi|331060276|gb|EGI32240.1| conserved hypothetical protein [Escherichia coli TA143]
 gi|331066055|gb|EGI37939.1| conserved hypothetical protein [Escherichia coli TA271]
 gi|331076203|gb|EGI47485.1| conserved hypothetical protein [Escherichia coli H591]
 gi|331081068|gb|EGI52233.1| conserved hypothetical protein [Escherichia coli H299]
 gi|332094160|gb|EGI99211.1| hypothetical protein SB521682_0495 [Shigella boydii 5216-82]
 gi|332096996|gb|EGJ01980.1| hypothetical protein SD15574_0808 [Shigella dysenteriae 155-74]
 gi|332098474|gb|EGJ03440.1| hypothetical protein SB359474_0386 [Shigella boydii 3594-74]
 gi|332103975|gb|EGJ07321.1| conserved hypothetical protein [Shigella sp. D9]
 gi|332341837|gb|AEE55171.1| conserved hypothetical protein [Escherichia coli UMNK88]
 gi|332760764|gb|EGJ91052.1| hypothetical protein SF434370_0618 [Shigella flexneri 4343-70]
 gi|332761493|gb|EGJ91775.1| hypothetical protein SF274771_0495 [Shigella flexneri 2747-71]
 gi|332768396|gb|EGJ98580.1| conserved DNA-binding protein [Shigella flexneri 2930-71]
 gi|332987434|gb|AEF06417.1| hypothetical protein STMUK_0492 [Salmonella enterica subsp.
           enterica serovar Typhimurium str. UK-1]
 gi|333007960|gb|EGK27436.1| hypothetical protein SFK218_0711 [Shigella flexneri K-218]
 gi|333008161|gb|EGK27636.1| hypothetical protein SFVA6_0818 [Shigella flexneri VA-6]
 gi|333009907|gb|EGK29342.1| hypothetical protein SFK272_0765 [Shigella flexneri K-272]
 gi|333020741|gb|EGK40001.1| hypothetical protein SFK227_0724 [Shigella flexneri K-227]
 gi|333021964|gb|EGK41212.1| hypothetical protein SFK304_0575 [Shigella flexneri K-304]
          Length = 109

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 48/107 (44%), Positives = 70/107 (65%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           + N+MK   Q +++Q KM+KM+E I  LE  G +G G+V V ING +    V+ID SLL 
Sbjct: 7   LGNLMK---QAQQMQEKMQKMQEEIAQLEVTGESGAGLVKVTINGAHNCRRVEIDPSLL- 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ E+LEDL+ AA +DA ++IE+    K   ++ G+ +PPG K PF
Sbjct: 63  EDDKEMLEDLVAAAFNDAARRIEETQKEKMASVSSGMQLPPGFKMPF 109


>gi|261245767|emb|CBG23564.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. D23580]
          Length = 117

 Score = 90.9 bits (224), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 48/107 (44%), Positives = 70/107 (65%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           + N+MK   Q +++Q KM+KM+E I  LE  G +G G+V V ING +    V+ID SLL 
Sbjct: 15  LGNLMK---QAQQMQEKMQKMQEEIAQLEVTGESGAGLVKVTINGAHNCRRVEIDPSLL- 70

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ E+LEDL+ AA +DA ++IE+    K   ++ G+ +PPG K PF
Sbjct: 71  EDDKEMLEDLVAAAFNDAARRIEETQKEKMASVSSGMQLPPGFKMPF 117


>gi|156934950|ref|YP_001438866.1| hypothetical protein ESA_02800 [Cronobacter sakazakii ATCC BAA-894]
 gi|260596870|ref|YP_003209441.1| hypothetical protein CTU_10780 [Cronobacter turicensis z3032]
 gi|166200347|sp|A7MJX1|Y2800_ENTS8 RecName: Full=UPF0133 protein ESA_02800
 gi|156533204|gb|ABU78030.1| hypothetical protein ESA_02800 [Cronobacter sakazakii ATCC BAA-894]
 gi|260216047|emb|CBA28759.1| UPF0133 protein ESA_02800 [Cronobacter turicensis z3032]
          Length = 110

 Score = 90.9 bits (224), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 48/107 (44%), Positives = 70/107 (65%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           + N+MK   Q +++Q KM+KM+E I  LE  G +G G+V V ING +    V+ID SLL 
Sbjct: 8   LGNLMK---QAQQMQEKMQKMQEEIAQLEVTGESGAGLVKVTINGAHNCRRVEIDPSLL- 63

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ E+LEDL+ AA +DA ++IE+    K   ++ G+ +PPG K PF
Sbjct: 64  EDDKEMLEDLVAAAFNDAARRIEETQKEKMASVSSGMQLPPGFKMPF 110


>gi|26246486|ref|NP_752525.1| hypothetical protein c0591 [Escherichia coli CFT073]
 gi|91209545|ref|YP_539531.1| hypothetical protein UTI89_C0499 [Escherichia coli UTI89]
 gi|26106884|gb|AAN79069.1|AE016756_252 Hypothetical protein ybaB [Escherichia coli CFT073]
 gi|91071119|gb|ABE06000.1| conserved hypothetical protein [Escherichia coli UTI89]
          Length = 114

 Score = 90.5 bits (223), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 48/107 (44%), Positives = 70/107 (65%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           + N+MK   Q +++Q KM+KM+E I  LE  G +G G+V V ING +    V+ID SLL 
Sbjct: 12  LGNLMK---QAQQMQEKMQKMQEEIAQLEVTGESGAGLVKVTINGAHNCRRVEIDPSLL- 67

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ E+LEDL+ AA +DA ++IE+    K   ++ G+ +PPG K PF
Sbjct: 68  EDDKEMLEDLVAAAFNDAARRIEETQKEKMASVSSGMQLPPGFKMPF 114


>gi|212711280|ref|ZP_03319408.1| hypothetical protein PROVALCAL_02352 [Providencia alcalifaciens DSM
           30120]
 gi|261345763|ref|ZP_05973407.1| putative cytoplasmic protein [Providencia rustigianii DSM 4541]
 gi|212686009|gb|EEB45537.1| hypothetical protein PROVALCAL_02352 [Providencia alcalifaciens DSM
           30120]
 gi|282566252|gb|EFB71787.1| putative cytoplasmic protein [Providencia rustigianii DSM 4541]
          Length = 109

 Score = 90.5 bits (223), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 48/107 (44%), Positives = 71/107 (66%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           + N+MK   Q +++Q KM+K++E I  LEA G +G G+V V ING +    V+ID SLL 
Sbjct: 7   LGNLMK---QAQQMQDKMQKVQEEIAQLEATGESGAGLVKVTINGSHNCRRVEIDPSLL- 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ ++LEDLI AA +DA ++IE+    K   ++ G+ +PPG K PF
Sbjct: 63  EDDKDMLEDLIAAAFNDAARRIEETQKEKMASVSSGMQLPPGFKMPF 109


>gi|152969026|ref|YP_001334135.1| hypothetical protein KPN_00453 [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|238893441|ref|YP_002918175.1| hypothetical protein KP1_1329 [Klebsiella pneumoniae NTUH-K2044]
 gi|262041604|ref|ZP_06014799.1| conserved hypothetical protein [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|330002983|ref|ZP_08304508.1| DNA-binding protein, YbaB/EbfC family [Klebsiella sp. MS 92-3]
 gi|167012949|sp|A6T5N4|Y444_KLEP7 RecName: Full=UPF0133 protein KPN78578_04440
 gi|150953875|gb|ABR75905.1| hypothetical protein KPN_00453 [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|238545757|dbj|BAH62108.1| hypothetical protein KP1_1329 [Klebsiella pneumoniae subsp.
           pneumoniae NTUH-K2044]
 gi|259041030|gb|EEW42106.1| conserved hypothetical protein [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|328537094|gb|EGF63373.1| DNA-binding protein, YbaB/EbfC family [Klebsiella sp. MS 92-3]
          Length = 110

 Score = 90.5 bits (223), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 48/107 (44%), Positives = 70/107 (65%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           + N+MK   Q +++Q KM+KM+E I  LE  G +G G+V V ING +    V+ID SLL 
Sbjct: 8   LGNLMK---QAQQMQEKMQKMQEEIAQLEVTGESGAGLVKVTINGAHNCRRVEIDPSLL- 63

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ E+LEDL+ AA +DA ++IE+    K   ++ G+ +PPG K PF
Sbjct: 64  EDDKEMLEDLVAAAFNDAARRIEETQKEKMASVSAGMQLPPGFKMPF 110


>gi|253990861|ref|YP_003042217.1| hypothetical protein PAU_03387 [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|211639196|emb|CAR67809.1| Hypothetical Protein PA-RVA20-21-0208 [Photorhabdus asymbiotica
           subsp. asymbiotica ATCC 43949]
 gi|253782311|emb|CAQ85475.1| conserved hypothetical protein [Photorhabdus asymbiotica]
          Length = 109

 Score = 90.5 bits (223), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 48/107 (44%), Positives = 70/107 (65%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           + N+MK   Q +++Q KM+KM+E I +LE  G +G G+V V ING +    V ID SL+ 
Sbjct: 7   LGNLMK---QAQQMQDKMQKMQEEIANLEVTGESGAGLVKVTINGAHNCRRVDIDPSLM- 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ E+LEDLI AA +DA ++IE+    K   ++ G+ +PPG K PF
Sbjct: 63  EDDKEMLEDLIAAAFNDAARRIEETQKEKMASVSSGMQLPPGFKMPF 109


>gi|88800844|ref|ZP_01116399.1| hypothetical protein MED297_17547 [Reinekea sp. MED297]
 gi|88776417|gb|EAR07637.1| hypothetical protein MED297_17547 [Reinekea sp. MED297]
          Length = 108

 Score = 90.5 bits (223), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 47/107 (43%), Positives = 72/107 (67%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M NIMK   Q +++Q +M+KM+E + ++E  G AG GMVSV +NG++ +  V +D S++ 
Sbjct: 6   MGNIMK---QAQKMQEEMQKMQEEVANMEVTGEAGAGMVSVVMNGRHDVKKVSVDDSVMS 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED  ++LEDL+ AA +DA +KIE     K   +T G+ +PPG+K PF
Sbjct: 63  EDK-DLLEDLLAAAVNDAVRKIESASQEKMSSVTSGMGLPPGMKLPF 108


>gi|311280617|ref|YP_003942848.1| hypothetical protein Entcl_3319 [Enterobacter cloacae SCF1]
 gi|308749812|gb|ADO49564.1| Uncharacterized protein family UPF0133 [Enterobacter cloacae SCF1]
          Length = 110

 Score = 90.5 bits (223), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 48/107 (44%), Positives = 70/107 (65%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           + N+MK   Q +++Q KM+KM+E I  LE  G +G G+V V ING +    V+ID SLL 
Sbjct: 8   LGNLMK---QAQQMQEKMQKMQEEIAKLEVTGESGAGLVKVTINGAHNCRRVEIDPSLL- 63

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ E+LEDL+ AA +DA ++IE+    K   ++ G+ +PPG K PF
Sbjct: 64  EDDKEMLEDLVAAAFNDAARRIEETQKEKMASVSSGMQLPPGFKMPF 110


>gi|260772461|ref|ZP_05881377.1| hypothetical protein VIB_000909 [Vibrio metschnikovii CIP 69.14]
 gi|260611600|gb|EEX36803.1| hypothetical protein VIB_000909 [Vibrio metschnikovii CIP 69.14]
          Length = 109

 Score = 90.5 bits (223), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 46/107 (42%), Positives = 73/107 (68%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+MK   Q +++Q +M+K++E I S+E  G +G G+V V I G + +  V+ID+SL+ 
Sbjct: 7   MGNLMK---QAQQMQDRMQKLQEEIASMEVVGESGAGLVKVTITGSHSVRRVEIDQSLM- 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ E+LEDLI AA +DA +++E+    K   +T G+ +PPG+K PF
Sbjct: 63  EDDKEMLEDLIAAAFNDAARRVEETQKDKMAAVTGGMQLPPGMKMPF 109


>gi|251793009|ref|YP_003007735.1| hypothetical protein NT05HA_1291 [Aggregatibacter aphrophilus
           NJ8700]
 gi|247534402|gb|ACS97648.1| conserved hypothetical protein [Aggregatibacter aphrophilus NJ8700]
          Length = 109

 Score = 90.1 bits (222), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 44/98 (44%), Positives = 66/98 (67%), Gaps = 1/98 (1%)

Query: 10  QFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILED 69
           Q +++Q KM+KM+E I  LE  G +G G+V + +NG +    V+ID SL+ ED+ E+LED
Sbjct: 13  QAQQMQEKMQKMQEEIAQLEVTGESGAGLVKITVNGAHNCRRVEIDPSLM-EDDKEMLED 71

Query: 70  LIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           LI AA++DA ++ E+L   K   +T G+ +PPG K PF
Sbjct: 72  LIAAAYNDAVRRAEELQKEKMASVTAGMSLPPGFKMPF 109


>gi|92113583|ref|YP_573511.1| hypothetical protein Csal_1459 [Chromohalobacter salexigens DSM
           3043]
 gi|122420127|sp|Q1QXJ6|Y1459_CHRSD RecName: Full=UPF0133 protein Csal_1459
 gi|91796673|gb|ABE58812.1| conserved hypothetical protein 103 [Chromohalobacter salexigens DSM
           3043]
          Length = 108

 Score = 90.1 bits (222), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 47/107 (43%), Positives = 72/107 (67%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+MK   Q +E+Q KM+K++E I   E  G AG GM+ V +NG++ ++ V +D S++ 
Sbjct: 6   MGNLMK---QAQEMQEKMQKIQEEIAETEVTGEAGAGMIKVTMNGRHDVSRVNVDPSVME 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED  E+LEDL+ AA +DA +K+E+    + +E TEG+ +PPG K PF
Sbjct: 63  EDK-ELLEDLLAAAVNDAVRKVEETSRGRMEEATEGMNLPPGFKMPF 108


>gi|218553037|ref|YP_002385950.1| hypothetical protein ECIAI1_0474 [Escherichia coli IAI1]
 gi|226708989|sp|B7M3W3|YBAB_ECO8A RecName: Full=UPF0133 protein ybaB
 gi|218359805|emb|CAQ97346.1| conserved hypothetical protein [Escherichia coli IAI1]
          Length = 109

 Score = 90.1 bits (222), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 47/107 (43%), Positives = 70/107 (65%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           + N+MK   Q +++Q KM+KM+E I  LE  G +G G++ V ING +    V+ID SLL 
Sbjct: 7   LGNLMK---QAQQMQEKMQKMQEEIAQLEVTGESGAGLIKVTINGAHNCRRVEIDPSLL- 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ E+LEDL+ AA +DA ++IE+    K   ++ G+ +PPG K PF
Sbjct: 63  EDDKEMLEDLVAAAFNDAARRIEETQKEKMASVSSGMQLPPGFKMPF 109


>gi|242238466|ref|YP_002986647.1| hypothetical protein Dd703_1020 [Dickeya dadantii Ech703]
 gi|242130523|gb|ACS84825.1| conserved hypothetical protein [Dickeya dadantii Ech703]
          Length = 109

 Score = 90.1 bits (222), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 47/107 (43%), Positives = 70/107 (65%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           + N+MK   Q +++Q KM+K +E I S+E  G +G G+V V ING +    V+ID SL+ 
Sbjct: 7   LGNLMK---QAQQMQEKMQKAQEEIASMEVTGESGAGLVKVTINGAHNCRRVEIDPSLM- 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ E+LEDLI AA +DA ++I +    K   ++ G+P+PPG K PF
Sbjct: 63  EDDKEMLEDLIAAAFNDAARRIAEAQQEKMASVSSGIPLPPGFKMPF 109


>gi|261867514|ref|YP_003255436.1| hypothetical protein D11S_0820 [Aggregatibacter
           actinomycetemcomitans D11S-1]
 gi|293391391|ref|ZP_06635725.1| hypothetical protein D7S_1544 [Aggregatibacter
           actinomycetemcomitans D7S-1]
 gi|261412846|gb|ACX82217.1| hypothetical protein D11S_0820 [Aggregatibacter
           actinomycetemcomitans D11S-1]
 gi|290951925|gb|EFE02044.1| hypothetical protein D7S_1544 [Aggregatibacter
           actinomycetemcomitans D7S-1]
          Length = 147

 Score = 90.1 bits (222), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 47/107 (43%), Positives = 70/107 (65%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           + N+MK   Q +++Q +M+KM+E I  LE  G +G G+V + ING +    V+ID SL+ 
Sbjct: 45  LGNLMK---QAQQMQDRMQKMQEEIAQLEVTGESGAGLVKITINGAHNCRRVEIDPSLM- 100

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ E+LEDLI AA +DA ++ E+L   K   +T G+ +PPG K PF
Sbjct: 101 EDDKEMLEDLIAAAFNDAVRRAEELQKEKMASVTAGMSLPPGFKMPF 147


>gi|262276243|ref|ZP_06054052.1| hypothetical protein VHA_003228 [Grimontia hollisae CIP 101886]
 gi|262220051|gb|EEY71367.1| hypothetical protein VHA_003228 [Grimontia hollisae CIP 101886]
          Length = 110

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 47/107 (43%), Positives = 69/107 (64%), Gaps = 3/107 (2%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+MK   Q + +Q +M+KM+E I ++E  G AG G+V V I G + +  V++D SL+ 
Sbjct: 7   MGNLMK---QAQLMQERMQKMQEEIANMEVTGEAGAGLVKVTITGSHSVRRVELDDSLME 63

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED  E+LEDLI AA +DA ++IE+    K   +T G+ +PPG K PF
Sbjct: 64  EDEKEMLEDLIAAAFNDAARRIEEAQKEKMASVTGGMQMPPGFKMPF 110


>gi|90426318|ref|YP_534688.1| hypothetical protein RPC_4847 [Rhodopseudomonas palustris BisB18]
 gi|122474845|sp|Q20WW7|Y4847_RHOPB RecName: Full=UPF0133 protein RPC_4847
 gi|90108332|gb|ABD90369.1| conserved hypothetical protein 103 [Rhodopseudomonas palustris
           BisB18]
          Length = 105

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 44/103 (42%), Positives = 68/103 (66%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M++ + M+ Q  ++Q KM+ M+E +  +E EG +GGG+VSVR+  K  +  +KID SL+ 
Sbjct: 1   MADFLGMMKQAAQLQSKMKAMQEELEHIEVEGISGGGLVSVRMTAKMEVKTIKIDPSLIN 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGL 103
            D   +LEDL++ A +DAH+K E  +  K Q +T GL +PPGL
Sbjct: 61  ADEAGVLEDLLVTALADAHRKAESAMQEKMQALTGGLSLPPGL 103


>gi|157158940|ref|YP_001461660.1| hypothetical protein EcE24377A_0509 [Escherichia coli E24377A]
 gi|166919060|sp|A7ZIN1|YBAB_ECO24 RecName: Full=UPF0133 protein ybaB
 gi|157080970|gb|ABV20678.1| conserved hypothetical protein TIGR00103 [Escherichia coli E24377A]
          Length = 109

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 48/107 (44%), Positives = 70/107 (65%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           + N+MK   Q +++Q KM+KM+E I  LE  G +G G+V V ING +    V+ID SLL 
Sbjct: 7   LGNLMK---QAQQMQEKMQKMQEEIAQLEVIGESGAGLVKVTINGAHNCRRVEIDPSLL- 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ E+LEDL+ AA +DA ++IE+    K   ++ G+ +PPG K PF
Sbjct: 63  EDDKEMLEDLVAAAFNDAARRIEETQKEKMASVSSGMQLPPGFKMPF 109


>gi|87122721|ref|ZP_01078596.1| hypothetical protein MED121_00140 [Marinomonas sp. MED121]
 gi|86162018|gb|EAQ63308.1| hypothetical protein MED121_00140 [Marinomonas sp. MED121]
          Length = 108

 Score = 89.4 bits (220), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 47/107 (43%), Positives = 72/107 (67%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M NIM+   Q +++Q  ++K+++ I ++E EG +G G+V + + G++ +  V+ID SL F
Sbjct: 6   MGNIMR---QAQKMQENVQKVQDEIANMEVEGQSGAGLVKITMTGRHDVKRVQIDDSL-F 61

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ EILEDLI AA +DA + IE    +K    TEG+P+PPG K PF
Sbjct: 62  EDDKEILEDLIAAAVNDAVRNIETTQKSKMDAATEGMPLPPGFKMPF 108


>gi|251790618|ref|YP_003005339.1| hypothetical protein Dd1591_3038 [Dickeya zeae Ech1591]
 gi|247539239|gb|ACT07860.1| conserved hypothetical protein [Dickeya zeae Ech1591]
          Length = 109

 Score = 89.4 bits (220), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 46/107 (42%), Positives = 71/107 (66%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           + N+MK   Q +++Q KM+K +E + +LE  G +G G+V V ING +    V+ID SL+ 
Sbjct: 7   LGNLMK---QAQQMQEKMQKAQEEMATLEVTGESGAGLVKVTINGAHNCRRVEIDPSLM- 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ E+LEDLI AA +DA ++I ++   K   ++ G+P+PPG K PF
Sbjct: 63  EDDKEMLEDLIAAAFNDAARRIAEVQQEKMASVSSGIPLPPGFKMPF 109


>gi|115526800|ref|YP_783711.1| hypothetical protein RPE_4812 [Rhodopseudomonas palustris BisA53]
 gi|122294449|sp|Q07H53|Y4812_RHOP5 RecName: Full=UPF0133 protein RPE_4812
 gi|115520747|gb|ABJ08731.1| conserved hypothetical protein 103 [Rhodopseudomonas palustris
           BisA53]
          Length = 105

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 44/103 (42%), Positives = 71/103 (68%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M++ + M+ Q  ++Q KM++M+  +  +E EG +GGG+V+VR++ K  +  VKID SLL 
Sbjct: 1   MADFLGMMKQAAQLQSKMKEMQSELDRIEVEGISGGGLVNVRMSAKMEVRAVKIDPSLLN 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGL 103
            D V +LEDL+++A +DAH+K E  +  K + +T GL +PPGL
Sbjct: 61  PDEVGVLEDLLVSALADAHRKAEAAMQDKMKTLTGGLSLPPGL 103


>gi|90020983|ref|YP_526810.1| valyl-tRNA synthetase [Saccharophagus degradans 2-40]
 gi|89950583|gb|ABD80598.1| conserved hypothetical protein 103 [Saccharophagus degradans 2-40]
          Length = 106

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 48/101 (47%), Positives = 68/101 (67%), Gaps = 1/101 (0%)

Query: 7   MVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEI 66
           M+ Q +E+Q KM +M+E + ++E+EG AG G+V V + G++ +  V ID S+L ED  E+
Sbjct: 7   MMKQAQEMQEKMARMQEDMANIESEGQAGAGLVKVVMTGRHDVRKVTIDPSVLEEDK-EM 65

Query: 67  LEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           LEDLI AA +DA +K E+    K  EIT GL +PPG K PF
Sbjct: 66  LEDLIAAAVNDAVRKTEEATKQKMSEITGGLQMPPGFKMPF 106


>gi|212634551|ref|YP_002311076.1| hypothetical protein swp_1717 [Shewanella piezotolerans WP3]
 gi|226736424|sp|B8CMY7|Y1717_SHEPW RecName: Full=UPF0133 protein swp_1717
 gi|212556035|gb|ACJ28489.1| Conserved hypothetical protein [Shewanella piezotolerans WP3]
          Length = 109

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 48/107 (44%), Positives = 70/107 (65%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+MK   Q +++Q KM K++E I  +E  G AG G+V V + G + +  V ID SLL 
Sbjct: 7   MGNLMK---QAQQMQDKMAKVQEEIARMEVTGEAGAGLVKVTMTGSHSVRKVDIDASLL- 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ E+LEDLI AA +DA +++E+    K  E+T G+ +PPG+K PF
Sbjct: 63  EDDKEMLEDLIAAACNDAARRVEENQKDKMAEVTGGMQLPPGMKMPF 109


>gi|167623522|ref|YP_001673816.1| hypothetical protein Shal_1591 [Shewanella halifaxensis HAW-EB4]
 gi|189038958|sp|B0TP00|Y1591_SHEHH RecName: Full=UPF0133 protein Shal_1591
 gi|167353544|gb|ABZ76157.1| conserved hypothetical protein [Shewanella halifaxensis HAW-EB4]
          Length = 109

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 48/107 (44%), Positives = 70/107 (65%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+MK   Q +++Q KM K++E I  +E  G AG G+V V + G + +  V ID SLL 
Sbjct: 7   MGNLMK---QAQQMQDKMAKVQEEIARMEVTGEAGAGLVKVTMTGSHSVRKVDIDASLL- 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ E+LEDLI AA +DA +++E+    K  E+T G+ +PPG+K PF
Sbjct: 63  EDDKEMLEDLIAAACNDAARRVEENQKEKMAEVTGGMQLPPGMKMPF 109


>gi|153833872|ref|ZP_01986539.1| conserved hypothetical protein [Vibrio harveyi HY01]
 gi|156975355|ref|YP_001446262.1| hypothetical protein VIBHAR_03086 [Vibrio harveyi ATCC BAA-1116]
 gi|269962150|ref|ZP_06176504.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
 gi|312882073|ref|ZP_07741823.1| hypothetical protein VIBC2010_13734 [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|166229371|sp|A7MUE5|Y3086_VIBHB RecName: Full=UPF0133 protein VIBHAR_03086
 gi|148869814|gb|EDL68788.1| conserved hypothetical protein [Vibrio harveyi HY01]
 gi|156526949|gb|ABU72035.1| hypothetical protein VIBHAR_03086 [Vibrio harveyi ATCC BAA-1116]
 gi|269833234|gb|EEZ87339.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
 gi|309370209|gb|EFP97711.1| hypothetical protein VIBC2010_13734 [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 109

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 72/107 (67%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+MK   Q +++Q +M+K++E I ++E  G +G G+V V I G + +  V+ID SL+ 
Sbjct: 7   MGNLMK---QAQQMQDRMQKLQEEIANMEVTGESGAGLVKVTITGSHSVRRVEIDESLM- 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ E+LEDLI AA +DA +++E+    K   +T G+ +PPG+K PF
Sbjct: 63  EDDKEMLEDLIAAAFNDAARRVEETQKEKMASVTGGMQLPPGMKMPF 109


>gi|121726245|ref|ZP_01679535.1| conserved hypothetical protein [Vibrio cholerae V52]
 gi|121631191|gb|EAX63564.1| conserved hypothetical protein [Vibrio cholerae V52]
          Length = 103

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 46/107 (42%), Positives = 71/107 (66%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+MK   Q +++Q +M+K++E I ++E  G +G G+V V + G + +  V ID SL+ 
Sbjct: 1   MGNLMK---QAQQMQERMQKLQEEIANMEVTGESGAGLVKVTVTGSHSVRRVNIDESLM- 56

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ E+LEDLI AA +DA ++IE+    K   IT G+ +PPG+K PF
Sbjct: 57  EDDKEMLEDLIAAAFNDAARRIEETQKEKMASITGGMQLPPGMKMPF 103


>gi|260914408|ref|ZP_05920877.1| conserved hypothetical protein [Pasteurella dagmatis ATCC 43325]
 gi|260631509|gb|EEX49691.1| conserved hypothetical protein [Pasteurella dagmatis ATCC 43325]
          Length = 113

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 46/107 (42%), Positives = 70/107 (65%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           + N+MK   Q +++Q +M+KM+E I  LE  G +G G+V + ING +    ++ID SL+ 
Sbjct: 11  LGNLMK---QAQQMQDRMQKMQEEIAQLEVTGESGAGLVKITINGAHNCRRIEIDPSLM- 66

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ E+LEDLI AA +DA ++ E+L   K   +T G+ +PPG K PF
Sbjct: 67  EDDKEMLEDLIAAAFNDAVRRAEELQKEKMASVTAGMQLPPGFKMPF 113


>gi|209694645|ref|YP_002262573.1| hypothetical protein VSAL_I1086 [Aliivibrio salmonicida LFI1238]
 gi|238058406|sp|B6EJ43|Y1086_ALISL RecName: Full=UPF0133 protein VSAL_I1086
 gi|208008596|emb|CAQ78771.1| conserved hypothetical protein [Aliivibrio salmonicida LFI1238]
          Length = 111

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 46/107 (42%), Positives = 70/107 (65%), Gaps = 3/107 (2%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+MK   Q +++Q +M+KM+E I ++E  G +G G+V V I G + +  V+ID SL+ 
Sbjct: 8   MGNLMK---QAQQMQDRMQKMQEEIGNMEITGESGAGLVKVTITGSHSVRRVEIDPSLME 64

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED  E+LEDLI AA +DA ++IE+    +   +T G+ +PPG K PF
Sbjct: 65  EDEKEMLEDLIAAAFNDASRRIEETQKERMAGVTGGMQMPPGFKMPF 111


>gi|237808961|ref|YP_002893401.1| hypothetical protein Tola_2216 [Tolumonas auensis DSM 9187]
 gi|259646603|sp|C4L8U5|Y2216_TOLAT RecName: Full=UPF0133 protein Tola_2216
 gi|237501222|gb|ACQ93815.1| conserved hypothetical protein [Tolumonas auensis DSM 9187]
          Length = 110

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 47/107 (43%), Positives = 68/107 (63%), Gaps = 3/107 (2%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+MK   Q + +Q +M+KM+E +  +E  G +G GMV + I G + +  V ID SLL 
Sbjct: 7   MGNLMK---QAQMMQERMQKMQEEVAKMEVTGESGAGMVKITITGSHNVRRVTIDPSLLQ 63

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           +D+ E+LEDLI AA +DA ++ E+    K  EIT G+ +PPG K PF
Sbjct: 64  DDDQEMLEDLIAAAFNDAVRRAEEQNKAKMAEITGGMQLPPGFKMPF 110


>gi|46143303|ref|ZP_00135501.2| COG0718: Uncharacterized protein conserved in bacteria
           [Actinobacillus pleuropneumoniae serovar 1 str. 4074]
 gi|126207563|ref|YP_001052788.1| uncharacterized protein YbaB [Actinobacillus pleuropneumoniae L20]
 gi|165975532|ref|YP_001651125.1| hypothetical protein APJL_0075 [Actinobacillus pleuropneumoniae
           serovar 3 str. JL03]
 gi|190149344|ref|YP_001967869.1| uncharacterized protein YbaB [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
 gi|254360630|ref|ZP_04976779.1| hypothetical protein MHA_0186 [Mannheimia haemolytica PHL213]
 gi|261493355|ref|ZP_05989881.1| hypothetical protein COK_1763 [Mannheimia haemolytica serotype A2
           str. BOVINE]
 gi|261496621|ref|ZP_05993001.1| hypothetical protein COI_2343 [Mannheimia haemolytica serotype A2
           str. OVINE]
 gi|303250209|ref|ZP_07336410.1| uncharacterized protein YbaB [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|303251898|ref|ZP_07338069.1| uncharacterized protein YbaB [Actinobacillus pleuropneumoniae
           serovar 2 str. 4226]
 gi|307247053|ref|ZP_07529106.1| hypothetical protein appser2_510 [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
 gi|307249275|ref|ZP_07531270.1| hypothetical protein appser4_900 [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
 gi|307251597|ref|ZP_07533503.1| hypothetical protein appser6_1200 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|307253831|ref|ZP_07535684.1| hypothetical protein appser9_900 [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|307256096|ref|ZP_07537883.1| hypothetical protein appser10_1010 [Actinobacillus pleuropneumoniae
           serovar 10 str. D13039]
 gi|307258287|ref|ZP_07540029.1| hypothetical protein appser11_910 [Actinobacillus pleuropneumoniae
           serovar 11 str. 56153]
 gi|307260529|ref|ZP_07542222.1| hypothetical protein appser12_1030 [Actinobacillus pleuropneumoniae
           serovar 12 str. 1096]
 gi|322515729|ref|ZP_08068694.1| hypothetical protein HMPREF0027_2446 [Actinobacillus ureae ATCC
           25976]
 gi|166227796|sp|A3MYE7|Y075_ACTP2 RecName: Full=UPF0133 protein APL_0075
 gi|238687507|sp|B0BRN3|Y075_ACTPJ RecName: Full=UPF0133 protein APJL_0075
 gi|238692368|sp|B3GZR5|Y075_ACTP7 RecName: Full=UPF0133 protein APP7_0075
 gi|40849963|gb|AAR95696.1| YbaB [Actinobacillus pleuropneumoniae]
 gi|126096355|gb|ABN73183.1| uncharacterized protein YbaB [Actinobacillus pleuropneumoniae
           serovar 5b str. L20]
 gi|153091170|gb|EDN73175.1| hypothetical protein MHA_0186 [Mannheimia haemolytica PHL213]
 gi|165875633|gb|ABY68681.1| hypothetical protein APJL_0075 [Actinobacillus pleuropneumoniae
           serovar 3 str. JL03]
 gi|189914475|gb|ACE60727.1| uncharacterized protein YbaB [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
 gi|261307824|gb|EEY09147.1| hypothetical protein COI_2343 [Mannheimia haemolytica serotype A2
           str. OVINE]
 gi|261310999|gb|EEY12176.1| hypothetical protein COK_1763 [Mannheimia haemolytica serotype A2
           str. BOVINE]
 gi|302649328|gb|EFL79513.1| uncharacterized protein YbaB [Actinobacillus pleuropneumoniae
           serovar 2 str. 4226]
 gi|302650920|gb|EFL81075.1| uncharacterized protein YbaB [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|306856422|gb|EFM88572.1| hypothetical protein appser2_510 [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
 gi|306858674|gb|EFM90735.1| hypothetical protein appser4_900 [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
 gi|306860908|gb|EFM92915.1| hypothetical protein appser6_1200 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|306863191|gb|EFM95132.1| hypothetical protein appser9_900 [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|306865277|gb|EFM97173.1| hypothetical protein appser10_1010 [Actinobacillus pleuropneumoniae
           serovar 10 str. D13039]
 gi|306867626|gb|EFM99472.1| hypothetical protein appser11_910 [Actinobacillus pleuropneumoniae
           serovar 11 str. 56153]
 gi|306869758|gb|EFN01542.1| hypothetical protein appser12_1030 [Actinobacillus pleuropneumoniae
           serovar 12 str. 1096]
 gi|322118191|gb|EFX90500.1| hypothetical protein HMPREF0027_2446 [Actinobacillus ureae ATCC
           25976]
          Length = 109

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 42/98 (42%), Positives = 67/98 (68%), Gaps = 1/98 (1%)

Query: 10  QFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILED 69
           Q +++Q +M+KM+E I  LE  G +G G+V V ING +    ++ID SL+ ED+ E++ED
Sbjct: 13  QAQQMQERMQKMQEEIAQLEVTGESGAGLVKVTINGAHNCRRIEIDPSLM-EDDKEMVED 71

Query: 70  LIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           L+ AA +DA ++ E++   K   +T G+ +PPG+KFPF
Sbjct: 72  LVAAAFNDAVRRAEEMQKEKMASVTAGMQLPPGMKFPF 109


>gi|113461452|ref|YP_719521.1| hypothetical protein HS_1309 [Haemophilus somnus 129PT]
 gi|170718441|ref|YP_001783659.1| hypothetical protein HSM_0308 [Haemophilus somnus 2336]
 gi|123031423|sp|Q0I4S4|Y1309_HAES1 RecName: Full=UPF0133 protein HS_1309
 gi|238688021|sp|B0UWK6|Y308_HAES2 RecName: Full=UPF0133 protein HSM_0308
 gi|112823495|gb|ABI25584.1| conserved hypothetical protein [Haemophilus somnus 129PT]
 gi|168826570|gb|ACA31941.1| conserved hypothetical protein 103 [Haemophilus somnus 2336]
          Length = 109

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 46/107 (42%), Positives = 69/107 (64%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           + N+MK   Q +++Q +M+KM+E I  LE  G AG G++ V ING +    + ID SL+ 
Sbjct: 7   LGNLMK---QAQQMQERMQKMQEEIAQLEVTGEAGAGLIKVTINGAHNCRRIDIDPSLM- 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ E+LEDLI AA +DA ++ E++   K   +T G+ +PPG K PF
Sbjct: 63  EDDKEMLEDLIAAAFNDAVRRAEEMQKEKMASVTAGMSLPPGFKMPF 109


>gi|320538819|ref|ZP_08038495.1| conserved protein [Serratia symbiotica str. Tucson]
 gi|320030979|gb|EFW12982.1| conserved protein [Serratia symbiotica str. Tucson]
          Length = 109

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 47/107 (43%), Positives = 70/107 (65%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           + N+MK   Q +++Q KM+KM+E +  LE  G +G G+V V ING +    V+ID SL+ 
Sbjct: 7   LGNLMK---QAQQMQEKMQKMQEEVAKLETTGESGAGLVKVTINGAHNCRRVEIDPSLM- 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ E+LEDLI AA +DA ++IE+    K   ++ G+ +PPG K PF
Sbjct: 63  EDDKEMLEDLIAAAFNDAVRRIEETQKEKMASVSNGMQLPPGFKMPF 109


>gi|15602070|ref|NP_245142.1| hypothetical protein PM0205 [Pasteurella multocida subsp. multocida
           str. Pm70]
 gi|13431988|sp|P57825|Y205_PASMU RecName: Full=UPF0133 protein PM0205
 gi|12720429|gb|AAK02289.1| unknown [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 109

 Score = 88.6 bits (218), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 46/107 (42%), Positives = 70/107 (65%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           + N+MK   Q +++Q +M+KM+E I  LE  G +G G+V + ING +    V+ID SL+ 
Sbjct: 7   LGNLMK---QAQQMQDRMQKMQEEIAQLEVTGESGAGLVKITINGAHNCRRVEIDPSLM- 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ ++LEDLI AA +DA ++ E+L   K   +T G+ +PPG K PF
Sbjct: 63  EDDKDMLEDLIAAAFNDAVRRAEELQKEKMASVTAGMALPPGFKMPF 109


>gi|119774448|ref|YP_927188.1| hypothetical protein Sama_1311 [Shewanella amazonensis SB2B]
 gi|166200338|sp|A1S562|Y1311_SHEAM RecName: Full=UPF0133 protein Sama_1311
 gi|119766948|gb|ABL99518.1| conserved hypothetical protein [Shewanella amazonensis SB2B]
          Length = 109

 Score = 88.6 bits (218), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 48/107 (44%), Positives = 71/107 (66%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+MK   Q + +Q KM KM+E I  +E  G +G G+V V + G + +  V+ID SLL 
Sbjct: 7   MGNLMK---QAQMMQEKMAKMQEEIARMEVTGESGAGLVKVTMTGTHNVRKVEIDPSLL- 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ E+LEDL+ AA +DA +++E+   TK  E+T G+ +PPG+K PF
Sbjct: 63  EDDKELLEDLVAAACNDAARRVEENQKTKMAEVTGGMQLPPGMKMPF 109


>gi|296447823|ref|ZP_06889736.1| conserved hypothetical protein [Methylosinus trichosporium OB3b]
 gi|296254682|gb|EFH01796.1| conserved hypothetical protein [Methylosinus trichosporium OB3b]
          Length = 107

 Score = 88.6 bits (218), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 67/107 (62%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M + M ++ Q + +Q KM +M+  +  +  EG AGGG+V V +  K  L  V ID SLL 
Sbjct: 1   MLDFMGLMKQAQAMQAKMAEMQAELDQVVVEGEAGGGLVKVTMTAKGALQRVAIDPSLLK 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            ++ +I+EDL++ AH+ A  K ++ VA K + +T GL +PPG+K PF
Sbjct: 61  PEDSDIIEDLVVTAHAQARAKADEAVAEKMKAVTGGLQLPPGMKLPF 107


>gi|144898667|emb|CAM75531.1| conserved hypothetical protein [Magnetospirillum gryphiswaldense
           MSR-1]
          Length = 107

 Score = 88.6 bits (218), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 71/107 (66%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+  ++ Q +++Q KM +M+  +  +E  G AGGGM+ V +NGK  L  +KID+SL+ 
Sbjct: 1   MKNLGNLMKQAQQMQAKMGEMQAKMAEMEVSGAAGGGMLQVTLNGKFELKKIKIDKSLVD 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            ++VE+LEDLI+AA +DA  K E  +  +  ++T GL +P G+K PF
Sbjct: 61  PEDVEVLEDLIVAAFNDAKVKAEVAMQDEMAKLTGGLNLPAGMKLPF 107


>gi|15641068|ref|NP_230700.1| hypothetical protein VC1055 [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|147675358|ref|YP_001216523.1| hypothetical protein VC0395_A0573 [Vibrio cholerae O395]
 gi|153803674|ref|ZP_01958260.1| conserved hypothetical protein [Vibrio cholerae MZO-3]
 gi|153824934|ref|ZP_01977601.1| conserved hypothetical protein [Vibrio cholerae MZO-2]
 gi|153828121|ref|ZP_01980788.1| conserved hypothetical protein [Vibrio cholerae 623-39]
 gi|227081228|ref|YP_002809779.1| hypothetical protein VCM66_1010 [Vibrio cholerae M66-2]
 gi|229505350|ref|ZP_04394860.1| transcriptional regulatory protein [Vibrio cholerae BX 330286]
 gi|229510980|ref|ZP_04400459.1| transcriptional regulatory protein [Vibrio cholerae B33]
 gi|229515437|ref|ZP_04404896.1| transcriptional regulatory protein [Vibrio cholerae TMA 21]
 gi|229518101|ref|ZP_04407545.1| transcriptional regulatory protein [Vibrio cholerae RC9]
 gi|229523158|ref|ZP_04412565.1| transcriptional regulatory protein [Vibrio cholerae TM 11079-80]
 gi|229525664|ref|ZP_04415069.1| transcriptional regulatory protein [Vibrio cholerae bv. albensis
           VL426]
 gi|229608369|ref|YP_002879017.1| hypothetical protein VCD_003287 [Vibrio cholerae MJ-1236]
 gi|254848184|ref|ZP_05237534.1| recombinational DNA repair protein [Vibrio cholerae MO10]
 gi|297578659|ref|ZP_06940587.1| recombinational DNA repair protein [Vibrio cholerae RC385]
 gi|298498837|ref|ZP_07008644.1| conserved hypothetical protein [Vibrio cholerae MAK 757]
 gi|9655521|gb|AAF94214.1| conserved hypothetical protein [Vibrio cholerae O1 biovar El Tor
           str. N16961]
 gi|124120793|gb|EAY39536.1| conserved hypothetical protein [Vibrio cholerae MZO-3]
 gi|146317241|gb|ABQ21780.1| conserved hypothetical protein [Vibrio cholerae O395]
 gi|148876363|gb|EDL74498.1| conserved hypothetical protein [Vibrio cholerae 623-39]
 gi|149741446|gb|EDM55476.1| conserved hypothetical protein [Vibrio cholerae MZO-2]
 gi|227009116|gb|ACP05328.1| conserved hypothetical protein [Vibrio cholerae M66-2]
 gi|227012871|gb|ACP09081.1| conserved hypothetical protein [Vibrio cholerae O395]
 gi|229339245|gb|EEO04262.1| transcriptional regulatory protein [Vibrio cholerae bv. albensis
           VL426]
 gi|229339521|gb|EEO04536.1| transcriptional regulatory protein [Vibrio cholerae TM 11079-80]
 gi|229344816|gb|EEO09790.1| transcriptional regulatory protein [Vibrio cholerae RC9]
 gi|229347206|gb|EEO12166.1| transcriptional regulatory protein [Vibrio cholerae TMA 21]
 gi|229350945|gb|EEO15886.1| transcriptional regulatory protein [Vibrio cholerae B33]
 gi|229357573|gb|EEO22490.1| transcriptional regulatory protein [Vibrio cholerae BX 330286]
 gi|229371024|gb|ACQ61447.1| transcriptional regulatory protein [Vibrio cholerae MJ-1236]
 gi|254843889|gb|EET22303.1| recombinational DNA repair protein [Vibrio cholerae MO10]
 gi|297536253|gb|EFH75086.1| recombinational DNA repair protein [Vibrio cholerae RC385]
 gi|297543170|gb|EFH79220.1| conserved hypothetical protein [Vibrio cholerae MAK 757]
          Length = 120

 Score = 88.6 bits (218), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 46/107 (42%), Positives = 71/107 (66%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+MK   Q +++Q +M+K++E I ++E  G +G G+V V + G + +  V ID SL+ 
Sbjct: 18  MGNLMK---QAQQMQERMQKLQEEIANMEVTGESGAGLVKVTVTGSHSVRRVNIDESLM- 73

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ E+LEDLI AA +DA ++IE+    K   IT G+ +PPG+K PF
Sbjct: 74  EDDKEMLEDLIAAAFNDAARRIEETQKEKMASITGGMQLPPGMKMPF 120


>gi|255745472|ref|ZP_05419420.1| conserved protein of unknown function likely to be involved in DNA
           repair [Vibrio cholera CIRS 101]
 gi|258621805|ref|ZP_05716836.1| conserved hypothetical protein [Vibrio mimicus VM573]
 gi|258626250|ref|ZP_05721097.1| conserved hypothetical protein [Vibrio mimicus VM603]
 gi|262165293|ref|ZP_06033030.1| hypothetical protein VMA_001739 [Vibrio mimicus VM223]
 gi|262167195|ref|ZP_06034907.1| hypothetical protein VIJ_000354 [Vibrio cholerae RC27]
 gi|262402602|ref|ZP_06079163.1| hypothetical protein VOA_000581 [Vibrio sp. RC586]
 gi|12644643|sp|Q9KT50|Y1055_VIBCH RecName: Full=UPF0133 protein VC_1055
 gi|255736547|gb|EET91944.1| conserved protein of unknown function likely to be involved in DNA
           repair [Vibrio cholera CIRS 101]
 gi|258581302|gb|EEW06204.1| conserved hypothetical protein [Vibrio mimicus VM603]
 gi|258586036|gb|EEW10754.1| conserved hypothetical protein [Vibrio mimicus VM573]
 gi|262024339|gb|EEY43028.1| hypothetical protein VIJ_000354 [Vibrio cholerae RC27]
 gi|262025009|gb|EEY43677.1| hypothetical protein VMA_001739 [Vibrio mimicus VM223]
 gi|262351384|gb|EEZ00517.1| hypothetical protein VOA_000581 [Vibrio sp. RC586]
          Length = 109

 Score = 88.6 bits (218), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 46/107 (42%), Positives = 71/107 (66%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+MK   Q +++Q +M+K++E I ++E  G +G G+V V + G + +  V ID SL+ 
Sbjct: 7   MGNLMK---QAQQMQERMQKLQEEIANMEVTGESGAGLVKVTVTGSHSVRRVNIDESLM- 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ E+LEDLI AA +DA ++IE+    K   IT G+ +PPG+K PF
Sbjct: 63  EDDKEMLEDLIAAAFNDAARRIEETQKEKMASITGGMQLPPGMKMPF 109


>gi|163801915|ref|ZP_02195812.1| hypothetical protein 1103602000600_AND4_15745 [Vibrio sp. AND4]
 gi|159174423|gb|EDP59227.1| hypothetical protein AND4_15745 [Vibrio sp. AND4]
          Length = 109

 Score = 88.6 bits (218), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 72/107 (67%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+MK   Q +++Q +M+K++E I ++E  G +G G+V V I G + +  V ID SL+ 
Sbjct: 7   MGNLMK---QAQQMQDRMQKLQEEIANMEITGESGAGLVKVTITGSHSVRRVDIDESLM- 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ E+LEDLI AA +DA +++E+    K  ++T G+ +PPG+K PF
Sbjct: 63  EDDKEMLEDLIAAAFNDAARRVEETQKEKMADVTGGMQLPPGMKMPF 109


>gi|83594801|ref|YP_428553.1| hypothetical protein Rru_A3472 [Rhodospirillum rubrum ATCC 11170]
 gi|123525547|sp|Q2RNM9|Y3472_RHORT RecName: Full=UPF0133 protein Rru_A3472
 gi|83577715|gb|ABC24266.1| conserved hypothetical protein [Rhodospirillum rubrum ATCC 11170]
          Length = 107

 Score = 88.6 bits (218), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 70/107 (65%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M NI +M+ Q +++Q +M +++E + +++  G +  GM  V ++GK  +  +KID SL+ 
Sbjct: 1   MKNIGQMLKQAQQLQTRMAEVQEELKAMDVSGQSAAGMCVVTLDGKGGVRSIKIDPSLVD 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
               E++EDLI+AA +DA  K++++V  K  E+T GL +PPG+  PF
Sbjct: 61  PKETEVMEDLIVAAFNDAKAKVDEMVKEKMSELTGGLKLPPGMSLPF 107


>gi|308048899|ref|YP_003912465.1| hypothetical protein Fbal_1182 [Ferrimonas balearica DSM 9799]
 gi|307631089|gb|ADN75391.1| conserved hypothetical protein [Ferrimonas balearica DSM 9799]
          Length = 109

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 46/107 (42%), Positives = 73/107 (68%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+MK   Q +++Q +M++++E I  +E  G AG GMV + +NG + +  V+ID SL+ 
Sbjct: 7   MGNLMK---QAQKMQERMQQVQEEIAVMEVTGEAGAGMVKITMNGAHNVRRVEIDESLM- 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ E+LEDLI AA +DA +++E+    K  E+T G+ +PPG+K PF
Sbjct: 63  EDDKEMLEDLIAAAINDAARRVEEGQKAKMAEVTGGMQLPPGMKLPF 109


>gi|91223617|ref|ZP_01258882.1| hypothetical protein V12G01_23163 [Vibrio alginolyticus 12G01]
 gi|262393659|ref|YP_003285513.1| hypothetical protein VEA_002886 [Vibrio sp. Ex25]
 gi|269966015|ref|ZP_06180107.1| conserved hypothetical protein [Vibrio alginolyticus 40B]
 gi|91191703|gb|EAS77967.1| hypothetical protein V12G01_23163 [Vibrio alginolyticus 12G01]
 gi|262337253|gb|ACY51048.1| hypothetical protein VEA_002886 [Vibrio sp. Ex25]
 gi|269829411|gb|EEZ83653.1| conserved hypothetical protein [Vibrio alginolyticus 40B]
          Length = 109

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 71/107 (66%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+MK   Q +++Q +M+K++E I ++E  G +G G+V V I G + +  V ID SL+ 
Sbjct: 7   MGNLMK---QAQQMQDRMQKLQEEIANMEVTGESGAGLVKVTITGSHSVRRVDIDESLM- 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ E+LEDLI AA +DA +++E+    K   +T G+ +PPG+K PF
Sbjct: 63  EDDKEMLEDLIAAAFNDAARRVEETQKEKMASVTGGMQLPPGMKMPF 109


>gi|153217696|ref|ZP_01951377.1| conserved hypothetical protein [Vibrio cholerae 1587]
 gi|124113359|gb|EAY32179.1| conserved hypothetical protein [Vibrio cholerae 1587]
          Length = 120

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 46/107 (42%), Positives = 70/107 (65%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+MK   Q +++Q +M+K++E I ++E  G +G G+V V + G   +  V ID SL+ 
Sbjct: 18  MGNLMK---QAQQMQERMQKLQEEIANMEVTGESGAGLVKVTVTGSQSVRRVNIDESLM- 73

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ E+LEDLI AA +DA ++IE+    K   IT G+ +PPG+K PF
Sbjct: 74  EDDKEMLEDLIAAAFNDAARRIEETQKEKMASITGGMQLPPGMKMPF 120


>gi|261341081|ref|ZP_05968939.1| putative cytoplasmic protein [Enterobacter cancerogenus ATCC 35316]
 gi|296101606|ref|YP_003611752.1| hypothetical protein ECL_01242 [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
 gi|288316755|gb|EFC55693.1| putative cytoplasmic protein [Enterobacter cancerogenus ATCC 35316]
 gi|295056065|gb|ADF60803.1| hypothetical protein ECL_01242 [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
 gi|295096738|emb|CBK85828.1| conserved hypothetical protein TIGR00103 [Enterobacter cloacae
           subsp. cloacae NCTC 9394]
          Length = 110

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 44/98 (44%), Positives = 65/98 (66%), Gaps = 1/98 (1%)

Query: 10  QFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILED 69
           Q +++Q KM+KM+E I  LE  G +G G+V V ING +    V+ID SLL ED+ E+LED
Sbjct: 14  QAQQMQEKMQKMQEEIAQLEVTGESGAGLVKVTINGAHNCRRVEIDPSLL-EDDKEMLED 72

Query: 70  LIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           L+ AA +DA ++I++    K   ++ G+ +PPG K PF
Sbjct: 73  LVAAAFNDAARRIDETQKEKMASVSSGMQLPPGFKMPF 110


>gi|118590527|ref|ZP_01547929.1| hypothetical protein SIAM614_03091 [Stappia aggregata IAM 12614]
 gi|118436990|gb|EAV43629.1| hypothetical protein SIAM614_03091 [Stappia aggregata IAM 12614]
          Length = 106

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 77/105 (73%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           + +KM+ Q K++Q +M  ++E I  +EAEG+AGGG+V+VR+NGK+ L  + ID SLL E+
Sbjct: 2   DFLKMMKQAKQMQEQMGSLQEQIVEIEAEGSAGGGLVTVRLNGKSDLKSLSIDPSLLKEE 61

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
             EILEDL+IAAH++A  K+E  +  KTQE+  GL +P G+K PF
Sbjct: 62  EKEILEDLLIAAHTEARAKVEQAIQEKTQELMGGLGLPAGMKLPF 106


>gi|170726147|ref|YP_001760173.1| hypothetical protein Swoo_1794 [Shewanella woodyi ATCC 51908]
 gi|238688703|sp|B1KNK1|Y1794_SHEWM RecName: Full=UPF0133 protein Swoo_1794
 gi|169811494|gb|ACA86078.1| conserved hypothetical protein [Shewanella woodyi ATCC 51908]
          Length = 109

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 48/107 (44%), Positives = 70/107 (65%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+MK   Q +++Q KM K++E I  +E  G AG G+V V + G + +  V ID SLL 
Sbjct: 7   MGNLMK---QAQQMQDKMAKVQEEIARMEVTGEAGAGLVKVTMTGSHSVRKVDIDPSLL- 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ E+LEDLI AA +DA +++E+    K  E+T G+ +PPG+K PF
Sbjct: 63  EDDKEMLEDLIAAACNDAARRVEENQKDKMAEVTGGMQLPPGMKMPF 109


>gi|145299060|ref|YP_001141901.1| hypothetical protein ASA_2087 [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|166227517|sp|A4SMN1|Y2087_AERS4 RecName: Full=UPF0133 protein ASA_2087
 gi|142851832|gb|ABO90153.1| Conserved hypothetical protein [Aeromonas salmonicida subsp.
           salmonicida A449]
          Length = 109

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 74/107 (69%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+MK   Q +++Q +M+KM+E +  +E  G AG GMV V + G + +  ++ID+SL+ 
Sbjct: 7   MGNLMK---QAQQMQERMQKMQEQLAEMEVVGEAGAGMVKVTMAGSHSVRRIEIDQSLM- 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ E++EDL+ AA +DA +++E+   +K  E+T G+ +PPG+K PF
Sbjct: 63  EDDKEMIEDLVAAAVNDAVRRVEEQSKSKMGELTGGMQLPPGMKLPF 109


>gi|91793732|ref|YP_563383.1| hypothetical protein Sden_2380 [Shewanella denitrificans OS217]
 gi|123356672|sp|Q12LL6|Y2380_SHEDO RecName: Full=UPF0133 protein Sden_2380
 gi|91715734|gb|ABE55660.1| conserved hypothetical protein 103 [Shewanella denitrificans OS217]
          Length = 110

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 49/107 (45%), Positives = 70/107 (65%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+MK   Q + +Q KM KM+E I  +E  G AG G+V V + G + +  V+ID SL+ 
Sbjct: 8   MGNLMK---QAQMMQDKMAKMQEEIARMEITGEAGAGLVKVTMTGSHSVRKVEIDPSLM- 63

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ E+LEDLI AA +DA ++IE+    K  E+T G+ +PPG+K PF
Sbjct: 64  EDDKEMLEDLIAAACNDASRRIEENQKNKMAEVTGGMQLPPGMKMPF 110


>gi|327483766|gb|AEA78173.1| hypothetical protein VCLMA_A0911 [Vibrio cholerae LMA3894-4]
          Length = 109

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 71/107 (66%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+MK   Q +++Q +M+K++E I ++E  G +G G+V V + G + +  V ID SL+ 
Sbjct: 7   MGNLMK---QAQQMQERMQKLQEEIANMEVTGESGAGLVKVTVTGSHSVRRVNIDESLM- 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ E+LEDLI AA +DA ++IE+    K   +T G+ +PPG+K PF
Sbjct: 63  EDDKEMLEDLIAAAFNDAARRIEETQKEKMASVTGGMQLPPGMKMPF 109


>gi|148977688|ref|ZP_01814249.1| hypothetical protein VSWAT3_15314 [Vibrionales bacterium SWAT-3]
 gi|145963056|gb|EDK28325.1| hypothetical protein VSWAT3_15314 [Vibrionales bacterium SWAT-3]
          Length = 109

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 46/107 (42%), Positives = 71/107 (66%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+MK   Q +++Q +M+K++E I ++E  G +G G+V V I G + +  V ID SL+ 
Sbjct: 7   MGNMMK---QAQQMQERMQKLQEEIANMEVTGESGAGLVKVTITGSHSVRRVDIDESLM- 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ E+LEDLI AA +DA +++E+    K   IT G+ +PPG+K PF
Sbjct: 63  EDDKEMLEDLIAAAFNDAARRVEETQKEKMASITGGMQLPPGMKMPF 109


>gi|27383226|ref|NP_774755.1| hypothetical protein bll8115 [Bradyrhizobium japonicum USDA 110]
 gi|47117553|sp|Q89BN3|YUD3_BRAJA RecName: Full=UPF0133 protein bll8115
 gi|27356400|dbj|BAC53380.1| bll8115 [Bradyrhizobium japonicum USDA 110]
          Length = 106

 Score = 88.2 bits (217), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 44/103 (42%), Positives = 70/103 (67%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M++ + M+ Q  ++Q KM++M++++ ++E EG +GGG+V VR+  K  + GVKID SL+ 
Sbjct: 1   MADFLGMMKQAAQLQSKMQEMQDALGNVEVEGISGGGLVVVRMTAKMDVKGVKIDPSLMK 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGL 103
            +  E+LEDL++ A  DA +K E  V  K Q +T GL +PPGL
Sbjct: 61  AEEREVLEDLLVTALGDARRKAEAAVQEKMQSLTGGLGLPPGL 103


>gi|229529854|ref|ZP_04419244.1| transcriptional regulatory protein [Vibrio cholerae 12129(1)]
 gi|229333628|gb|EEN99114.1| transcriptional regulatory protein [Vibrio cholerae 12129(1)]
          Length = 120

 Score = 88.2 bits (217), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 71/107 (66%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+MK   Q +++Q +M+K++E I ++E  G +G G+V V + G + +  V ID SL+ 
Sbjct: 18  MGNLMK---QAQQMQERMQKLQEEIANMEVTGESGAGLVKVTVTGSHSVRRVNIDESLM- 73

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ E+LEDLI AA +DA ++IE+    K   +T G+ +PPG+K PF
Sbjct: 74  EDDKEMLEDLIAAAFNDAARRIEETQKEKMASVTGGMQLPPGMKMPF 120


>gi|28898952|ref|NP_798557.1| hypothetical protein VP2178 [Vibrio parahaemolyticus RIMD 2210633]
 gi|153838676|ref|ZP_01991343.1| conserved hypothetical protein [Vibrio parahaemolyticus AQ3810]
 gi|260364434|ref|ZP_05777063.1| conserved hypothetical protein [Vibrio parahaemolyticus K5030]
 gi|260878850|ref|ZP_05891205.1| conserved hypothetical protein [Vibrio parahaemolyticus AN-5034]
 gi|260896228|ref|ZP_05904724.1| conserved hypothetical protein [Vibrio parahaemolyticus Peru-466]
 gi|260900003|ref|ZP_05908398.1| conserved hypothetical protein [Vibrio parahaemolyticus AQ4037]
 gi|33301897|sp|Q87MQ3|Y2178_VIBPA RecName: Full=UPF0133 protein VP2178
 gi|28807171|dbj|BAC60441.1| conserved hypothetical protein [Vibrio parahaemolyticus RIMD
           2210633]
 gi|149747896|gb|EDM58768.1| conserved hypothetical protein [Vibrio parahaemolyticus AQ3810]
 gi|308088807|gb|EFO38502.1| conserved hypothetical protein [Vibrio parahaemolyticus Peru-466]
 gi|308094247|gb|EFO43942.1| conserved hypothetical protein [Vibrio parahaemolyticus AN-5034]
 gi|308107314|gb|EFO44854.1| conserved hypothetical protein [Vibrio parahaemolyticus AQ4037]
 gi|308114587|gb|EFO52127.1| conserved hypothetical protein [Vibrio parahaemolyticus K5030]
 gi|328474508|gb|EGF45313.1| hypothetical protein VP10329_17425 [Vibrio parahaemolyticus 10329]
          Length = 109

 Score = 88.2 bits (217), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 71/107 (66%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+MK   Q +++Q +M+K++E I ++E  G +G G+V V I G + +  V ID SL+ 
Sbjct: 7   MGNLMK---QAQQMQERMQKLQEEIANMEVTGESGAGLVKVTITGSHSVRRVDIDESLM- 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ E+LEDLI AA +DA +++E+    K   +T G+ +PPG+K PF
Sbjct: 63  EDDKEMLEDLIAAAFNDAARRVEETQKEKMASVTGGMQLPPGMKMPF 109


>gi|261252407|ref|ZP_05944980.1| hypothetical protein VIA_002429 [Vibrio orientalis CIP 102891]
 gi|260935798|gb|EEX91787.1| hypothetical protein VIA_002429 [Vibrio orientalis CIP 102891]
          Length = 109

 Score = 88.2 bits (217), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 72/107 (67%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+MK   Q +++Q +M+K++E I ++E  G +G G+V V I G + +  V+ID SL+ 
Sbjct: 7   MGNLMK---QAQQMQDRMQKLQEEIANMEVTGESGAGLVKVTITGSHSVRRVEIDESLM- 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ E+LEDLI AA +DA +++E+    K   +T G+ +PPG+K PF
Sbjct: 63  EDDKEMLEDLIAAAFNDAARRVEETQKEKMAGVTGGMQLPPGMKMPF 109


>gi|330981945|gb|EGH80048.1| hypothetical protein PSYAP_25854 [Pseudomonas syringae pv. aptata
           str. DSM 50252]
          Length = 108

 Score = 88.2 bits (217), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 47/107 (43%), Positives = 70/107 (65%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M+ +MK   Q +++Q KM KM+E + + E  G +G GMVSV + G++ +  + +D SL+ 
Sbjct: 6   MAGLMK---QAQQMQEKMAKMQEELANAEVTGQSGAGMVSVVMTGRHDVKRINLDDSLMQ 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED  E+LEDLI AA +DA +KIE     KT  +T G+ +PPG+K PF
Sbjct: 63  EDK-EVLEDLIAAAVNDAVRKIEQASQDKTASMTAGMQLPPGMKLPF 108


>gi|146337879|ref|YP_001202927.1| hypothetical protein BRADO0764 [Bradyrhizobium sp. ORS278]
 gi|166228859|sp|A4YLB3|Y764_BRASO RecName: Full=UPF0133 protein BRADO0764
 gi|146190685|emb|CAL74689.1| conserved hypothetical protein; putative YbaB family protein
           [Bradyrhizobium sp. ORS278]
          Length = 106

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 44/105 (41%), Positives = 68/105 (64%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M++ + M+ Q  ++Q KM++M+  + ++E EG +GGG+V+VR+  K  +  +KID SLL 
Sbjct: 1   MADFLGMMKQAAQLQSKMQEMQAELGNVEVEGISGGGLVAVRMTAKMDVKSIKIDPSLLK 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKF 105
            +  EILEDL++ AH DA +K E  +  K Q IT  L +PPG  F
Sbjct: 61  PEEAEILEDLLVTAHGDARRKAEAAMQEKMQAITGKLGLPPGFGF 105


>gi|85058668|ref|YP_454370.1| hypothetical protein SG0690 [Sodalis glossinidius str. 'morsitans']
 gi|123519909|sp|Q2NV60|Y690_SODGM RecName: Full=UPF0133 protein SG0690
 gi|84779188|dbj|BAE73965.1| conserved hypothetical protein [Sodalis glossinidius str.
           'morsitans']
          Length = 109

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 46/107 (42%), Positives = 69/107 (64%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+MK   Q +++Q KM++M+E I  LE  G +G G+V V ING +    V++D SLL 
Sbjct: 7   MGNLMK---QAQQMQEKMQRMQEEIAQLEVTGESGAGLVKVTINGAHNCRRVEVDPSLL- 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ ++LEDLI AA +DA ++I +    K   ++ G+ +PPG K PF
Sbjct: 63  EDDKDMLEDLIAAAFNDAARRIAETQKEKMAAVSSGMQLPPGFKMPF 109


>gi|170767949|ref|ZP_02902402.1| conserved hypothetical protein [Escherichia albertii TW07627]
 gi|170123437|gb|EDS92368.1| conserved hypothetical protein [Escherichia albertii TW07627]
          Length = 109

 Score = 87.8 bits (216), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 47/107 (43%), Positives = 69/107 (64%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           + N+MK   Q +++Q KM+KM+E I  LE  G +G G+V V ING +    V+I  SLL 
Sbjct: 7   LGNLMK---QAQQMQEKMQKMQEEIAQLEVTGESGAGLVKVTINGAHNCRRVEIAPSLL- 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ E+LEDL+ AA +DA ++IE+    K   ++ G+ +PPG K PF
Sbjct: 63  EDDKEMLEDLVAAAFNDAARRIEETQKEKMASVSSGMQLPPGFKMPF 109


>gi|37680594|ref|NP_935203.1| hypothetical protein VV2410 [Vibrio vulnificus YJ016]
 gi|320155733|ref|YP_004188112.1| hypothetical protein VVM_01751 [Vibrio vulnificus MO6-24/O]
 gi|30316305|sp|Q8DB23|Y2004_VIBVU RecName: Full=UPF0133 protein VV1_2004
 gi|47117409|sp|Q7MIV3|Y2410_VIBVY RecName: Full=UPF0133 protein VV2410
 gi|37199342|dbj|BAC95174.1| conserved hypothetical protein [Vibrio vulnificus YJ016]
 gi|319931045|gb|ADV85909.1| hypothetical protein co-occurring with RecR [Vibrio vulnificus
           MO6-24/O]
          Length = 109

 Score = 87.8 bits (216), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 46/107 (42%), Positives = 71/107 (66%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+MK   Q +++Q +M+K++E I ++E  G +G G+V V I G + +  V ID SL+ 
Sbjct: 7   MGNLMK---QAQQMQERMQKLQEEIANMEVVGESGAGLVKVTITGSHSVRRVNIDESLM- 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ E+LEDLI AA +DA +++E+    K   IT G+ +PPG+K PF
Sbjct: 63  EDDKEMLEDLIAAAFNDAARRVEETQKEKMAAITGGMQLPPGMKMPF 109


>gi|260776401|ref|ZP_05885296.1| hypothetical protein VIC_001785 [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|323499526|ref|ZP_08104496.1| hypothetical protein VISI1226_22982 [Vibrio sinaloensis DSM 21326]
 gi|260607624|gb|EEX33889.1| hypothetical protein VIC_001785 [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|323315399|gb|EGA68440.1| hypothetical protein VISI1226_22982 [Vibrio sinaloensis DSM 21326]
          Length = 109

 Score = 87.8 bits (216), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 72/107 (67%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+MK   Q +++Q +M+K++E I ++E  G +G G+V V I G + +  V+ID SL+ 
Sbjct: 7   MGNLMK---QAQQMQERMQKLQEEIANMEVTGESGAGLVKVTITGSHSVRRVEIDESLM- 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ E+LEDLI AA +DA +++E+    K   +T G+ +PPG+K PF
Sbjct: 63  EDDKEMLEDLIAAAFNDAARRVEETQKEKMAGVTGGMQLPPGMKMPF 109


>gi|323493359|ref|ZP_08098482.1| hypothetical protein VIBR0546_07697 [Vibrio brasiliensis LMG 20546]
 gi|323312445|gb|EGA65586.1| hypothetical protein VIBR0546_07697 [Vibrio brasiliensis LMG 20546]
          Length = 109

 Score = 87.4 bits (215), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 72/107 (67%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+MK   Q +++Q +M+K++E I ++E  G +G G+V V I G + +  V+ID SL+ 
Sbjct: 7   MGNLMK---QAQQMQDRMQKLQEEIANMEVTGESGAGLVKVTITGSHSVRRVEIDDSLM- 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ E+LEDLI AA +DA +++E+    K   +T G+ +PPG+K PF
Sbjct: 63  EDDKEMLEDLIAAAFNDAARRVEETQKEKMAGVTGGMQLPPGMKMPF 109


>gi|157375986|ref|YP_001474586.1| hypothetical protein Ssed_2851 [Shewanella sediminis HAW-EB3]
 gi|189039789|sp|A8FX85|Y2851_SHESH RecName: Full=UPF0133 protein Ssed_2851
 gi|157318360|gb|ABV37458.1| conserved hypothetical protein [Shewanella sediminis HAW-EB3]
          Length = 109

 Score = 87.4 bits (215), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 47/107 (43%), Positives = 70/107 (65%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+MK   Q +++Q KM K++E I  +E  G AG G+V V + G + +  V ID SLL 
Sbjct: 7   MGNLMK---QAQQMQDKMAKVQEEIARMEVTGEAGAGLVKVTMTGSHSVRKVDIDPSLL- 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ E+LEDLI AA +DA +++E+    +  E+T G+ +PPG+K PF
Sbjct: 63  EDDKEMLEDLIAAACNDAARRVEENQKERMAEVTGGMQLPPGMKMPF 109


>gi|127513162|ref|YP_001094359.1| hypothetical protein Shew_2234 [Shewanella loihica PV-4]
 gi|166227689|sp|A3QF52|Y2234_SHELP RecName: Full=UPF0133 protein Shew_2234
 gi|126638457|gb|ABO24100.1| conserved hypothetical protein 103 [Shewanella loihica PV-4]
          Length = 109

 Score = 87.4 bits (215), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 48/107 (44%), Positives = 70/107 (65%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+MK   Q + +Q KM K++E I  +E  G AG G+V V + G + +  V+ID SLL 
Sbjct: 7   MGNLMK---QAQMMQDKMAKVQEEIARMEVTGEAGAGLVKVTMTGSHSVRKVEIDPSLL- 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ E+LEDLI AA +DA +++E+    K  E+T G+ +PPG+K PF
Sbjct: 63  EDDKEMLEDLIAAACNDAARRVEESQKEKMAEVTGGMQLPPGMKMPF 109


>gi|167855377|ref|ZP_02478144.1| hypothetical protein HPS_09201 [Haemophilus parasuis 29755]
 gi|167853525|gb|EDS24772.1| hypothetical protein HPS_09201 [Haemophilus parasuis 29755]
          Length = 109

 Score = 87.4 bits (215), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 41/98 (41%), Positives = 67/98 (68%), Gaps = 1/98 (1%)

Query: 10  QFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILED 69
           Q +++Q +M+KM+E I  LE  G +G G+V V ING +    ++ID SL+ ED+ E++ED
Sbjct: 13  QAQQMQERMQKMQEEIAQLEVTGESGAGLVKVTINGAHNCRRIEIDPSLM-EDDKEMVED 71

Query: 70  LIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           L+ AA +DA ++ +++   K   +T G+ +PPG+KFPF
Sbjct: 72  LVAAAFNDAVRRADEMQKEKMASVTAGMQLPPGMKFPF 109


>gi|240948278|ref|ZP_04752664.1| hypothetical protein AM305_05479 [Actinobacillus minor NM305]
 gi|257465543|ref|ZP_05629914.1| hypothetical protein AM202_03460 [Actinobacillus minor 202]
 gi|240297317|gb|EER47858.1| hypothetical protein AM305_05479 [Actinobacillus minor NM305]
 gi|257451203|gb|EEV25246.1| hypothetical protein AM202_03460 [Actinobacillus minor 202]
          Length = 109

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 44/98 (44%), Positives = 66/98 (67%), Gaps = 1/98 (1%)

Query: 10  QFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILED 69
           Q +++Q KM+KM+E I  LE  G +G G+V V ING +    ++ID SL+ ED+ E++ED
Sbjct: 13  QAQQMQEKMQKMQEEIAQLEVTGESGAGLVKVTINGAHNCRRIEIDPSLM-EDDKEMVED 71

Query: 70  LIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           L+ AA +DA ++ E+L   K   +T GL +P G+KFPF
Sbjct: 72  LVAAAFNDAVRRAEELQKEKMASVTAGLNLPAGMKFPF 109


>gi|323136737|ref|ZP_08071818.1| hypothetical protein family UPF0133 [Methylocystis sp. ATCC 49242]
 gi|322398054|gb|EFY00575.1| hypothetical protein family UPF0133 [Methylocystis sp. ATCC 49242]
          Length = 107

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 66/107 (61%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M + M ++ Q +++Q KM + +  +   E EG AGGG+V VR+  K  +  + ID SL+ 
Sbjct: 1   MMDFMGLMKQAQQMQAKMAEAQLELEQTEVEGEAGGGLVKVRLTAKGAMKSISIDPSLVK 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            +  EILEDLI+ AH  A  + ++++A K + +T GL +PPG K PF
Sbjct: 61  PEEKEILEDLIVTAHMQARARADEVMAEKMKAMTGGLQLPPGFKLPF 107


>gi|326423918|ref|NP_760874.2| hypothetical protein VV1_2004 [Vibrio vulnificus CMCP6]
 gi|319999295|gb|AAO10401.2| conserved protein of unknown function likely to be involved in DNA
           repair [Vibrio vulnificus CMCP6]
          Length = 109

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 46/107 (42%), Positives = 70/107 (65%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+MK   Q +++Q +M+K++E I  +E  G +G G+V V I G + +  V ID SL+ 
Sbjct: 7   MGNLMK---QAQQMQERMQKLQEEIAXMEVVGESGAGLVKVTITGSHSVRRVNIDESLM- 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ E+LEDLI AA +DA +++E+    K   IT G+ +PPG+K PF
Sbjct: 63  EDDKEMLEDLIAAAFNDAARRVEETQKEKMAAITGGMQLPPGMKMPF 109


>gi|291616583|ref|YP_003519325.1| YbaB [Pantoea ananatis LMG 20103]
 gi|291151613|gb|ADD76197.1| YbaB [Pantoea ananatis LMG 20103]
 gi|327393013|dbj|BAK10435.1| hypothetical UPF0133 protein YbaB [Pantoea ananatis AJ13355]
          Length = 109

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 71/107 (66%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           + N+MK   Q +++Q KM +++E I +LE  G +G GMV V ING +    V++D SLL 
Sbjct: 7   LGNLMK---QAQQMQDKMAQVQEEIAALEVTGESGAGMVKVTINGAHNCRRVEVDPSLL- 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ ++LEDLI AA +DA ++I+++   K   ++ G+ +PPG K PF
Sbjct: 63  EDDKDMLEDLIAAAFNDAARRIDEVQKEKMASVSSGMQLPPGFKMPF 109


>gi|329296814|ref|ZP_08254150.1| hypothetical protein Pstas_10045 [Plautia stali symbiont]
          Length = 109

 Score = 87.4 bits (215), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 46/107 (42%), Positives = 70/107 (65%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           + N+MK   Q +++Q KM K++E I +LE  G +G G+V V ING +    V++D SLL 
Sbjct: 7   LGNLMK---QAQQMQDKMAKVQEEIAALEVTGESGAGLVKVTINGAHNCRRVEVDPSLL- 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ E+LEDLI AA +DA ++I++    K   ++ G+ +PPG K PF
Sbjct: 63  EDDKEMLEDLIAAAFNDAARRIDETQKEKMASVSAGMQLPPGFKMPF 109


>gi|157961335|ref|YP_001501369.1| hypothetical protein Spea_1509 [Shewanella pealeana ATCC 700345]
 gi|189038733|sp|A8H2P7|Y1509_SHEPA RecName: Full=UPF0133 protein Spea_1509
 gi|157846335|gb|ABV86834.1| conserved hypothetical protein [Shewanella pealeana ATCC 700345]
          Length = 109

 Score = 87.0 bits (214), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 48/107 (44%), Positives = 69/107 (64%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+MK   Q + +Q KM K++E I  +E  G AG G+V V + G + +  V ID SLL 
Sbjct: 7   MGNLMK---QAQMMQDKMAKVQEEIARMEVTGEAGAGLVKVTMTGSHSVRKVDIDASLL- 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ E+LEDLI AA +DA +++E+    K  E+T G+ +PPG+K PF
Sbjct: 63  EDDKEMLEDLIAAACNDAARRVEENQKEKMAEVTGGMQLPPGMKMPF 109


>gi|317492876|ref|ZP_07951300.1| ybaB protein [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316918998|gb|EFV40333.1| ybaB protein [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 109

 Score = 87.0 bits (214), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 46/107 (42%), Positives = 69/107 (64%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           + N+MK   Q +++Q KM K++E I  LE  G +G G+V V ING +    ++ID SL+ 
Sbjct: 7   LGNLMK---QAQQMQDKMAKVQEEIAQLEVTGESGAGLVKVTINGAHNCRRIEIDPSLM- 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ E+LEDLI AA +DA ++IE+    K   ++ G+ +PPG K PF
Sbjct: 63  EDDKEMLEDLIAAAFNDAARRIEETQKEKMASVSSGMQLPPGFKMPF 109


>gi|163750245|ref|ZP_02157487.1| hypothetical protein KT99_10303 [Shewanella benthica KT99]
 gi|294141553|ref|YP_003557531.1| hypothetical protein SVI_2782 [Shewanella violacea DSS12]
 gi|161330101|gb|EDQ01085.1| hypothetical protein KT99_10303 [Shewanella benthica KT99]
 gi|293328022|dbj|BAJ02753.1| conserved hypothetical protein [Shewanella violacea DSS12]
          Length = 109

 Score = 87.0 bits (214), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 46/107 (42%), Positives = 69/107 (64%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+MK   Q +++Q KM K +E I  +E  G AG G+V + + G + +  V ID SLL 
Sbjct: 7   MGNLMK---QAQQMQDKMAKAQEEIARMEVTGEAGAGLVKITMTGSHSVRKVDIDPSLL- 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ E+LEDLI AA +DA +++E+    +  E+T G+ +PPG+K PF
Sbjct: 63  EDDKEMLEDLIAAACNDAARRVEESQKERMAEVTGGMQLPPGMKMPF 109


>gi|162149235|ref|YP_001603696.1| hypothetical protein GDI_3467 [Gluconacetobacter diazotrophicus PAl
           5]
 gi|209545027|ref|YP_002277256.1| hypothetical protein Gdia_2910 [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|189040150|sp|A9H481|Y3467_GLUDA RecName: Full=UPF0133 protein GDI3467/Gdia_2910
 gi|161787812|emb|CAP57410.1| conserved hypothetical protein [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|209532704|gb|ACI52641.1| conserved hypothetical protein [Gluconacetobacter diazotrophicus
           PAl 5]
          Length = 107

 Score = 87.0 bits (214), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 70/107 (65%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+  ++ Q  ++Q +ME+M+  +  +  EG+AG GMV V +NGK  +  VKID  L  
Sbjct: 1   MKNLAGLMKQATQMQARMEEMQSKLEGMTIEGSAGAGMVHVTLNGKGDMKAVKIDPKLAD 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
              +E+L+DLI+AA +DA K +++  + + +++T G+ +P GLKFPF
Sbjct: 61  PAEMEMLQDLIVAACADARKLLDERASEEMKKVTGGMNLPAGLKFPF 107


>gi|86148366|ref|ZP_01066659.1| hypothetical protein MED222_02691 [Vibrio sp. MED222]
 gi|218708915|ref|YP_002416536.1| hypothetical protein VS_0917 [Vibrio splendidus LGP32]
 gi|254807270|sp|B7VL97|Y917_VIBSL RecName: Full=UPF0133 protein VS_0917
 gi|85833849|gb|EAQ52014.1| hypothetical protein MED222_02691 [Vibrio sp. MED222]
 gi|218321934|emb|CAV17929.1| Hypothetical protein VS_0917 [Vibrio splendidus LGP32]
          Length = 109

 Score = 86.7 bits (213), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 71/107 (66%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+MK   Q +++Q +M+K++E I ++E  G +G G+V V I G + +  V ID SL+ 
Sbjct: 7   MGNMMK---QAQQMQERMQKLQEEIANMEVTGESGAGLVKVTITGSHSVRRVDIDESLM- 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ E+LEDLI AA +DA +++E+    K   +T G+ +PPG+K PF
Sbjct: 63  EDDKEMLEDLIAAAFNDAARRVEETQKEKMAGVTGGMQLPPGMKMPF 109


>gi|219871232|ref|YP_002475607.1| hypothetical protein HAPS_1040 [Haemophilus parasuis SH0165]
 gi|254799908|sp|B8F5Q7|Y1040_HAEPS RecName: Full=UPF0133 protein HAPS_1040
 gi|219691436|gb|ACL32659.1| conserved hypothetical protein [Haemophilus parasuis SH0165]
          Length = 109

 Score = 86.7 bits (213), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 41/98 (41%), Positives = 66/98 (67%), Gaps = 1/98 (1%)

Query: 10  QFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILED 69
           Q +++Q +M+KM+E I  LE  G +G G+V V ING +    ++ID SL+ ED+ E+ ED
Sbjct: 13  QAQQMQERMQKMQEEIAQLEVTGESGAGLVKVTINGAHNCRRIEIDPSLM-EDDKEMAED 71

Query: 70  LIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           L+ AA +DA ++ +++   K   +T G+ +PPG+KFPF
Sbjct: 72  LVAAAFNDAVRRADEMQKEKMASVTAGMQLPPGMKFPF 109


>gi|89094006|ref|ZP_01166950.1| hypothetical protein MED92_01876 [Oceanospirillum sp. MED92]
 gi|89081680|gb|EAR60908.1| hypothetical protein MED92_01876 [Oceanospirillum sp. MED92]
          Length = 107

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 48/107 (44%), Positives = 68/107 (63%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+MK   Q +++Q  ++K +E I S E  G +G G+V V +NG++ + G+ ID SL+ 
Sbjct: 5   MGNLMK---QAQKMQENLQKAQEQIASAEQTGESGAGLVKVVMNGRHDVKGISIDDSLME 61

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED  EILEDLI AA +DA +KIE     K  E+T G+ +PPG   PF
Sbjct: 62  EDK-EILEDLIAAAVNDAVRKIESYTQEKMAEVTGGMGMPPGFNMPF 107


>gi|114563576|ref|YP_751089.1| hypothetical protein Sfri_2406 [Shewanella frigidimarina NCIMB 400]
 gi|122299430|sp|Q080R4|Y2406_SHEFN RecName: Full=UPF0133 protein Sfri_2406
 gi|114334869|gb|ABI72251.1| conserved hypothetical protein 103 [Shewanella frigidimarina NCIMB
           400]
          Length = 110

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 49/107 (45%), Positives = 70/107 (65%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+MK   Q + +Q KM K++E I   E  G AG G+V V + G + +  V+ID SL+ 
Sbjct: 8   MGNLMK---QAQMMQDKMAKVQEEIARTEMTGEAGAGLVKVTMTGNHNVRKVEIDPSLM- 63

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ E+LEDLI AA +DA ++IE+   TK  E+T G+ +PPG+K PF
Sbjct: 64  EDDKEMLEDLIAAACNDAARRIEENQKTKMAEVTGGMQLPPGMKMPF 110


>gi|58039073|ref|YP_191037.1| hypothetical protein GOX0603 [Gluconobacter oxydans 621H]
 gi|81352377|sp|Q5FTB5|Y603_GLUOX RecName: Full=UPF0133 protein GOX0603
 gi|58001487|gb|AAW60381.1| Hypothetical protein GOX0603 [Gluconobacter oxydans 621H]
          Length = 107

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 68/107 (63%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+  ++ Q  ++Q KME  + ++ SL  +G+AG G+V+V++ GK  +  +KID  L  
Sbjct: 1   MKNLAGLMKQASQMQAKMEAAQSNLASLIVDGSAGAGLVTVKLTGKGEMRDLKIDPQLAD 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
             ++E L+DLI+AA++DA  K E   +   +++T GL +P GLK PF
Sbjct: 61  PSDIETLQDLIVAAYTDAKTKAEAASSEAMRDVTGGLDLPAGLKLPF 107


>gi|28870801|ref|NP_793420.1| hypothetical protein PSPTO_3645 [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|66045070|ref|YP_234911.1| hypothetical protein Psyr_1826 [Pseudomonas syringae pv. syringae
           B728a]
 gi|71736808|ref|YP_274020.1| hypothetical protein PSPPH_1786 [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|213968913|ref|ZP_03397053.1| conserved hypothetical protein [Pseudomonas syringae pv. tomato T1]
 gi|257484500|ref|ZP_05638541.1| hypothetical protein PsyrptA_14674 [Pseudomonas syringae pv. tabaci
           ATCC 11528]
 gi|289626399|ref|ZP_06459353.1| hypothetical protein PsyrpaN_14882 [Pseudomonas syringae pv.
           aesculi str. NCPPB3681]
 gi|289649553|ref|ZP_06480896.1| hypothetical protein Psyrpa2_17673 [Pseudomonas syringae pv.
           aesculi str. 2250]
 gi|289679615|ref|ZP_06500505.1| hypothetical protein PsyrpsF_40332 [Pseudomonas syringae pv.
           syringae FF5]
 gi|298486350|ref|ZP_07004412.1| Transcriptional regulatory protein [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|301385365|ref|ZP_07233783.1| hypothetical protein PsyrptM_22134 [Pseudomonas syringae pv. tomato
           Max13]
 gi|302063639|ref|ZP_07255180.1| hypothetical protein PsyrptK_26958 [Pseudomonas syringae pv. tomato
           K40]
 gi|302133890|ref|ZP_07259880.1| hypothetical protein PsyrptN_20987 [Pseudomonas syringae pv. tomato
           NCPPB 1108]
 gi|302185102|ref|ZP_07261775.1| hypothetical protein Psyrps6_02124 [Pseudomonas syringae pv.
           syringae 642]
 gi|38258734|sp|Q87YZ4|Y3645_PSESM RecName: Full=UPF0133 protein PSPTO_3645
 gi|75502602|sp|Q4ZVE9|Y1826_PSEU2 RecName: Full=UPF0133 protein Psyr_1826
 gi|123637189|sp|Q48KQ5|Y1786_PSE14 RecName: Full=UPF0133 protein PSPPH_1786
 gi|28854050|gb|AAO57115.1| conserved protein of unknown function [Pseudomonas syringae pv.
           tomato str. DC3000]
 gi|63255777|gb|AAY36873.1| Conserved hypothetical protein 103 [Pseudomonas syringae pv.
           syringae B728a]
 gi|71557361|gb|AAZ36572.1| conserved hypothetical protein TIGR00103 [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|213926212|gb|EEB59767.1| conserved hypothetical protein [Pseudomonas syringae pv. tomato T1]
 gi|298159078|gb|EFI00137.1| Transcriptional regulatory protein [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|320323484|gb|EFW79569.1| hypothetical protein PsgB076_17216 [Pseudomonas syringae pv.
           glycinea str. B076]
 gi|320329473|gb|EFW85465.1| hypothetical protein PsgRace4_13694 [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330866323|gb|EGH01032.1| hypothetical protein PSYAE_03505 [Pseudomonas syringae pv. aesculi
           str. 0893_23]
 gi|330879128|gb|EGH13277.1| hypothetical protein PSYMP_23941 [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
 gi|330879812|gb|EGH13961.1| hypothetical protein Pgy4_15344 [Pseudomonas syringae pv. glycinea
           str. race 4]
 gi|330897697|gb|EGH29116.1| hypothetical protein PSYJA_09080 [Pseudomonas syringae pv. japonica
           str. M301072PT]
 gi|330939990|gb|EGH43190.1| hypothetical protein PSYPI_12684 [Pseudomonas syringae pv. pisi
           str. 1704B]
 gi|330954422|gb|EGH54682.1| hypothetical protein PSYCIT7_24290 [Pseudomonas syringae Cit 7]
 gi|330960240|gb|EGH60500.1| hypothetical protein PMA4326_16931 [Pseudomonas syringae pv.
           maculicola str. ES4326]
 gi|330963242|gb|EGH63502.1| hypothetical protein PSYAC_01040 [Pseudomonas syringae pv.
           actinidiae str. M302091]
 gi|330973300|gb|EGH73366.1| hypothetical protein PSYAR_22709 [Pseudomonas syringae pv. aceris
           str. M302273PT]
 gi|330986181|gb|EGH84284.1| hypothetical protein PLA107_14260 [Pseudomonas syringae pv.
           lachrymans str. M301315]
 gi|331013237|gb|EGH93293.1| hypothetical protein PSYTB_26942 [Pseudomonas syringae pv. tabaci
           ATCC 11528]
 gi|331015913|gb|EGH95969.1| hypothetical protein PLA106_07930 [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 108

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 46/107 (42%), Positives = 70/107 (65%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M+ +MK   Q +++Q KM KM+E + + E  G +G G+VSV + G++ +  + +D SL+ 
Sbjct: 6   MAGLMK---QAQQMQEKMAKMQEELANAEVTGQSGAGLVSVVMTGRHDVKRINLDDSLMQ 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED  E+LEDLI AA +DA +KIE     KT  +T G+ +PPG+K PF
Sbjct: 63  EDK-EVLEDLIAAAVNDAVRKIEQASQDKTASMTAGMQLPPGMKLPF 108


>gi|260769014|ref|ZP_05877948.1| DUF149 domain-containing protein [Vibrio furnissii CIP 102972]
 gi|260617044|gb|EEX42229.1| DUF149 domain-containing protein [Vibrio furnissii CIP 102972]
 gi|315180753|gb|ADT87667.1| hypothetical protein vfu_A02544 [Vibrio furnissii NCTC 11218]
          Length = 109

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 71/107 (66%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+MK   Q +++Q +M+K++E I ++E  G +G G+V V I G + +  V ID SL+ 
Sbjct: 7   MGNLMK---QAQQMQERMQKLQEEIANMEITGESGAGLVKVTITGSHSVRRVDIDESLM- 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ E+LEDLI AA +DA +++E+    K   +T G+ +PPG+K PF
Sbjct: 63  EDDKEMLEDLIAAAFNDAARRVEEAQKEKMAGVTGGMQLPPGMKMPF 109


>gi|120598524|ref|YP_963098.1| hypothetical protein Sputw3181_1707 [Shewanella sp. W3-18-1]
 gi|146293397|ref|YP_001183821.1| hypothetical protein Sputcn32_2301 [Shewanella putrefaciens CN-32]
 gi|166227710|sp|A4Y7T9|Y2301_SHEPC RecName: Full=UPF0133 protein Sputcn32_2301
 gi|166234785|sp|A1RIP9|Y1707_SHESW RecName: Full=UPF0133 protein Sputw3181_1707
 gi|120558617|gb|ABM24544.1| conserved hypothetical protein 103 [Shewanella sp. W3-18-1]
 gi|145565087|gb|ABP76022.1| conserved hypothetical protein 103 [Shewanella putrefaciens CN-32]
 gi|319426700|gb|ADV54774.1| conserved hypothetical protein [Shewanella putrefaciens 200]
          Length = 109

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 48/107 (44%), Positives = 70/107 (65%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+MK   Q + +Q KM KM+E I  +E  G +G G+V V + G + +  V+ID SL+ 
Sbjct: 7   MGNLMK---QAQMMQEKMAKMQEEIARMEMVGESGAGLVKVTMTGAHTVRKVEIDPSLM- 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ E+LEDLI AA +DA ++IE+    K  E+T G+ +PPG+K PF
Sbjct: 63  EDDKEMLEDLIAAACNDAARRIEENQKAKMAEVTGGMQLPPGMKMPF 109


>gi|117620231|ref|YP_856736.1| hypothetical protein AHA_2212 [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
 gi|166227684|sp|A0KKD5|Y2212_AERHH RecName: Full=UPF0133 protein AHA_2212
 gi|117561638|gb|ABK38586.1| conserved hypothetical protein [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
          Length = 109

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 72/107 (67%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+MK   Q +++Q +M+KM+E +  +E  G AG GMV V + G + +  ++ID SL+ 
Sbjct: 7   MGNLMK---QAQQMQERMQKMQEQLAQMEVVGEAGAGMVKVTMAGSHSVRRIEIDPSLM- 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ E+LEDL+ AA +DA +++E+   +K  E+T G+ +PPG K PF
Sbjct: 63  EDDKEMLEDLVAAAVNDAVRRVEEQNKSKMGELTGGMQLPPGFKMPF 109


>gi|325522011|gb|EGD00695.1| hypothetical protein B1M_30285 [Burkholderia sp. TJI49]
          Length = 108

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 44/105 (41%), Positives = 66/105 (62%), Gaps = 1/105 (0%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           NI  ++ Q +++Q  M+KM+E +  +E EG +G G+V V +  +N +  V ID SLL +D
Sbjct: 5   NIAGLMKQAQQMQENMKKMQEQLAQIEVEGQSGAGLVKVTMTCRNEVRRVSIDPSLLADD 64

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
             ++LEDL+ AA +DA +K E     K   +T GLP+PPG K PF
Sbjct: 65  K-DMLEDLVAAAFNDAVRKAEATSQEKMSGMTSGLPLPPGFKLPF 108


>gi|26990959|ref|NP_746384.1| hypothetical protein PP_4268 [Pseudomonas putida KT2440]
 gi|148546838|ref|YP_001266940.1| hypothetical protein Pput_1600 [Pseudomonas putida F1]
 gi|167034828|ref|YP_001670059.1| hypothetical protein PputGB1_3833 [Pseudomonas putida GB-1]
 gi|38258738|sp|Q88F31|Y4268_PSEPK RecName: Full=UPF0133 protein PP_4268
 gi|166979806|sp|A5W0U6|Y1600_PSEP1 RecName: Full=UPF0133 protein Pput_1600
 gi|189040251|sp|B0KPW8|Y3833_PSEPG RecName: Full=UPF0133 protein PputGB1_3833
 gi|24985982|gb|AAN69848.1|AE016623_10 conserved hypothetical protein [Pseudomonas putida KT2440]
 gi|148510896|gb|ABQ77756.1| conserved hypothetical protein 103 [Pseudomonas putida F1]
 gi|166861316|gb|ABY99723.1| conserved hypothetical protein [Pseudomonas putida GB-1]
 gi|313497892|gb|ADR59258.1| Hypothetical protein, conserved [Pseudomonas putida BIRD-1]
          Length = 111

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 72/109 (66%), Gaps = 5/109 (4%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M+ +MK   Q +++Q KM+KM+E + + E  G +GGG+VSV + G++ +  V ID+SL+ 
Sbjct: 6   MAGLMK---QAQQMQEKMQKMQEELANAEVTGQSGGGLVSVVMTGRHDVKRVSIDQSLMS 62

Query: 61  --EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
             ED+ E+LEDLI AA +DA +K+E     K   +T G+ +PPG K PF
Sbjct: 63  TDEDDKEVLEDLIAAALNDAVRKVEQSSQEKMGGMTAGMQLPPGFKMPF 111


>gi|217972947|ref|YP_002357698.1| hypothetical protein Sbal223_1770 [Shewanella baltica OS223]
 gi|304409214|ref|ZP_07390835.1| Uncharacterized protein family UPF0133 [Shewanella baltica OS183]
 gi|307303217|ref|ZP_07582972.1| conserved hypothetical protein [Shewanella baltica BA175]
 gi|254800622|sp|B8E702|Y1770_SHEB2 RecName: Full=UPF0133 protein Sbal223_1770
 gi|217498082|gb|ACK46275.1| conserved hypothetical protein [Shewanella baltica OS223]
 gi|304353035|gb|EFM17432.1| Uncharacterized protein family UPF0133 [Shewanella baltica OS183]
 gi|306913577|gb|EFN43999.1| conserved hypothetical protein [Shewanella baltica BA175]
 gi|315267991|gb|ADT94844.1| Uncharacterised protein family UPF0133 [Shewanella baltica OS678]
          Length = 109

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 48/107 (44%), Positives = 71/107 (66%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+MK   Q + +Q KM K++E I  +E  G +G G+V V + G + +  V+ID SL+ 
Sbjct: 7   MGNLMK---QAQMMQEKMAKVQEEIARMEMVGESGAGLVKVTMTGAHTVRKVEIDPSLM- 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ E+LEDLI AA +DA ++IE+   TK  E+T G+ +PPG+K PF
Sbjct: 63  EDDKEMLEDLIAAACNDAARRIEENQKTKMAEVTGGMQLPPGMKMPF 109


>gi|126174786|ref|YP_001050935.1| hypothetical protein Sbal_2573 [Shewanella baltica OS155]
 gi|153001131|ref|YP_001366812.1| hypothetical protein Shew185_2614 [Shewanella baltica OS185]
 gi|160875801|ref|YP_001555117.1| hypothetical protein Sbal195_2689 [Shewanella baltica OS195]
 gi|125997991|gb|ABN62066.1| conserved hypothetical protein 103 [Shewanella baltica OS155]
 gi|151365749|gb|ABS08749.1| conserved hypothetical protein 103 [Shewanella baltica OS185]
 gi|160861323|gb|ABX49857.1| conserved hypothetical protein [Shewanella baltica OS195]
          Length = 121

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 48/107 (44%), Positives = 71/107 (66%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+MK   Q + +Q KM K++E I  +E  G +G G+V V + G + +  V+ID SL+ 
Sbjct: 19  MGNLMK---QAQMMQEKMAKVQEEIARMEMVGESGAGLVKVTMTGAHTVRKVEIDPSLM- 74

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ E+LEDLI AA +DA ++IE+   TK  E+T G+ +PPG+K PF
Sbjct: 75  EDDKEMLEDLIAAACNDAARRIEENQKTKMAEVTGGMQLPPGMKMPF 121


>gi|317047211|ref|YP_004114859.1| hypothetical protein Pat9b_0979 [Pantoea sp. At-9b]
 gi|316948828|gb|ADU68303.1| conserved hypothetical protein [Pantoea sp. At-9b]
          Length = 128

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 70/107 (65%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           + N+MK   Q +++Q KM K++E I +LE  G +G G+V V ING +    V++D SLL 
Sbjct: 26  LGNLMK---QAQQMQDKMAKVQEEIAALEVTGESGAGLVKVTINGAHNCRRVEVDPSLL- 81

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ ++LEDLI AA +DA ++I++    K   ++ G+ +PPG K PF
Sbjct: 82  EDDKDMLEDLIAAAFNDAARRIDETQKEKMASVSAGMQLPPGFKMPF 128


>gi|149179096|ref|ZP_01857668.1| hypothetical protein PM8797T_30519 [Planctomyces maris DSM 8797]
 gi|148842087|gb|EDL56478.1| hypothetical protein PM8797T_30519 [Planctomyces maris DSM 8797]
          Length = 111

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 47/98 (47%), Positives = 65/98 (66%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           NI  M+ QF E+QGKM +M+E +  L  EG+AGGGMV+V  NG+  + GVKID++LL   
Sbjct: 1   NIAGMMKQFSEMQGKMTEMQEKLGKLRFEGSAGGGMVNVEANGQQKVLGVKIDQTLLESG 60

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           + E+LEDLI AA + A  K  +  A +  +IT G+ IP
Sbjct: 61  DREMLEDLITAATNQALDKAREGAAEEMSQITGGMNIP 98


>gi|149927017|ref|ZP_01915275.1| hypothetical protein LMED105_09187 [Limnobacter sp. MED105]
 gi|149824238|gb|EDM83458.1| hypothetical protein LMED105_09187 [Limnobacter sp. MED105]
          Length = 110

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 48/110 (43%), Positives = 68/110 (61%), Gaps = 6/110 (5%)

Query: 3   NIMK-----MVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRS 57
           N+MK     ++ Q +++Q KM KM+  I +LE EG +GGGMV V +  K+    + ID S
Sbjct: 2   NMMKGQLAGLMKQAQQMQEKMAKMQAEIGALEVEGQSGGGMVKVVMTCKHDCKRITIDPS 61

Query: 58  LLFEDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           LL ED  ++LEDL+ AA +DA +K E  +  K   +T G P+PPG K PF
Sbjct: 62  LLGEDK-DMLEDLVAAAFNDAVRKAEATMTEKMSSVTAGFPMPPGFKMPF 110


>gi|74316534|ref|YP_314274.1| hypothetical protein Tbd_0516 [Thiobacillus denitrificans ATCC
           25259]
 gi|74056029|gb|AAZ96469.1| Conserved hypothetical protein [Thiobacillus denitrificans ATCC
           25259]
          Length = 108

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 48/105 (45%), Positives = 65/105 (61%), Gaps = 4/105 (3%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           N+MK V Q +E    M KM+  +  +E EG +G GMV V +  K  +  V ID SL+ +D
Sbjct: 8   NMMKQVQQMQE---NMAKMQAKLAEIEIEGQSGAGMVKVTMTCKYDVRRVAIDPSLMSDD 64

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
             E+LEDL+ AA +DA +K+E  V  K   +T GLPIPPG+K PF
Sbjct: 65  K-EMLEDLVAAAVNDAVRKVETTVQEKMAGVTAGLPIPPGMKLPF 108


>gi|84393359|ref|ZP_00992119.1| hypothetical protein V12B01_20992 [Vibrio splendidus 12B01]
 gi|84376075|gb|EAP92963.1| hypothetical protein V12B01_20992 [Vibrio splendidus 12B01]
          Length = 109

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 71/107 (66%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+MK   Q +++Q +M+K++E I ++E  G +G G+V + I G + +  V ID SL+ 
Sbjct: 7   MGNMMK---QAQQMQERMQKLQEEIANMEVTGESGAGLVKITITGSHSVRRVDIDESLM- 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ E+LEDLI AA +DA +++E+    K   +T G+ +PPG+K PF
Sbjct: 63  EDDKEMLEDLIAAAFNDAARRVEETQKEKMAGVTGGMQLPPGMKMPF 109


>gi|300721961|ref|YP_003711241.1| hypothetical protein XNC1_0952 [Xenorhabdus nematophila ATCC 19061]
 gi|297628458|emb|CBJ89023.1| conserved hypothetical protein [Xenorhabdus nematophila ATCC 19061]
          Length = 109

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 71/107 (66%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           + N+MK   Q +++Q KM+KM+E I +LE  G +G G+V + ING +    V+ID SL+ 
Sbjct: 7   LGNLMK---QAQQMQEKMQKMQEEIANLEVTGESGAGLVKITINGAHNCRRVEIDPSLM- 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           +D+ ++LEDLI AA +DA ++IE+    K   ++ G+ +PPG K PF
Sbjct: 63  DDDKDMLEDLIAAAFNDAARRIEETQKEKMAGVSSGMQLPPGFKMPF 109


>gi|167587033|ref|ZP_02379421.1| hypothetical protein BuboB_16947 [Burkholderia ubonensis Bu]
          Length = 108

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 44/105 (41%), Positives = 66/105 (62%), Gaps = 1/105 (0%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           NI  ++ Q +++Q  M+KM+E +  +E EG +G G+V V +  +N +  V ID SLL +D
Sbjct: 5   NIAGLMKQAQQMQENMKKMQEQLAQIEVEGQSGAGLVKVTMTCRNEVRRVSIDPSLLADD 64

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
             ++LEDL+ AA +DA +K E     K   +T GLP+PPG K PF
Sbjct: 65  K-DMLEDLVAAAFNDAVRKAEATSQEKMSGMTAGLPLPPGFKLPF 108


>gi|269138377|ref|YP_003295077.1| hypothetical protein ETAE_1021 [Edwardsiella tarda EIB202]
 gi|267984037|gb|ACY83866.1| hypothetical protein ETAE_1021 [Edwardsiella tarda EIB202]
 gi|304558407|gb|ADM41071.1| hypothetical protein ETAF_0952 [Edwardsiella tarda FL6-60]
          Length = 109

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 46/107 (42%), Positives = 69/107 (64%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           + N+MK   Q +++Q KM+KM+E I  +E  G +G GMV V ING +    V+ID SL+ 
Sbjct: 7   LGNLMK---QAQQMQEKMQKMQEEIALVEVTGESGAGMVKVTINGAHNCRRVEIDPSLM- 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ E+LEDLI AA +DA ++I+     +   ++ G+ +PPG K PF
Sbjct: 63  EDDKEMLEDLIAAAFNDAARRIDSEQKERMASVSSGMQLPPGFKMPF 109


>gi|113970588|ref|YP_734381.1| hypothetical protein Shewmr4_2253 [Shewanella sp. MR-4]
 gi|113885272|gb|ABI39324.1| conserved hypothetical protein 103 [Shewanella sp. MR-4]
          Length = 111

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 47/107 (43%), Positives = 70/107 (65%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+MK   Q + +Q +M KM+E I  +E  G +G G+V V + G + +  V+ID SL+ 
Sbjct: 9   MGNLMK---QAQMMQERMAKMQEEIARMEMVGESGAGLVKVTMTGAHTVRKVEIDPSLM- 64

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ E+LEDLI AA +DA ++IE+    K  E+T G+ +PPG+K PF
Sbjct: 65  EDDKEMLEDLIAAACNDAARRIEENQKAKMAEVTGGMQLPPGMKMPF 111


>gi|327480433|gb|AEA83743.1| conserved hypothetical protein [Pseudomonas stutzeri DSM 4166]
          Length = 108

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 48/107 (44%), Positives = 70/107 (65%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M+ +MK   Q +++Q KM+KM+E + + E  G +G G+VSV +NG++ +  V +D SL+ 
Sbjct: 6   MAGLMK---QAQQMQEKMQKMQEELANAEVTGQSGAGLVSVVMNGRHDVKRVSLDDSLMQ 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED  EILEDLI AA +DA +KIE     K   +T G+ +PPG K PF
Sbjct: 63  EDK-EILEDLIAAAVNDAVRKIEQNSQEKMAGMTAGMQLPPGFKMPF 108


>gi|330829420|ref|YP_004392372.1| hypothetical protein B565_1720 [Aeromonas veronii B565]
 gi|328804556|gb|AEB49755.1| hypothetical protein B565_1720 [Aeromonas veronii B565]
          Length = 109

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 70/107 (65%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+MK   Q +++Q +M+K +E +  +E  G AG GMV V + G + +  ++ID SL+ 
Sbjct: 7   MGNLMK---QAQQMQERMQKAQEQLAQMEVTGEAGAGMVKVTMTGSHSVRRIEIDPSLM- 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ E+LEDL+ AA +DA +++E+    K  E+T G+ +PPG K PF
Sbjct: 63  EDDKELLEDLVAAACNDAVRRVEEQNKAKMGELTGGMQLPPGFKMPF 109


>gi|294635358|ref|ZP_06713852.1| putative cytoplasmic protein [Edwardsiella tarda ATCC 23685]
 gi|291091245|gb|EFE23806.1| putative cytoplasmic protein [Edwardsiella tarda ATCC 23685]
          Length = 109

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 46/107 (42%), Positives = 69/107 (64%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           + N+MK   Q +++Q KM+KM++ I  LE  G +G G+V V ING +    V+ID SL+ 
Sbjct: 7   LGNLMK---QAQQMQEKMQKMQDEIALLEVTGESGAGLVKVTINGAHNCRRVEIDPSLM- 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ E+LEDLI AA +DA ++IE     +   ++ G+ +PPG K PF
Sbjct: 63  EDDKEMLEDLIAAAFNDAARRIESEQKERMASVSSGMQLPPGFKMPF 109


>gi|114047819|ref|YP_738369.1| hypothetical protein Shewmr7_2325 [Shewanella sp. MR-7]
 gi|113889261|gb|ABI43312.1| conserved hypothetical protein 103 [Shewanella sp. MR-7]
          Length = 111

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 47/107 (43%), Positives = 70/107 (65%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+MK   Q + +Q +M KM+E I  +E  G +G G+V V + G + +  V+ID SL+ 
Sbjct: 9   MGNLMK---QAQMMQERMAKMQEEIARMEMVGESGAGLVKVTMTGTHTVRKVEIDPSLM- 64

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ E+LEDLI AA +DA ++IE+    K  E+T G+ +PPG+K PF
Sbjct: 65  EDDKEMLEDLIAAACNDAARRIEENQKAKMAEVTGGMQLPPGMKMPF 111


>gi|330889896|gb|EGH22557.1| hypothetical protein PSYMO_14081 [Pseudomonas syringae pv. mori
           str. 301020]
          Length = 108

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 70/107 (65%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M+ +MK   Q +++Q KM KM+E + + E  G +G G+VSV + G++ +  + +D SL+ 
Sbjct: 6   MAGLMK---QAQQMQEKMAKMQEELANAEVTGQSGAGLVSVVMTGRHDVKRINLDDSLMQ 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED  E++EDLI AA +DA +KIE     KT  +T G+ +PPG+K PF
Sbjct: 63  EDK-EVMEDLIAAAVNDAVRKIEQASQDKTASMTAGMQLPPGMKLPF 108


>gi|254252243|ref|ZP_04945561.1| hypothetical protein BDAG_01463 [Burkholderia dolosa AUO158]
 gi|124894852|gb|EAY68732.1| hypothetical protein BDAG_01463 [Burkholderia dolosa AUO158]
          Length = 120

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 43/105 (40%), Positives = 66/105 (62%), Gaps = 1/105 (0%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           N+  ++ Q +++Q  M+KM+E +  +E EG +G G+V V +  +N +  V ID SLL +D
Sbjct: 17  NLAGLMKQAQQMQENMKKMQEQLAQIEVEGQSGAGLVKVTMTCRNEVRRVSIDPSLLADD 76

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
             ++LEDL+ AA +DA +K E     K   +T GLP+PPG K PF
Sbjct: 77  K-DMLEDLVAAAFNDAVRKAEATSQEKMSGMTSGLPLPPGFKLPF 120


>gi|332290071|ref|YP_004420923.1| DNA-binding protein, YbaB/EbfC family [Gallibacterium anatis
           UMN179]
 gi|330432967|gb|AEC18026.1| DNA-binding protein, YbaB/EbfC family [Gallibacterium anatis
           UMN179]
          Length = 109

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 41/98 (41%), Positives = 65/98 (66%), Gaps = 1/98 (1%)

Query: 10  QFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILED 69
           Q +++Q +M+KM+E I  +E  G +G G+V V +NG +    V+ID SLL ED+ ++LED
Sbjct: 13  QAQQMQERMQKMQEEIAQMEVTGESGAGLVKVTVNGAHSCRRVEIDPSLL-EDDKDMLED 71

Query: 70  LIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           L+ AA +DA ++ ++L   K   +T G+ +PPG K PF
Sbjct: 72  LVAAAFNDAVRRADELQKEKMASVTAGMQLPPGFKMPF 109


>gi|307262658|ref|ZP_07544287.1| hypothetical protein appser13_860 [Actinobacillus pleuropneumoniae
           serovar 13 str. N273]
 gi|306871986|gb|EFN03701.1| hypothetical protein appser13_860 [Actinobacillus pleuropneumoniae
           serovar 13 str. N273]
          Length = 109

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 41/98 (41%), Positives = 66/98 (67%), Gaps = 1/98 (1%)

Query: 10  QFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILED 69
           Q +++Q +M+KM+E I  LE  G +G G+V V ING +    ++ID SL+ ED+ E++ED
Sbjct: 13  QAQQMQERMQKMQEEIAQLEVTGESGAGLVKVTINGAHNCRRIEIDPSLM-EDDKEMVED 71

Query: 70  LIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           L+ AA +DA ++ E++   K   +T G+ + PG+KFPF
Sbjct: 72  LVAAAFNDAVRRAEEMQKEKMASVTAGMQLSPGMKFPF 109


>gi|221198095|ref|ZP_03571141.1| conserved hypothetical protein TIGR00103 [Burkholderia multivorans
           CGD2M]
 gi|221204346|ref|ZP_03577363.1| conserved hypothetical protein TIGR00103 [Burkholderia multivorans
           CGD2]
 gi|221212755|ref|ZP_03585731.1| conserved hypothetical protein TIGR00103 [Burkholderia multivorans
           CGD1]
 gi|221166968|gb|EED99438.1| conserved hypothetical protein TIGR00103 [Burkholderia multivorans
           CGD1]
 gi|221175203|gb|EEE07633.1| conserved hypothetical protein TIGR00103 [Burkholderia multivorans
           CGD2]
 gi|221182027|gb|EEE14428.1| conserved hypothetical protein TIGR00103 [Burkholderia multivorans
           CGD2M]
          Length = 108

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 43/105 (40%), Positives = 66/105 (62%), Gaps = 1/105 (0%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           N+  ++ Q +++Q  M+KM+E +  +E EG +G G+V V +  +N +  V ID SLL +D
Sbjct: 5   NLAGLMKQAQQMQENMKKMQEQLAQIEVEGQSGAGLVKVTMTCRNEVRRVSIDPSLLADD 64

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
             ++LEDL+ AA +DA +K E     K   +T GLP+PPG K PF
Sbjct: 65  K-DMLEDLVAAAFNDAVRKAEATSQEKMSGMTSGLPLPPGFKLPF 108


>gi|254786715|ref|YP_003074144.1| hypothetical protein TERTU_2741 [Teredinibacter turnerae T7901]
 gi|237684305|gb|ACR11569.1| conserved hypothetical protein [Teredinibacter turnerae T7901]
          Length = 106

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 71/107 (66%), Gaps = 1/107 (0%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M  +  ++ Q +E+Q KM++M+E + + E +G AG G+V+V + G++ +  V ID SLL 
Sbjct: 1   MKGLGDLMKQAQEMQEKMQRMQEDLANQEVQGEAGAGLVAVIMTGRHDVKKVTIDPSLLS 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED  E+LEDL+ AA +DA +++ED    K  ++T G+ +PPG K PF
Sbjct: 61  EDK-EMLEDLLAAAVNDAVRRVEDANKQKMSDLTGGMQMPPGFKMPF 106


>gi|161524620|ref|YP_001579632.1| hypothetical protein Bmul_1447 [Burkholderia multivorans ATCC
           17616]
 gi|189350624|ref|YP_001946252.1| hypothetical protein BMULJ_01796 [Burkholderia multivorans ATCC
           17616]
 gi|238687036|sp|A9AGY0|Y1796_BURM1 RecName: Full=UPF0133 protein Bmul_1447/BMULJ_01796
 gi|160342049|gb|ABX15135.1| conserved hypothetical protein [Burkholderia multivorans ATCC
           17616]
 gi|189334646|dbj|BAG43716.1| conserved hypothetical protein [Burkholderia multivorans ATCC
           17616]
          Length = 108

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 43/105 (40%), Positives = 65/105 (61%), Gaps = 1/105 (0%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           N+  ++ Q +++Q  M KM+E +  +E EG +G G+V V +  +N +  V ID SLL +D
Sbjct: 5   NLAGLMKQAQQMQENMRKMQEQLAQIEVEGQSGAGLVKVTMTCRNEVRRVSIDPSLLADD 64

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
             ++LEDL+ AA +DA +K E     K   +T GLP+PPG K PF
Sbjct: 65  K-DMLEDLVAAAFNDAVRKAEATSQEKMSGMTSGLPLPPGFKLPF 108


>gi|94500850|ref|ZP_01307376.1| hypothetical protein RED65_11440 [Oceanobacter sp. RED65]
 gi|94426969|gb|EAT11951.1| hypothetical protein RED65_11440 [Oceanobacter sp. RED65]
          Length = 108

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 46/107 (42%), Positives = 71/107 (66%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M NIMK   Q +++Q KM+K +E + + E  G +GGG+V V + G++ +  V +D SL+ 
Sbjct: 6   MGNIMK---QAQKMQEKMQKAQEELANAETTGESGGGLVKVVMTGRHDVKSVNLDDSLME 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED  EI+EDL+ AA +DA +KIE+    K   +T+G+ +PPG+K PF
Sbjct: 63  EDK-EIIEDLLAAAVNDAVRKIEETSQEKMSSMTQGMGLPPGMKLPF 108


>gi|117920888|ref|YP_870080.1| hypothetical protein Shewana3_2445 [Shewanella sp. ANA-3]
 gi|117613220|gb|ABK48674.1| conserved hypothetical protein 103 [Shewanella sp. ANA-3]
          Length = 111

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 47/107 (43%), Positives = 70/107 (65%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+MK   Q + +Q +M KM+E I  +E  G +G G+V V + G + +  V+ID SL+ 
Sbjct: 9   MGNLMK---QAQMMQERMAKMQEEIARMEMVGESGAGLVKVTMTGSHTVGKVEIDPSLM- 64

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ E+LEDLI AA +DA ++IE+    K  E+T G+ +PPG+K PF
Sbjct: 65  EDDKEMLEDLIAAACNDAARRIEENQKAKMAEVTGGMQLPPGMKMPF 111


>gi|330993789|ref|ZP_08317721.1| UPF0133 protein [Gluconacetobacter sp. SXCC-1]
 gi|329759057|gb|EGG75569.1| UPF0133 protein [Gluconacetobacter sp. SXCC-1]
          Length = 107

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 71/107 (66%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+  ++ Q  ++Q +ME+M+  + ++  EG+AG GMV++ +NGK  +  + ID  L  
Sbjct: 1   MKNLAGLMKQATQMQARMEEMQAKLETMTIEGSAGAGMVTLTMNGKGDMKSITIDPKLAD 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
              +E+L+DLI+AA +DA KK++   + + +++T GL +P G+KFPF
Sbjct: 61  PAEMEMLQDLILAACADARKKLDASASEEMKKVTGGLSLPGGMKFPF 107


>gi|115351815|ref|YP_773654.1| hypothetical protein Bamb_1764 [Burkholderia ambifaria AMMD]
 gi|134295857|ref|YP_001119592.1| hypothetical protein Bcep1808_1753 [Burkholderia vietnamiensis G4]
 gi|170703766|ref|ZP_02894479.1| conserved hypothetical protein [Burkholderia ambifaria IOP40-10]
 gi|171322542|ref|ZP_02911331.1| conserved hypothetical protein [Burkholderia ambifaria MEX-5]
 gi|172060786|ref|YP_001808438.1| hypothetical protein BamMC406_1737 [Burkholderia ambifaria MC40-6]
 gi|122323079|sp|Q0BEV3|Y1764_BURCM RecName: Full=UPF0133 protein Bamb_1764
 gi|166234798|sp|A4JEQ4|Y1753_BURVG RecName: Full=UPF0133 protein Bcep1808_1753
 gi|238689150|sp|B1YRE8|Y1737_BURA4 RecName: Full=UPF0133 protein BamMC406_1737
 gi|115281803|gb|ABI87320.1| conserved hypothetical protein 103 [Burkholderia ambifaria AMMD]
 gi|134139014|gb|ABO54757.1| conserved hypothetical protein 103 [Burkholderia vietnamiensis G4]
 gi|170131327|gb|EDS99941.1| conserved hypothetical protein [Burkholderia ambifaria IOP40-10]
 gi|171092123|gb|EDT37535.1| conserved hypothetical protein [Burkholderia ambifaria MEX-5]
 gi|171993303|gb|ACB64222.1| conserved hypothetical protein [Burkholderia ambifaria MC40-6]
          Length = 108

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 43/105 (40%), Positives = 66/105 (62%), Gaps = 1/105 (0%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           N+  ++ Q +++Q  M+KM+E +  +E EG +G G+V V +  +N +  V ID SLL +D
Sbjct: 5   NLAGLMKQAQQMQENMKKMQEQLAQIEVEGQSGAGLVKVTMTCRNEVRRVAIDPSLLADD 64

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
             ++LEDL+ AA +DA +K E     K   +T GLP+PPG K PF
Sbjct: 65  K-DMLEDLVAAAFNDAVRKAEATSQEKMSGMTSGLPLPPGFKLPF 108


>gi|238919041|ref|YP_002932555.1| hypothetical protein NT01EI_1109 [Edwardsiella ictaluri 93-146]
 gi|259645722|sp|C5BCZ9|Y1109_EDWI9 RecName: Full=UPF0133 protein NT01EI_1109
 gi|238868609|gb|ACR68320.1| conserved hypothetical protein [Edwardsiella ictaluri 93-146]
          Length = 109

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 69/107 (64%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           + N+MK   Q +++Q KM+KM+E I  +E  G +G G+V V ING +    V+ID SL+ 
Sbjct: 7   LGNLMK---QAQQMQEKMQKMQEEIALVEVTGESGAGLVKVTINGAHNCRRVEIDPSLM- 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ E+LEDL+ AA +DA ++IE     +   ++ G+ +PPG K PF
Sbjct: 63  EDDKEMLEDLVAAAFNDAARRIESEQKERMASVSSGMQLPPGFKMPF 109


>gi|170722749|ref|YP_001750437.1| hypothetical protein PputW619_3586 [Pseudomonas putida W619]
 gi|229553900|sp|B1JBZ2|Y3586_PSEPW RecName: Full=UPF0133 protein PputW619_3586
 gi|169760752|gb|ACA74068.1| conserved hypothetical protein [Pseudomonas putida W619]
          Length = 111

 Score = 85.5 bits (210), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 71/109 (65%), Gaps = 5/109 (4%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M+ +MK   Q +++Q KM KM+E + + E  G +GGG+VSV + G++ +  V ID+SL+ 
Sbjct: 6   MAGLMK---QAQQMQEKMAKMQEELANAEVTGQSGGGLVSVVMTGRHDVKRVSIDQSLMS 62

Query: 61  --EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
             ED+ E+LEDLI AA +DA +K+E     K   +T G+ +PPG K PF
Sbjct: 63  TEEDDKEVLEDLIAAALNDAVRKVEQSSQEKMGGMTAGMQLPPGFKMPF 111


>gi|104780940|ref|YP_607438.1| hypothetical protein PSEEN1789 [Pseudomonas entomophila L48]
 gi|122403934|sp|Q1ICI1|Y1789_PSEE4 RecName: Full=UPF0133 protein PSEEN1789
 gi|95109927|emb|CAK14632.1| conserved hypothetical protein [Pseudomonas entomophila L48]
          Length = 111

 Score = 85.5 bits (210), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 71/109 (65%), Gaps = 5/109 (4%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M+ +MK   Q +++Q KM+KM+E + + E  G +GGG+VSV + G++ +  V ID+SL+ 
Sbjct: 6   MAGLMK---QAQQMQEKMQKMQEELANAEVTGQSGGGLVSVVMTGRHDVKRVSIDQSLMS 62

Query: 61  --EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
              D+ E+LEDLI AA +DA +KIE     K   +T G+ +PPG K PF
Sbjct: 63  TDADDKEVLEDLIAAALNDAVRKIEQNSQDKMGSMTAGMQLPPGFKMPF 111


>gi|254506870|ref|ZP_05119009.1| conserved hypothetical protein TIGR00103 [Vibrio parahaemolyticus
           16]
 gi|219550155|gb|EED27141.1| conserved hypothetical protein TIGR00103 [Vibrio parahaemolyticus
           16]
          Length = 109

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 71/107 (66%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M  +MK   Q +++Q +M+K++E I ++E  G +G G+V V I G + +  V+ID SL+ 
Sbjct: 7   MGTLMK---QAQQMQERMQKLQEEIANMEVTGESGAGLVKVTITGSHSVRRVEIDESLM- 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ E+LEDLI AA +DA +++E+    K   +T G+ +PPG+K PF
Sbjct: 63  EDDKEMLEDLIAAAFNDAARRVEETQKEKMAGVTGGMQLPPGMKMPF 109


>gi|290474636|ref|YP_003467516.1| hypothetical protein XBJ1_1610 [Xenorhabdus bovienii SS-2004]
 gi|289173949|emb|CBJ80736.1| conserved hypothetical protein [Xenorhabdus bovienii SS-2004]
          Length = 109

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 71/107 (66%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           + N+MK   Q +++Q KM+K++E I +LE  G +G G+V V ING +    V+ID SL+ 
Sbjct: 7   LGNLMK---QAQQMQEKMQKVQEEIANLEVTGESGAGLVKVTINGAHNCRRVEIDPSLM- 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           +D+ ++LEDLI AA +DA ++IE+    K   ++ G+ +PPG K PF
Sbjct: 63  DDDKDMLEDLIAAAFNDAARRIEETQKEKMSGVSNGMQLPPGFKMPF 109


>gi|304395535|ref|ZP_07377418.1| conserved hypothetical protein [Pantoea sp. aB]
 gi|308185943|ref|YP_003930074.1| UPF0133 protein ybaB [Pantoea vagans C9-1]
 gi|304356829|gb|EFM21193.1| conserved hypothetical protein [Pantoea sp. aB]
 gi|308056453|gb|ADO08625.1| UPF0133 protein ybaB [Pantoea vagans C9-1]
          Length = 110

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 70/107 (65%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           + N+MK   Q +++Q KM K++E I ++E  G +G G+V V ING +    V++D SLL 
Sbjct: 8   LGNLMK---QAQQMQDKMAKVQEEIAAIEVTGESGAGLVKVTINGAHNCRRVEVDPSLL- 63

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ ++LEDLI AA +DA ++I++    K   ++ G+ +PPG K PF
Sbjct: 64  EDDKDMLEDLIAAAFNDAARRIDETQKEKMASVSSGMQLPPGFKMPF 110


>gi|121997040|ref|YP_001001827.1| hypothetical protein Hhal_0231 [Halorhodospira halophila SL1]
 gi|166227713|sp|A1WTL3|Y231_HALHL RecName: Full=UPF0133 protein Hhal_0231
 gi|121588445|gb|ABM61025.1| conserved hypothetical protein 103 [Halorhodospira halophila SL1]
          Length = 107

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 70/107 (65%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           + NIMK   Q +++Q  M+K +E I ++E  G AG GMV V + G+N +  V+ID SL F
Sbjct: 5   LGNIMK---QAQKMQEDMQKAQEEIAAMEVSGEAGAGMVKVTMTGRNEVRKVEIDPSL-F 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ E++EDL+ AA +DA +K++     +   + EG+ +PPG+K PF
Sbjct: 61  EDDREMVEDLVAAAVNDAVQKVQRESQERMSGMAEGMGLPPGMKLPF 107


>gi|307544646|ref|YP_003897125.1| hypothetical protein HELO_2056 [Halomonas elongata DSM 2581]
 gi|307216670|emb|CBV41940.1| K09747 hypothetical protein [Halomonas elongata DSM 2581]
          Length = 123

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 46/107 (42%), Positives = 68/107 (63%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+MK   Q +E+Q KM+K +E +   E +G AG GM+ V +NG++ +  V ID S++ 
Sbjct: 21  MGNLMK---QAQEMQDKMQKAQEEVAKAEVQGEAGAGMIKVTMNGRHDVISVDIDPSVME 77

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED  E+LEDL+ AA +DA +K+E       +E T G+ +PPG K PF
Sbjct: 78  EDK-ELLEDLLAAAVNDAVRKVEASSKELMEEATAGMNLPPGFKMPF 123


>gi|288959354|ref|YP_003449695.1| hypothetical protein AZL_025130 [Azospirillum sp. B510]
 gi|288911662|dbj|BAI73151.1| hypothetical protein AZL_025130 [Azospirillum sp. B510]
          Length = 107

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 63/88 (71%)

Query: 20  KMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAH 79
           +M+ S+  +E  G +  GMV V +NGK+ +  VK+D+S++  ++VE+LEDLI+AA +DA 
Sbjct: 20  EMQASLEQVEMTGQSAAGMVVVTVNGKSEMKKVKLDKSVVDPEDVEVLEDLIVAAFNDAK 79

Query: 80  KKIEDLVATKTQEITEGLPIPPGLKFPF 107
           +K+E  VA +T ++  GL +PPG+K PF
Sbjct: 80  RKVEQHVAEETSKMMGGLKLPPGIKLPF 107


>gi|90580018|ref|ZP_01235826.1| hypothetical protein VAS14_17571 [Vibrio angustum S14]
 gi|90438903|gb|EAS64086.1| hypothetical protein VAS14_17571 [Vibrio angustum S14]
          Length = 109

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 70/107 (65%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+MK   Q +++Q +M+KM+E + ++E  G +G G+V V I G + +  V+ID SL+ 
Sbjct: 7   MGNMMK---QAQQMQERMQKMQEEVANMEVTGESGAGLVKVTITGSHSVRRVEIDESLM- 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ ++LEDLI AA +DA ++IE+    K   +T G+ +P G K PF
Sbjct: 63  EDDKDMLEDLIAAAFNDAARRIEEAQKEKMASVTGGMNLPAGFKLPF 109


>gi|146310612|ref|YP_001175686.1| hypothetical protein Ent638_0951 [Enterobacter sp. 638]
 gi|166918998|sp|A4W7F5|Y951_ENT38 RecName: Full=UPF0133 protein Ent638_0951
 gi|145317488|gb|ABP59635.1| conserved hypothetical protein 103 [Enterobacter sp. 638]
          Length = 110

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 42/98 (42%), Positives = 64/98 (65%), Gaps = 1/98 (1%)

Query: 10  QFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILED 69
           Q +++Q KM+K +E I  LE  G +G G+V V ING +    V+ID SLL ED+ ++LED
Sbjct: 14  QAQQMQEKMQKAQEEIAQLEVTGESGAGLVKVTINGAHNCRRVEIDPSLL-EDDKDMLED 72

Query: 70  LIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           L+ AA +DA ++I++    K   ++ G+ +PPG K PF
Sbjct: 73  LVAAAFNDAARRIDETQKEKMASVSSGMQLPPGFKMPF 110


>gi|78066596|ref|YP_369365.1| hypothetical protein Bcep18194_A5127 [Burkholderia sp. 383]
 gi|107028995|ref|YP_626090.1| hypothetical protein Bcen_6253 [Burkholderia cenocepacia AU 1054]
 gi|116689847|ref|YP_835470.1| hypothetical protein Bcen2424_1826 [Burkholderia cenocepacia
           HI2424]
 gi|170733186|ref|YP_001765133.1| hypothetical protein Bcenmc03_1850 [Burkholderia cenocepacia MC0-3]
 gi|206560261|ref|YP_002231025.1| hypothetical protein BCAL1898 [Burkholderia cenocepacia J2315]
 gi|122977677|sp|Q1BGY8|Y6253_BURCA RecName: Full=UPF0133 protein Bcen_6253
 gi|123568318|sp|Q39FP5|Y5127_BURS3 RecName: Full=UPF0133 protein Bcep18194_A5127
 gi|166219530|sp|A0K7V0|Y1826_BURCH RecName: Full=UPF0133 protein Bcen2424_1826
 gi|238688542|sp|B1JTA6|Y1850_BURCC RecName: Full=UPF0133 protein Bcenmc03_1850
 gi|238693092|sp|B4EAY3|Y1861_BURCJ RecName: Full=UPF0133 protein BceJ2315_18610
 gi|77967341|gb|ABB08721.1| conserved hypothetical protein [Burkholderia sp. 383]
 gi|105898159|gb|ABF81117.1| conserved hypothetical protein 103 [Burkholderia cenocepacia AU
           1054]
 gi|116647936|gb|ABK08577.1| conserved hypothetical protein 103 [Burkholderia cenocepacia
           HI2424]
 gi|169816428|gb|ACA91011.1| conserved hypothetical protein [Burkholderia cenocepacia MC0-3]
 gi|198036302|emb|CAR52198.1| conserved hypothetical protein [Burkholderia cenocepacia J2315]
          Length = 108

 Score = 84.3 bits (207), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 43/105 (40%), Positives = 66/105 (62%), Gaps = 1/105 (0%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           N+  ++ Q +++Q  M+KM+E +  +E EG +G G+V V +  +N +  V ID SLL +D
Sbjct: 5   NLAGLMKQAQQMQENMKKMQEQLALIEVEGQSGAGLVKVTMTCRNEVRRVSIDPSLLADD 64

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
             ++LEDL+ AA +DA +K E     K   +T GLP+PPG K PF
Sbjct: 65  K-DMLEDLVAAAFNDAVRKAEATSQEKMSGMTSGLPLPPGFKLPF 108


>gi|73541799|ref|YP_296319.1| hypothetical protein Reut_A2111 [Ralstonia eutropha JMP134]
 gi|94311066|ref|YP_584276.1| hypothetical protein Rmet_2128 [Cupriavidus metallidurans CH34]
 gi|123624673|sp|Q46ZF8|Y2111_RALEJ RecName: Full=UPF0133 protein Reut_A2111
 gi|166227524|sp|Q1LLG9|Y2128_RALME RecName: Full=UPF0133 protein Rmet_2128
 gi|72119212|gb|AAZ61475.1| Conserved hypothetical protein 103 [Ralstonia eutropha JMP134]
 gi|93354918|gb|ABF09007.1| conserved hypothetical protein [Cupriavidus metallidurans CH34]
          Length = 108

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 43/101 (42%), Positives = 64/101 (63%), Gaps = 1/101 (0%)

Query: 7   MVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEI 66
           ++ Q +++Q  M+KM+E +  +E EG +G G+V V +  KN +  V ID SLL +D  ++
Sbjct: 9   LMKQAQQMQENMKKMQEQLAQIEVEGQSGAGLVKVVMTCKNDVKRVTIDPSLLADDK-DL 67

Query: 67  LEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           LEDL+ AA +DA +K E     K   +T GLP+PPG K PF
Sbjct: 68  LEDLVAAAFNDAVRKAEATTQEKMGSMTSGLPLPPGFKLPF 108


>gi|89073485|ref|ZP_01160008.1| hypothetical protein SKA34_02554 [Photobacterium sp. SKA34]
 gi|89050749|gb|EAR56230.1| hypothetical protein SKA34_02554 [Photobacterium sp. SKA34]
          Length = 109

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 70/107 (65%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+MK   Q +++Q +M+KM+E + ++E  G +G G+V V I G + +  V+ID SL+ 
Sbjct: 7   MGNMMK---QAQQMQERMQKMQEEVANMEVTGESGAGLVKVTITGSHSVRRVEIDESLM- 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ ++LEDLI AA +DA ++IE+    K   +T G+ +P G K PF
Sbjct: 63  EDDKDMLEDLIAAAFNDAARRIEETQKEKMASVTGGMNLPAGFKMPF 109


>gi|330445438|ref|ZP_08309090.1| conserved DNA-binding protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328489629|dbj|GAA03587.1| conserved DNA-binding protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 109

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 69/107 (64%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+MK   Q +++Q +M+KM+E I ++E  G +G G+V V I G + +  V ID SL+ 
Sbjct: 7   MGNMMK---QAQQMQERMQKMQEEIANMEVTGESGAGLVKVTITGSHSVRRVDIDESLM- 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ ++LEDLI AA +DA ++IE+    K   +T G+ +P G K PF
Sbjct: 63  EDDKDMLEDLIAAAFNDAARRIEEAQKEKMASVTGGMNLPAGFKMPF 109


>gi|209886654|ref|YP_002290511.1| hypothetical protein OCAR_7544 [Oligotropha carboxidovorans OM5]
 gi|229890248|sp|B6JJQ2|Y7544_OLICO RecName: Full=UPF0133 protein OCAR_7544
 gi|209874850|gb|ACI94646.1| conserved hypothetical protein [Oligotropha carboxidovorans OM5]
          Length = 105

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 67/100 (67%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M++ + M+ Q  ++Q KM++M+E +  +E EG+AGG MV+VR+  K  L  V ID SL+ 
Sbjct: 1   MADFLGMMKQAAQLQSKMKEMQEQLDQVEVEGSAGGSMVTVRMTAKMELKAVSIDPSLMK 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
            +  E+LEDL++AA +DA +K E+ +  + + +T GL IP
Sbjct: 61  PEEREVLEDLLVAAQNDARRKAEEAMQERMKALTGGLSIP 100


>gi|269103101|ref|ZP_06155798.1| hypothetical protein VDA_002527 [Photobacterium damselae subsp.
           damselae CIP 102761]
 gi|268162999|gb|EEZ41495.1| hypothetical protein VDA_002527 [Photobacterium damselae subsp.
           damselae CIP 102761]
          Length = 109

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 70/107 (65%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M+N+MK   Q +++Q +M+KM+E I ++E  G +G G+V V I G + +  V ID SL+ 
Sbjct: 7   MANMMK---QAQQMQERMQKMQEEIANMEVTGESGAGLVKVTITGNHSVRRVNIDESLM- 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ ++LEDLI AA +DA ++IE+    K   +T G+ +P G K PF
Sbjct: 63  EDDKDMLEDLIAAAFNDAARRIEEAQKEKMAGVTGGMNLPAGFKMPF 109


>gi|329908503|ref|ZP_08274877.1| hypothetical protein IMCC9480_3615 [Oxalobacteraceae bacterium
           IMCC9480]
 gi|327546694|gb|EGF31646.1| hypothetical protein IMCC9480_3615 [Oxalobacteraceae bacterium
           IMCC9480]
          Length = 108

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 43/101 (42%), Positives = 65/101 (64%), Gaps = 1/101 (0%)

Query: 7   MVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEI 66
           M+ + + +Q  M+KM++ +  +  EG +G G+V V ++ KN +  V ID SLL +D  ++
Sbjct: 9   MMKKVQSMQDDMKKMQDQLALINVEGESGAGLVKVTMSCKNDVKRVVIDPSLLADDK-DM 67

Query: 67  LEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           LEDL+ AA +DA +K E L A K   +T G+PIPPG K PF
Sbjct: 68  LEDLVAAAFNDAVRKAEALTAEKMSGVTAGMPIPPGFKMPF 108


>gi|170692334|ref|ZP_02883497.1| conserved hypothetical protein [Burkholderia graminis C4D1M]
 gi|186475717|ref|YP_001857187.1| hypothetical protein Bphy_0952 [Burkholderia phymatum STM815]
 gi|307729577|ref|YP_003906801.1| hypothetical protein BC1003_1540 [Burkholderia sp. CCGE1003]
 gi|238691284|sp|B2JG59|Y952_BURP8 RecName: Full=UPF0133 protein Bphy_0952
 gi|170142764|gb|EDT10929.1| conserved hypothetical protein [Burkholderia graminis C4D1M]
 gi|184192176|gb|ACC70141.1| conserved hypothetical protein [Burkholderia phymatum STM815]
 gi|307584112|gb|ADN57510.1| Uncharacterized protein family UPF0133 [Burkholderia sp. CCGE1003]
          Length = 108

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 43/98 (43%), Positives = 62/98 (63%), Gaps = 1/98 (1%)

Query: 10  QFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILED 69
           Q +++Q  M+KM+E +  +E EG +G G+V V +  KN +  V ID SLL +D  ++LED
Sbjct: 12  QAQQMQENMKKMQEQLAQIEVEGQSGAGLVKVTMTCKNDVRRVSIDPSLLADDK-DMLED 70

Query: 70  LIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           L+ AA +DA +K E     K   +T GLP+PPG K PF
Sbjct: 71  LVAAAFNDAVRKAEATAQEKMGGMTSGLPLPPGFKLPF 108


>gi|296116791|ref|ZP_06835397.1| hypothetical protein GXY_13338 [Gluconacetobacter hansenii ATCC
           23769]
 gi|295976592|gb|EFG83364.1| hypothetical protein GXY_13338 [Gluconacetobacter hansenii ATCC
           23769]
          Length = 107

 Score = 84.0 bits (206), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 38/107 (35%), Positives = 71/107 (66%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+  ++ Q  ++Q +ME+M+  + ++  EG++G GMV + +NGK  +  ++ID  L  
Sbjct: 1   MKNLAGLMKQATQMQARMEEMQAKLEAMVIEGSSGAGMVQITLNGKGDMKAIRIDPKLAD 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            + +++L+DLI+AA SDA  K++   + + +++T GL +P G+KFPF
Sbjct: 61  PEEMDMLQDLILAACSDARAKLDATASEEMKKVTGGLNLPGGMKFPF 107


>gi|114770075|ref|ZP_01447613.1| hypothetical protein OM2255_10580 [alpha proteobacterium HTCC2255]
 gi|114548912|gb|EAU51795.1| hypothetical protein OM2255_10580 [alpha proteobacterium HTCC2255]
          Length = 114

 Score = 83.6 bits (205), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 68/107 (63%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           + ++  M+ + KE+Q K+E+ +  ++ +E +G AG G+V+ ++NGK  +  + ID+S+  
Sbjct: 8   LGDMAGMMAKAKEMQSKVEEAQAKVSEIEVDGEAGAGLVTCKVNGKGEVKALNIDKSIFS 67

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            D+ EI+EDLIIAA  D   K +     +  +ITEGL +P G+K PF
Sbjct: 68  PDDKEIVEDLIIAALKDGKDKADIKAKAEMGKITEGLNLPAGMKLPF 114


>gi|209522075|ref|ZP_03270728.1| conserved hypothetical protein [Burkholderia sp. H160]
 gi|295676459|ref|YP_003604983.1| hypothetical protein BC1002_1396 [Burkholderia sp. CCGE1002]
 gi|209497484|gb|EDZ97686.1| conserved hypothetical protein [Burkholderia sp. H160]
 gi|295436302|gb|ADG15472.1| conserved hypothetical protein [Burkholderia sp. CCGE1002]
          Length = 108

 Score = 83.6 bits (205), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 43/98 (43%), Positives = 62/98 (63%), Gaps = 1/98 (1%)

Query: 10  QFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILED 69
           Q +++Q  M+KM+E +  +E EG +G G+V V +  KN +  V ID SLL +D  ++LED
Sbjct: 12  QAQQMQENMKKMQEQLAQIEVEGQSGAGLVKVTMTCKNDVRRVSIDPSLLADDK-DMLED 70

Query: 70  LIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           L+ AA +DA +K E     K   +T GLP+PPG K PF
Sbjct: 71  LVAAAFNDAVRKAEATAQEKMGGMTAGLPLPPGFKLPF 108


>gi|226226519|ref|YP_002760625.1| hypothetical protein GAU_1113 [Gemmatimonas aurantiaca T-27]
 gi|259645724|sp|C1A7E5|Y1113_GEMAT RecName: Full=UPF0133 protein GAU_1113
 gi|226089710|dbj|BAH38155.1| hypothetical protein [Gemmatimonas aurantiaca T-27]
          Length = 104

 Score = 83.6 bits (205), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 70/105 (66%), Gaps = 2/105 (1%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           ++ KM+GQFK++QG+M+ M+E ++       AGGG+V+  ++GK  L  +K+D S++   
Sbjct: 2   DLFKMLGQFKDMQGRMQTMQEEMSQRTFSALAGGGLVTADVDGKMQLKRIKLDASVVNPG 61

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ++E+LEDLI+ A ++A KK  D +  + Q++T G+ +P   K PF
Sbjct: 62  DIEMLEDLIVVAVAEAQKKAADAMQMELQKVTGGIDLP--FKLPF 104


>gi|152980834|ref|YP_001354019.1| hypothetical protein mma_2329 [Janthinobacterium sp. Marseille]
 gi|166227716|sp|A6T0H2|Y2329_JANMA RecName: Full=UPF0133 protein mma_2329
 gi|151280911|gb|ABR89321.1| Uncharacterized conserved protein [Janthinobacterium sp. Marseille]
          Length = 108

 Score = 83.6 bits (205), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 42/98 (42%), Positives = 63/98 (64%), Gaps = 1/98 (1%)

Query: 10  QFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILED 69
           Q + +Q  M+KM++ + S+E EG +G G+V V ++ KN +  V ID SLL +D  ++LED
Sbjct: 12  QAQAMQDNMKKMQDQLASIEVEGQSGAGLVKVVMSCKNDVKRVSIDPSLLADDK-DMLED 70

Query: 70  LIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           L+ AA +DA +K E     K   +T G+P+PPG K PF
Sbjct: 71  LVAAAFNDAVRKAEATSQEKMSGVTAGMPLPPGFKMPF 108


>gi|152978671|ref|YP_001344300.1| hypothetical protein Asuc_0997 [Actinobacillus succinogenes 130Z]
 gi|171704262|sp|A6VN18|Y997_ACTSZ RecName: Full=UPF0133 protein Asuc_0997
 gi|150840394|gb|ABR74365.1| conserved hypothetical protein 103 [Actinobacillus succinogenes
           130Z]
          Length = 109

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 40/98 (40%), Positives = 64/98 (65%), Gaps = 1/98 (1%)

Query: 10  QFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILED 69
           Q +++Q +M+KM++ I  LE  G +G G+V + +NG +    ++ID SL+ ED  E+LED
Sbjct: 13  QAQQMQERMQKMQDEIAQLEVTGESGAGLVKITLNGAHNCRRIEIDPSLMEEDK-EMLED 71

Query: 70  LIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           LI AA +DA ++ E++   K   +T G+ +PPG K PF
Sbjct: 72  LIAAAFNDAVRRAEEMQKEKMASVTAGMSLPPGFKMPF 109


>gi|301301625|ref|ZP_07207760.1| hypothetical protein HMPREF9347_00182 [Escherichia coli MS 124-1]
 gi|300843122|gb|EFK70882.1| hypothetical protein HMPREF9347_00182 [Escherichia coli MS 124-1]
          Length = 89

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 42/90 (46%), Positives = 59/90 (65%), Gaps = 1/90 (1%)

Query: 18  MEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSD 77
           M+KM+E I  LE  G +G G+V V ING +    V+ID SLL ED+ E+LEDL+ AA +D
Sbjct: 1   MQKMQEEIAQLEVTGESGAGLVKVTINGAHNCRRVEIDPSLL-EDDKEMLEDLVAAAFND 59

Query: 78  AHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           A ++IE+    K   ++ G+ +PPG K PF
Sbjct: 60  AARRIEETQKEKMASVSSGMQLPPGFKMPF 89


>gi|152983698|ref|YP_001349154.1| hypothetical protein PSPA7_3800 [Pseudomonas aeruginosa PA7]
 gi|150958856|gb|ABR80881.1| conserved hypothetical protein [Pseudomonas aeruginosa PA7]
          Length = 111

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 50/112 (44%), Positives = 70/112 (62%), Gaps = 6/112 (5%)

Query: 1   MSNIMK--MVG---QFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKID 55
           M N+MK  M G   Q +++Q KM+KM+E + + E  G +G G+VSV + G++ +  V +D
Sbjct: 1   MKNMMKGGMAGLMKQAQQMQEKMQKMQEELANAEVTGQSGAGLVSVVMTGRHDVKRVSLD 60

Query: 56  RSLLFEDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            SL+ ED  EILEDLI AA +DA +KIE     K    T G+ +PPG K PF
Sbjct: 61  DSLMQEDK-EILEDLIAAAVNDAVRKIEQNNQEKMSGFTSGMQLPPGFKMPF 111


>gi|259909221|ref|YP_002649577.1| hypothetical protein EpC_25860 [Erwinia pyrifoliae Ep1/96]
 gi|292487503|ref|YP_003530375.1| hypothetical protein EAMY_1017 [Erwinia amylovora CFBP1430]
 gi|292898744|ref|YP_003538113.1| hypothetical protein EAM_1025 [Erwinia amylovora ATCC 49946]
 gi|224964843|emb|CAX56365.1| conserved uncharacterized protein [Erwinia pyrifoliae Ep1/96]
 gi|283479271|emb|CAY75187.1| UPF0133 protein ybaB [Erwinia pyrifoliae DSM 12163]
 gi|291198592|emb|CBJ45700.1| conserved hypothetical protein [Erwinia amylovora ATCC 49946]
 gi|291552922|emb|CBA19967.1| UPF0133 protein ybaB [Erwinia amylovora CFBP1430]
 gi|310766875|gb|ADP11825.1| conserved uncharacterized protein [Erwinia sp. Ejp617]
 gi|312171608|emb|CBX79866.1| UPF0133 protein ybaB [Erwinia amylovora ATCC BAA-2158]
          Length = 109

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 69/107 (64%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           + N+MK   Q +++Q KM +++E I ++E  G +G G+V V ING +    V++D SLL 
Sbjct: 7   LGNLMK---QAQQMQDKMAQVQEEIAAMEVTGESGAGLVKVTINGSHSCRRVEVDPSLL- 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ ++LEDL+ AA +DA ++I +    K   ++ G+ +PPG K PF
Sbjct: 63  EDDKDMLEDLVAAAFNDAARRIAEAQKEKMATVSNGMSLPPGFKMPF 109


>gi|323526148|ref|YP_004228301.1| hypothetical protein BC1001_1808 [Burkholderia sp. CCGE1001]
 gi|323383150|gb|ADX55241.1| Uncharacterized protein family UPF0133 [Burkholderia sp. CCGE1001]
          Length = 108

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 42/98 (42%), Positives = 62/98 (63%), Gaps = 1/98 (1%)

Query: 10  QFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILED 69
           Q +++Q  M+KM+E +  +E EG +G G+V + +  KN +  V ID SLL +D  ++LED
Sbjct: 12  QAQQMQENMKKMQEQLAQIEVEGQSGAGLVKITMTCKNDVRRVSIDPSLLADDK-DMLED 70

Query: 70  LIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           L+ AA +DA +K E     K   +T GLP+PPG K PF
Sbjct: 71  LVAAAFNDAVRKAEATAQEKMGGMTSGLPLPPGFKLPF 108


>gi|238027057|ref|YP_002911288.1| hypothetical protein bglu_1g14360 [Burkholderia glumae BGR1]
 gi|330817181|ref|YP_004360886.1| hypothetical protein bgla_1g23030 [Burkholderia gladioli BSR3]
 gi|237876251|gb|ACR28584.1| Hypothetical protein bglu_1g14360 [Burkholderia glumae BGR1]
 gi|327369574|gb|AEA60930.1| hypothetical protein bgla_1g23030 [Burkholderia gladioli BSR3]
          Length = 108

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 43/101 (42%), Positives = 64/101 (63%), Gaps = 1/101 (0%)

Query: 7   MVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEI 66
           ++ Q +++Q  M+KM+E +  +E EG +G G+V V +  KN +  V ID SLL +D  ++
Sbjct: 9   LMKQAQQMQENMKKMQEQLALIEVEGQSGAGLVKVTMTCKNEVRRVAIDPSLLADDK-DM 67

Query: 67  LEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           LEDL+ AA +DA +K E     K   +T GLP+PPG K PF
Sbjct: 68  LEDLVAAAFNDAVRKAEATSQEKMSGMTSGLPLPPGFKLPF 108


>gi|312796076|ref|YP_004028998.1| transcription regulator [Burkholderia rhizoxinica HKI 454]
 gi|312167851|emb|CBW74854.1| Hypothetical transcriptional regulatory protein [Burkholderia
           rhizoxinica HKI 454]
          Length = 133

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 42/101 (41%), Positives = 64/101 (63%), Gaps = 1/101 (0%)

Query: 7   MVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEI 66
           ++ Q +++Q  M+KM+E +  +E EG +G G+V V +  KN +  V ID SLL +D  ++
Sbjct: 34  LMKQAQQMQENMKKMQEQLAQIEIEGQSGAGLVKVTMTCKNEVRRVTIDPSLLADDK-DM 92

Query: 67  LEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           LEDL+ AA +DA +K E     +   +T GLP+PPG K PF
Sbjct: 93  LEDLVAAAFNDAVRKAEATAQERMSGMTAGLPLPPGFKLPF 133


>gi|254248058|ref|ZP_04941379.1| conserved hypothetical protein [Burkholderia cenocepacia PC184]
 gi|124872834|gb|EAY64550.1| conserved hypothetical protein [Burkholderia cenocepacia PC184]
          Length = 120

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 43/105 (40%), Positives = 65/105 (61%), Gaps = 1/105 (0%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           N+  ++ Q +++Q  M KM+E +  +E EG +G G+V V +  +N +  V ID SLL +D
Sbjct: 17  NLAGLMKQAQQMQEHMMKMQEQLALIEVEGQSGAGLVKVTMTCRNEVRRVSIDPSLLADD 76

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
             ++LEDL+ AA +DA +K E     K   +T GLP+PPG K PF
Sbjct: 77  K-DMLEDLVAAAFNDAVRKAEATSQEKMSGMTSGLPLPPGFKLPF 120


>gi|194290031|ref|YP_002005938.1| hypothetical protein RALTA_A1934 [Cupriavidus taiwanensis LMG
           19424]
 gi|238692739|sp|B3R1M7|Y1934_CUPTR RecName: Full=UPF0133 protein RALTA_A1934
 gi|193223866|emb|CAQ69875.1| conserved hypothetical protein [Cupriavidus taiwanensis LMG 19424]
          Length = 110

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 65/102 (63%), Gaps = 1/102 (0%)

Query: 7   MVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFE-DNVE 65
           ++ Q +++Q  M+KM+E +  +E EG +G G+V V +  KN +  V ID SLL E ++ +
Sbjct: 9   LMKQAQQMQENMKKMQEQLAQIEVEGQSGAGLVKVVMTCKNDVKRVTIDPSLLAEGEDKD 68

Query: 66  ILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           +LEDL+ AA +DA +K E     K   +T GLP+PPG K PF
Sbjct: 69  LLEDLVAAAFNDAVRKAEATTQEKMGSMTSGLPLPPGFKLPF 110


>gi|289209015|ref|YP_003461081.1| hypothetical protein TK90_1854 [Thioalkalivibrio sp. K90mix]
 gi|288944646|gb|ADC72345.1| conserved hypothetical protein [Thioalkalivibrio sp. K90mix]
          Length = 108

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 42/98 (42%), Positives = 66/98 (67%), Gaps = 1/98 (1%)

Query: 10  QFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILED 69
           Q +++Q  M+KM+  +  +E EG AGGG+VSV + GK  +  VKID SLL ED+ +++ED
Sbjct: 12  QAQKMQEDMQKMQAELAEMEIEGQAGGGLVSVLMTGKYAVRRVKIDPSLL-EDDRDMIED 70

Query: 70  LIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           L+ AA +DA +K+E     +   +T+G+ +P G+K PF
Sbjct: 71  LVAAAINDAVQKVESTTQERMGSLTQGMGLPAGMKLPF 108


>gi|313675618|ref|YP_004053614.1| hypothetical protein Ftrac_1516 [Marivirga tractuosa DSM 4126]
 gi|312942316|gb|ADR21506.1| Uncharacterized protein family UPF0133 [Marivirga tractuosa DSM
           4126]
          Length = 109

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 42/103 (40%), Positives = 72/103 (69%), Gaps = 1/103 (0%)

Query: 4   IMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDN 63
           +MKM+GQ KE+QGK+++ +E++  + AEG AG GMV  ++NGK  L  V+ID SL+ E++
Sbjct: 1   MMKMMGQIKEVQGKVKQAQENLVHITAEGEAGAGMVKAKVNGKKQLISVEIDDSLVNEND 60

Query: 64  VEILEDLIIAAHSDAHKKIEDLVATKTQEITEG-LPIPPGLKF 105
            E+++DL +AA + A ++++ L   + ++ T+G LP  PG+  
Sbjct: 61  KEMIQDLTVAAVNKAMEEVDVLAKEEMRKATDGALPNIPGMDL 103


>gi|91783456|ref|YP_558662.1| hypothetical protein Bxe_A2360 [Burkholderia xenovorans LB400]
 gi|187923817|ref|YP_001895459.1| hypothetical protein Bphyt_1827 [Burkholderia phytofirmans PsJN]
 gi|296157766|ref|ZP_06840600.1| conserved hypothetical protein [Burkholderia sp. Ch1-1]
 gi|123062918|sp|Q13Z79|Y2072_BURXL RecName: Full=UPF0133 protein Bxeno_A2072
 gi|238689605|sp|B2T3S4|Y1827_BURPP RecName: Full=UPF0133 protein Bphyt_1827
 gi|91687410|gb|ABE30610.1| Conserved hypothetical protein 103 [Burkholderia xenovorans LB400]
 gi|187715011|gb|ACD16235.1| conserved hypothetical protein [Burkholderia phytofirmans PsJN]
 gi|295892012|gb|EFG71796.1| conserved hypothetical protein [Burkholderia sp. Ch1-1]
          Length = 108

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 43/98 (43%), Positives = 62/98 (63%), Gaps = 1/98 (1%)

Query: 10  QFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILED 69
           Q +++Q  M+KM+E +  +E EG +G G+V V +  KN +  V ID SLL +D  ++LED
Sbjct: 12  QAQQMQENMKKMQEQLALIEVEGQSGAGLVKVTMTCKNDVRRVSIDPSLLADDK-DMLED 70

Query: 70  LIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           L+ AA +DA +K E     K   +T GLP+PPG K PF
Sbjct: 71  LVAAAFNDAVRKAEATAQEKMGGMTSGLPLPPGFKLPF 108


>gi|89056368|ref|YP_511819.1| hypothetical protein Jann_3877 [Jannaschia sp. CCS1]
 gi|88865917|gb|ABD56794.1| conserved hypothetical protein 103 [Jannaschia sp. CCS1]
          Length = 114

 Score = 82.8 bits (203), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 67/107 (62%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M ++ KM+ Q +E+QGKM +++E + ++  +G +G G+V      K  LT + ID S+  
Sbjct: 8   MGDMAKMMKQAQELQGKMAEVQEGLATMTVQGESGAGLVKATATAKGELTALDIDPSIFN 67

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           +D  E++EDLI+AA  DA  K +D    + Q++TE L +P G+K PF
Sbjct: 68  KDEKEVVEDLILAAIKDAQSKAQDKHNEEMQKMTEELGLPAGMKMPF 114


>gi|319944208|ref|ZP_08018484.1| hypothetical protein HMPREF0551_1331 [Lautropia mirabilis ATCC
           51599]
 gi|319742503|gb|EFV94914.1| hypothetical protein HMPREF0551_1331 [Lautropia mirabilis ATCC
           51599]
          Length = 108

 Score = 82.8 bits (203), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 39/101 (38%), Positives = 65/101 (64%), Gaps = 1/101 (0%)

Query: 7   MVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEI 66
           ++ Q +++Q  M+K+++S+  +E EG +G G+V V +  +N +  + ID SLL +D  ++
Sbjct: 9   LMKQAQQMQDNMKKVQDSLADIEVEGQSGAGLVKVVMTCRNDVRRIAIDPSLLADDK-DM 67

Query: 67  LEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           LEDL+ AA +DA ++ E     K   +T GLP+PPG K PF
Sbjct: 68  LEDLVAAAVNDALRRAEQTAQEKMSAVTAGLPLPPGFKMPF 108


>gi|107100964|ref|ZP_01364882.1| hypothetical protein PaerPA_01001994 [Pseudomonas aeruginosa PACS2]
          Length = 103

 Score = 82.8 bits (203), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 47/107 (43%), Positives = 68/107 (63%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M+ +MK   Q +++Q KM+KM+E + + E  G +G G+VSV + G++ +  V +D SL+ 
Sbjct: 1   MAGLMK---QAQQMQEKMQKMQEELANAEVTGQSGAGLVSVVMTGRHDVKRVSLDDSLMQ 57

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED  EILEDLI AA +DA +KIE     K    T G+ +PPG K PF
Sbjct: 58  EDK-EILEDLIAAAVNDAVRKIEQNNQEKMSGFTSGMQLPPGFKMPF 103


>gi|15596730|ref|NP_250224.1| hypothetical protein PA1533 [Pseudomonas aeruginosa PAO1]
 gi|116049477|ref|YP_791720.1| hypothetical protein PA14_44620 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|218892511|ref|YP_002441378.1| hypothetical protein PLES_37951 [Pseudomonas aeruginosa LESB58]
 gi|254234635|ref|ZP_04927958.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719]
 gi|254239881|ref|ZP_04933203.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192]
 gi|296390099|ref|ZP_06879574.1| hypothetical protein PaerPAb_18196 [Pseudomonas aeruginosa PAb1]
 gi|313106538|ref|ZP_07792766.1| hypothetical protein PA39016_000460001 [Pseudomonas aeruginosa
           39016]
 gi|21264165|sp|Q9I3I0|Y1533_PSEAE RecName: Full=UPF0133 protein PA1533
 gi|122258585|sp|Q02K16|Y4462_PSEAB RecName: Full=UPF0133 protein PA14_44620
 gi|226706052|sp|B7UVI9|Y3795_PSEA8 RecName: Full=UPF0133 protein PLES_37951
 gi|9947491|gb|AAG04922.1|AE004581_9 conserved hypothetical protein [Pseudomonas aeruginosa PAO1]
 gi|115584698|gb|ABJ10713.1| conserved hypothetical protein [Pseudomonas aeruginosa UCBPP-PA14]
 gi|126166566|gb|EAZ52077.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719]
 gi|126193259|gb|EAZ57322.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192]
 gi|218772737|emb|CAW28522.1| conserved hypothetical protein [Pseudomonas aeruginosa LESB58]
 gi|310879268|gb|EFQ37862.1| hypothetical protein PA39016_000460001 [Pseudomonas aeruginosa
           39016]
          Length = 108

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 47/107 (43%), Positives = 68/107 (63%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M+ +MK   Q +++Q KM+KM+E + + E  G +G G+VSV + G++ +  V +D SL+ 
Sbjct: 6   MAGLMK---QAQQMQEKMQKMQEELANAEVTGQSGAGLVSVVMTGRHDVKRVSLDDSLMQ 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED  EILEDLI AA +DA +KIE     K    T G+ +PPG K PF
Sbjct: 63  EDK-EILEDLIAAAVNDAVRKIEQNNQEKMSGFTSGMQLPPGFKMPF 108


>gi|53719133|ref|YP_108119.1| hypothetical protein BPSL1499 [Burkholderia pseudomallei K96243]
 gi|53723572|ref|YP_103020.1| hypothetical protein BMA1360 [Burkholderia mallei ATCC 23344]
 gi|67639898|ref|ZP_00438727.1| conserved hypothetical protein [Burkholderia mallei GB8 horse 4]
 gi|76810665|ref|YP_333767.1| hypothetical protein BURPS1710b_2372 [Burkholderia pseudomallei
           1710b]
 gi|121598777|ref|YP_993169.1| hypothetical protein BMASAVP1_A1850 [Burkholderia mallei SAVP1]
 gi|124385489|ref|YP_001026055.1| hypothetical protein BMA10229_A0046 [Burkholderia mallei NCTC
           10229]
 gi|126440667|ref|YP_001059240.1| hypothetical protein BURPS668_2205 [Burkholderia pseudomallei 668]
 gi|126450777|ref|YP_001080676.1| hypothetical protein BMA10247_1122 [Burkholderia mallei NCTC 10247]
 gi|126452757|ref|YP_001066507.1| hypothetical protein BURPS1106A_2243 [Burkholderia pseudomallei
           1106a]
 gi|134277948|ref|ZP_01764663.1| conserved hypothetical protein TIGR00103 [Burkholderia pseudomallei
           305]
 gi|167002259|ref|ZP_02268049.1| conserved hypothetical protein TIGR00103 [Burkholderia mallei
           PRL-20]
 gi|167719249|ref|ZP_02402485.1| hypothetical protein BpseD_09502 [Burkholderia pseudomallei DM98]
 gi|167738246|ref|ZP_02411020.1| hypothetical protein Bpse14_09270 [Burkholderia pseudomallei 14]
 gi|167815436|ref|ZP_02447116.1| hypothetical protein Bpse9_09844 [Burkholderia pseudomallei 91]
 gi|167823846|ref|ZP_02455317.1| hypothetical protein Bpseu9_09210 [Burkholderia pseudomallei 9]
 gi|167845387|ref|ZP_02470895.1| hypothetical protein BpseB_08868 [Burkholderia pseudomallei B7210]
 gi|167893930|ref|ZP_02481332.1| hypothetical protein Bpse7_09241 [Burkholderia pseudomallei 7894]
 gi|167902382|ref|ZP_02489587.1| hypothetical protein BpseN_08932 [Burkholderia pseudomallei NCTC
           13177]
 gi|167910622|ref|ZP_02497713.1| hypothetical protein Bpse112_09010 [Burkholderia pseudomallei 112]
 gi|167918647|ref|ZP_02505738.1| hypothetical protein BpseBC_08835 [Burkholderia pseudomallei
           BCC215]
 gi|217421586|ref|ZP_03453090.1| conserved hypothetical protein TIGR00103 [Burkholderia pseudomallei
           576]
 gi|226197496|ref|ZP_03793073.1| conserved hypothetical protein [Burkholderia pseudomallei Pakistan
           9]
 gi|237812564|ref|YP_002897015.1| hypothetical protein GBP346_A2313 [Burkholderia pseudomallei
           MSHR346]
 gi|242317471|ref|ZP_04816487.1| conserved hypothetical protein [Burkholderia pseudomallei 1106b]
 gi|254177916|ref|ZP_04884571.1| conserved hypothetical protein TIGR00103 [Burkholderia mallei ATCC
           10399]
 gi|254179535|ref|ZP_04886134.1| conserved hypothetical protein TIGR00103 [Burkholderia pseudomallei
           1655]
 gi|254189073|ref|ZP_04895584.1| conserved hypothetical protein TIGR00103 [Burkholderia pseudomallei
           Pasteur 52237]
 gi|254198354|ref|ZP_04904776.1| conserved hypothetical protein TIGR00103 [Burkholderia pseudomallei
           S13]
 gi|254199967|ref|ZP_04906333.1| conserved hypothetical protein TIGR00103 [Burkholderia mallei FMH]
 gi|254206300|ref|ZP_04912652.1| conserved hypothetical protein TIGR00103 [Burkholderia mallei JHU]
 gi|254260099|ref|ZP_04951153.1| conserved hypothetical protein [Burkholderia pseudomallei 1710a]
 gi|254297413|ref|ZP_04964866.1| conserved hypothetical protein TIGR00103 [Burkholderia pseudomallei
           406e]
 gi|254358286|ref|ZP_04974559.1| conserved hypothetical protein TIGR00103 [Burkholderia mallei
           2002721280]
 gi|81379866|sp|Q63UU7|Y1499_BURPS RecName: Full=UPF0133 protein BPSL1499
 gi|81604951|sp|Q62JU9|Y1360_BURMA RecName: Full=UPF0133 protein BMA1360
 gi|123598910|sp|Q3JRN6|Y2372_BURP1 RecName: Full=UPF0133 protein BURPS1710b_2372
 gi|166227681|sp|A3NA69|Y2205_BURP6 RecName: Full=UPF0133 protein BURPS668_2205
 gi|166227693|sp|A3NVY6|Y2243_BURP0 RecName: Full=UPF0133 protein BURPS1106A_2243
 gi|166227721|sp|A2S286|Y2346_BURM9 RecName: Full=UPF0133 protein BMA10229_A0046
 gi|166232616|sp|A3MK90|Y3622_BURM7 RecName: Full=UPF0133 protein BMA10247_1122
 gi|166232622|sp|A1V4L6|Y3650_BURMS RecName: Full=UPF0133 protein BMASAVP1_A1850
 gi|52209547|emb|CAH35500.1| conserved hypothetical protein [Burkholderia pseudomallei K96243]
 gi|52426995|gb|AAU47588.1| conserved hypothetical protein TIGR00103 [Burkholderia mallei ATCC
           23344]
 gi|76580118|gb|ABA49593.1| conserved hypothetical protein TIGR00103 [Burkholderia pseudomallei
           1710b]
 gi|121227587|gb|ABM50105.1| conserved hypothetical protein TIGR00103 [Burkholderia mallei
           SAVP1]
 gi|124293509|gb|ABN02778.1| conserved hypothetical protein TIGR00103 [Burkholderia mallei NCTC
           10229]
 gi|126220160|gb|ABN83666.1| conserved hypothetical protein [Burkholderia pseudomallei 668]
 gi|126226399|gb|ABN89939.1| conserved hypothetical protein TIGR00103 [Burkholderia pseudomallei
           1106a]
 gi|126243647|gb|ABO06740.1| conserved hypothetical protein TIGR00103 [Burkholderia mallei NCTC
           10247]
 gi|134251598|gb|EBA51677.1| conserved hypothetical protein TIGR00103 [Burkholderia pseudomallei
           305]
 gi|147749563|gb|EDK56637.1| conserved hypothetical protein TIGR00103 [Burkholderia mallei FMH]
 gi|147753743|gb|EDK60808.1| conserved hypothetical protein TIGR00103 [Burkholderia mallei JHU]
 gi|148027413|gb|EDK85434.1| conserved hypothetical protein TIGR00103 [Burkholderia mallei
           2002721280]
 gi|157807073|gb|EDO84243.1| conserved hypothetical protein TIGR00103 [Burkholderia pseudomallei
           406e]
 gi|157936752|gb|EDO92422.1| conserved hypothetical protein TIGR00103 [Burkholderia pseudomallei
           Pasteur 52237]
 gi|160698955|gb|EDP88925.1| conserved hypothetical protein TIGR00103 [Burkholderia mallei ATCC
           10399]
 gi|169655095|gb|EDS87788.1| conserved hypothetical protein TIGR00103 [Burkholderia pseudomallei
           S13]
 gi|184210075|gb|EDU07118.1| conserved hypothetical protein TIGR00103 [Burkholderia pseudomallei
           1655]
 gi|217395328|gb|EEC35346.1| conserved hypothetical protein TIGR00103 [Burkholderia pseudomallei
           576]
 gi|225930875|gb|EEH26885.1| conserved hypothetical protein [Burkholderia pseudomallei Pakistan
           9]
 gi|237506477|gb|ACQ98795.1| conserved hypothetical protein [Burkholderia pseudomallei MSHR346]
 gi|238520510|gb|EEP83969.1| conserved hypothetical protein [Burkholderia mallei GB8 horse 4]
 gi|242140710|gb|EES27112.1| conserved hypothetical protein [Burkholderia pseudomallei 1106b]
 gi|243062075|gb|EES44261.1| conserved hypothetical protein TIGR00103 [Burkholderia mallei
           PRL-20]
 gi|254218788|gb|EET08172.1| conserved hypothetical protein [Burkholderia pseudomallei 1710a]
          Length = 108

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 42/101 (41%), Positives = 64/101 (63%), Gaps = 1/101 (0%)

Query: 7   MVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEI 66
           ++ Q +++Q  M+KM+E +  +E EG +G G+V V +  +N +  V ID SLL +D  ++
Sbjct: 9   LMKQAQQMQENMKKMQEQLALIEVEGQSGAGLVKVTMTCRNEVRRVAIDPSLLADDK-DM 67

Query: 67  LEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           LEDL+ AA +DA +K E     K   +T GLP+PPG K PF
Sbjct: 68  LEDLVAAAFNDAVRKAEATSQEKMSGMTSGLPLPPGFKLPF 108


>gi|300312974|ref|YP_003777066.1| hypothetical protein Hsero_3680 [Herbaspirillum seropedicae SmR1]
 gi|300075759|gb|ADJ65158.1| conserved hypothetical protein [Herbaspirillum seropedicae SmR1]
          Length = 99

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 42/98 (42%), Positives = 61/98 (62%), Gaps = 1/98 (1%)

Query: 10  QFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILED 69
           Q + +Q  M+K +E + S+E EG +G G+V V +  KN +  V ID SLL +D  ++LED
Sbjct: 3   QAQAMQDNMKKAQEQLASIEVEGQSGAGLVKVVMTCKNDVKRVSIDPSLLADDK-DMLED 61

Query: 70  LIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           L+ AA +DA +K E     K   +T G+P+PPG K PF
Sbjct: 62  LVAAAFNDAVRKAEATAQEKMSGVTAGMPLPPGFKMPF 99


>gi|70729287|ref|YP_259024.1| hypothetical protein PFL_1905 [Pseudomonas fluorescens Pf-5]
 gi|123656870|sp|Q4KFF9|Y1905_PSEF5 RecName: Full=UPF0133 protein PFL_1905
 gi|68343586|gb|AAY91192.1| conserved hypothetical protein TIGR00103 [Pseudomonas fluorescens
           Pf-5]
          Length = 111

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 48/110 (43%), Positives = 69/110 (62%), Gaps = 6/110 (5%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLL- 59
           M+ +MK   Q +++Q KM KM+E + + E  G AGG MV+V + G++ +  V ID SLL 
Sbjct: 5   MAGLMK---QAQQMQEKMAKMQEELANAEVTGKAGGDMVTVVMTGRHDIKRVSIDPSLLE 61

Query: 60  --FEDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
              ED+ E+LEDL  AA +DA +KIE     K   +T G+ +PPG+K PF
Sbjct: 62  GVSEDDREVLEDLFAAAVNDAVRKIESNSQEKMSGMTAGMQLPPGMKLPF 111


>gi|167562530|ref|ZP_02355446.1| hypothetical protein BoklE_08209 [Burkholderia oklahomensis EO147]
 gi|167569716|ref|ZP_02362590.1| hypothetical protein BoklC_07738 [Burkholderia oklahomensis C6786]
 gi|167837616|ref|ZP_02464499.1| hypothetical protein Bpse38_14100 [Burkholderia thailandensis
           MSMB43]
          Length = 108

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 42/101 (41%), Positives = 64/101 (63%), Gaps = 1/101 (0%)

Query: 7   MVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEI 66
           ++ Q +++Q  M+KM+E +  +E EG +G G+V V +  +N +  V ID SLL +D  ++
Sbjct: 9   LMKQAQQMQENMKKMQEQLALIEVEGQSGAGLVKVTMTCRNEVRRVSIDPSLLADDK-DM 67

Query: 67  LEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           LEDL+ AA +DA +K E     K   +T GLP+PPG K PF
Sbjct: 68  LEDLVAAAFNDAVRKAEATSQEKMSGMTAGLPLPPGFKLPF 108


>gi|49080072|gb|AAT49966.1| PA1533 [synthetic construct]
          Length = 109

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 47/107 (43%), Positives = 68/107 (63%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M+ +MK   Q +++Q KM+KM+E + + E  G +G G+VSV + G++ +  V +D SL+ 
Sbjct: 6   MAGLMK---QAQQMQEKMQKMQEELANAEVTGQSGAGLVSVVMTGRHDVKRVSLDDSLMQ 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED  EILEDLI AA +DA +KIE     K    T G+ +PPG K PF
Sbjct: 63  EDK-EILEDLIAAAVNDAVRKIEQNNQEKMSGFTSGMQLPPGFKMPF 108


>gi|188534598|ref|YP_001908395.1| hypothetical protein ETA_24730 [Erwinia tasmaniensis Et1/99]
 gi|226701593|sp|B2VCL7|Y2473_ERWT9 RecName: Full=UPF0133 protein ETA_24730
 gi|188029640|emb|CAO97519.1| Conserved hypothetical protein [Erwinia tasmaniensis Et1/99]
          Length = 109

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 68/107 (63%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           + N+MK   Q +++Q KM +++E I  +E  G +G G+V V ING +    V++D SLL 
Sbjct: 7   LGNLMK---QAQQMQEKMAQVQEEIAEMEVTGESGAGLVKVTINGAHSCRRVEVDPSLL- 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ ++LEDL+ AA +DA ++I +    K   ++ G+ +PPG K PF
Sbjct: 63  EDDKDMLEDLVAAAFNDAARRISEAQKDKMASVSNGMSLPPGFKMPF 109


>gi|54308211|ref|YP_129231.1| hypothetical protein PBPRA1018 [Photobacterium profundum SS9]
 gi|46912639|emb|CAG19429.1| conserved hypothetical protein [Photobacterium profundum SS9]
          Length = 103

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 70/107 (65%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+MK   Q +++Q +M+KM+E + ++E  G +G G+V V I G + +  V++D SL+ 
Sbjct: 1   MGNMMK---QAQQMQERMQKMQEEVANMEVTGESGAGLVKVTITGNHSVRRVQLDDSLM- 56

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ ++LEDLI AA +DA +++E+    K   +T G+ +P G K PF
Sbjct: 57  EDDKDMLEDLIAAAFNDASRRVEETQKEKMAGVTGGMNLPAGFKMPF 103


>gi|90411567|ref|ZP_01219577.1| hypothetical protein P3TCK_15929 [Photobacterium profundum 3TCK]
 gi|90327457|gb|EAS43810.1| hypothetical protein P3TCK_15929 [Photobacterium profundum 3TCK]
          Length = 109

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 70/107 (65%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+MK   Q +++Q +M+KM+E + ++E  G +G G+V V I G + +  V++D SL+ 
Sbjct: 7   MGNMMK---QAQQMQERMQKMQEEVANMEVTGESGAGLVKVTITGNHSVRRVQLDDSLM- 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ ++LEDLI AA +DA +++E+    K   +T G+ +P G K PF
Sbjct: 63  EDDKDMLEDLIAAAFNDASRRVEETQKEKMAGVTGGMNLPAGFKMPF 109


>gi|56460948|ref|YP_156229.1| hypothetical protein IL1848 [Idiomarina loihiensis L2TR]
 gi|81362731|sp|Q5QWR0|Y1848_IDILO RecName: Full=UPF0133 protein IL1848
 gi|56179958|gb|AAV82680.1| Uncharacterized protein [Idiomarina loihiensis L2TR]
          Length = 108

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 70/107 (65%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+MK   Q +++Q +M++ +E + ++E  G AG G+V + + G + +  V ID SL+ 
Sbjct: 6   MGNMMK---QAQQMQERMQQAQEEVANMEVTGEAGAGLVKITMLGNHNVKRVSIDPSLM- 61

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ E+LEDLI AA +DA +++E+    +  EIT G+ +PPG K PF
Sbjct: 62  EDDQEMLEDLIAAATNDAVRRVEETSKERMSEITGGMGLPPGFKMPF 108


>gi|217969821|ref|YP_002355055.1| hypothetical protein Tmz1t_1400 [Thauera sp. MZ1T]
 gi|217507148|gb|ACK54159.1| conserved hypothetical protein [Thauera sp. MZ1T]
          Length = 107

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 41/98 (41%), Positives = 64/98 (65%), Gaps = 2/98 (2%)

Query: 10  QFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILED 69
           Q +++Q  M+KM++ + S+E EG +G GMV V++  K  +  V ID S++  D+ E+LED
Sbjct: 12  QAQQMQENMKKMQDQLGSIEVEGQSGAGMVKVQMTCKYDVRRVSIDESVM--DDREMLED 69

Query: 70  LIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           L+ AA +DA +K+E     K   +T GL +PPG+K PF
Sbjct: 70  LVAAALNDAVRKVEAATQEKMSSVTAGLNLPPGMKLPF 107


>gi|32491275|ref|NP_871529.1| hypothetical protein WGLp526 [Wigglesworthia glossinidia
           endosymbiont of Glossina brevipalpis]
 gi|30316304|sp|Q8D229|YGG0_WIGBR RecName: Full=UPF0133 protein WIGBR5260
 gi|25166482|dbj|BAC24672.1| ybaB [Wigglesworthia glossinidia endosymbiont of Glossina
           brevipalpis]
          Length = 102

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 42/102 (41%), Positives = 66/102 (64%), Gaps = 2/102 (1%)

Query: 6   KMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVE 65
           K++ Q ++IQ KM+ ++E I+ LEA G +G G+V +++NG      VKID SLL   + E
Sbjct: 3   KLMKQAQKIQEKMKLIQEEISKLEAIGESGAGLVKIKLNGSRYCNYVKIDNSLL--KDKE 60

Query: 66  ILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           +LEDLI+AA +DA ++I ++   K   ++  + IP G K PF
Sbjct: 61  MLEDLIVAAFNDAIRRISEIQQEKIASVSSSIQIPEGFKMPF 102


>gi|91974568|ref|YP_567227.1| hypothetical protein RPD_0086 [Rhodopseudomonas palustris BisB5]
 gi|123763178|sp|Q13F13|Y086_RHOPS RecName: Full=UPF0133 protein RPD_0086
 gi|91681024|gb|ABE37326.1| conserved hypothetical protein 103 [Rhodopseudomonas palustris
          BisB5]
          Length = 106

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 40/94 (42%), Positives = 63/94 (67%)

Query: 1  MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
          M++ + M+ Q  ++Q KM+ M+  +  +E EG++GGG+V VR++ K  + GV ID SLL 
Sbjct: 1  MADFLGMMKQAAQLQSKMKAMQAELDQIEVEGSSGGGLVQVRMSAKMEVRGVSIDPSLLK 60

Query: 61 EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEIT 94
           D   +LEDL++AAH+DAH+K E  +  K Q +T
Sbjct: 61 PDEGGVLEDLLVAAHADAHRKAEAAMQEKMQALT 94


>gi|284006439|emb|CBA71684.1| conserved hypothetical protein [Arsenophonus nasoniae]
          Length = 99

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 41/98 (41%), Positives = 64/98 (65%), Gaps = 1/98 (1%)

Query: 10  QFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILED 69
           Q +++Q KM+K++E I ++E  G +G G+V V ING +    V+ID SL+ +D  ++LED
Sbjct: 3   QAQQMQEKMQKVQEEIANMEVTGESGAGLVKVTINGAHNCRRVEIDPSLMADDK-DMLED 61

Query: 70  LIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           LI AA +DA ++IE+    K    + G+ +PPG K PF
Sbjct: 62  LIAAAFNDAARRIEEAQKEKMANASNGMQLPPGFKMPF 99


>gi|254293231|ref|YP_003059254.1| hypothetical protein Hbal_0863 [Hirschia baltica ATCC 49814]
 gi|254041762|gb|ACT58557.1| conserved hypothetical protein [Hirschia baltica ATCC 49814]
          Length = 106

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 68/107 (63%), Gaps = 3/107 (2%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M +IM+   Q +E+QGK+ + +E +  +EA G +GGGMV V + GK  +  + ID SL+ 
Sbjct: 3   MKDIMR---QAQEMQGKLAEAQEKLELIEAIGTSGGGMVKVTLKGKGEMASMSIDPSLID 59

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            ++ EI+EDL+ AAH DA +K++   A   ++ T G+ + PG K PF
Sbjct: 60  PNDPEIIEDLVKAAHDDARRKLDAAHAEAMKDATSGMGMLPGFKMPF 106


>gi|194364636|ref|YP_002027246.1| hypothetical protein Smal_0858 [Stenotrophomonas maltophilia
           R551-3]
 gi|254524661|ref|ZP_05136716.1| conserved hypothetical protein TIGR00103 [Stenotrophomonas sp.
           SKA14]
 gi|238693451|sp|B4SLQ3|Y858_STRM5 RecName: Full=UPF0133 protein Smal_0858
 gi|194347440|gb|ACF50563.1| conserved hypothetical protein [Stenotrophomonas maltophilia
           R551-3]
 gi|219722252|gb|EED40777.1| conserved hypothetical protein TIGR00103 [Stenotrophomonas sp.
           SKA14]
          Length = 106

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 44/105 (41%), Positives = 65/105 (61%), Gaps = 2/105 (1%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           NI +++ Q +++Q  ++K +E I  +E  G+AGGGMVSV + G      V+ID SL    
Sbjct: 4   NIAQLMQQAQKMQENLQKAQEEIAKIEVTGSAGGGMVSVTLTGAKECRKVRIDPSLA--S 61

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           + E+LEDLI AA +DA  KI+    +K    T G+ +PPG+K PF
Sbjct: 62  DPEMLEDLIAAAFNDASNKIDAESKSKMGSATAGMQLPPGMKLPF 106


>gi|146282184|ref|YP_001172337.1| hypothetical protein PST_1821 [Pseudomonas stutzeri A1501]
 gi|145570389|gb|ABP79495.1| conserved hypothetical protein [Pseudomonas stutzeri A1501]
          Length = 93

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 44/94 (46%), Positives = 62/94 (65%), Gaps = 1/94 (1%)

Query: 14  IQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIA 73
           +Q KM+KM+E + + E  G +G G+VSV +NG++ +  V +D SL+ ED  EILEDLI A
Sbjct: 1   MQEKMQKMQEELANAEVTGQSGAGLVSVVMNGRHDVKRVSLDDSLMQEDK-EILEDLIAA 59

Query: 74  AHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           A +DA +KIE     K   +T G+ +PPG K PF
Sbjct: 60  AVNDAVRKIEQNSQEKMAGMTAGMQLPPGFKMPF 93


>gi|190573046|ref|YP_001970891.1| hypothetical protein Smlt1015 [Stenotrophomonas maltophilia K279a]
 gi|229557879|sp|B2FR75|Y1015_STRMK RecName: Full=UPF0133 protein Smlt1015
 gi|190010968|emb|CAQ44577.1| conserved hypothetical protein [Stenotrophomonas maltophilia K279a]
          Length = 106

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 44/105 (41%), Positives = 65/105 (61%), Gaps = 2/105 (1%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           NI +++ Q +++Q  ++K +E I  +E  G+AGGGMVSV + G      V+ID SL    
Sbjct: 4   NIAQLMQQAQKMQENLQKAQEEIAKIEVTGSAGGGMVSVTLTGAKECRKVRIDPSLT--S 61

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           + E+LEDLI AA +DA  KI+    +K    T G+ +PPG+K PF
Sbjct: 62  DPEMLEDLIAAAFNDASNKIDAESKSKMGSATAGMQLPPGMKLPF 106


>gi|83719436|ref|YP_442741.1| hypothetical protein BTH_I2220 [Burkholderia thailandensis E264]
 gi|167581688|ref|ZP_02374562.1| hypothetical protein BthaT_26324 [Burkholderia thailandensis TXDOH]
 gi|167619805|ref|ZP_02388436.1| hypothetical protein BthaB_26102 [Burkholderia thailandensis Bt4]
 gi|257138952|ref|ZP_05587214.1| hypothetical protein BthaA_07045 [Burkholderia thailandensis E264]
 gi|123536827|sp|Q2SWF8|Y2220_BURTA RecName: Full=UPF0133 protein BTH_I2220
 gi|83653261|gb|ABC37324.1| conserved hypothetical protein TIGR00103 [Burkholderia
           thailandensis E264]
          Length = 108

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 42/101 (41%), Positives = 64/101 (63%), Gaps = 1/101 (0%)

Query: 7   MVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEI 66
           ++ Q +++Q  M+KM+E +  +E EG +G G+V V +  +N +  V ID SLL +D  ++
Sbjct: 9   LMKQAQQMQENMKKMQEQLALIEVEGQSGAGLVKVTMTCRNEVRRVSIDPSLLADDK-DM 67

Query: 67  LEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           LEDL+ AA +DA +K E     K   +T GLP+PPG K PF
Sbjct: 68  LEDLVAAAFNDAVRKAEVTSQEKMSGMTAGLPLPPGFKLPF 108


>gi|330502978|ref|YP_004379847.1| hypothetical protein MDS_2064 [Pseudomonas mendocina NK-01]
 gi|328917264|gb|AEB58095.1| hypothetical protein MDS_2064 [Pseudomonas mendocina NK-01]
          Length = 108

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 69/107 (64%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M+ +MK   Q +++Q KM+KM+E + + E  G +G G+VSV + G++ +  + +D SL+ 
Sbjct: 6   MAGLMK---QAQQMQEKMQKMQEELANAEVTGQSGAGLVSVVMTGRHDVKRITLDDSLMQ 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED  E+LEDLI AA +DA +K+E     K   +T G+ +PPG K PF
Sbjct: 63  EDK-EVLEDLIAAAVNDAVRKVEQNSQEKMSGMTAGMQLPPGFKMPF 108


>gi|83313203|ref|YP_423467.1| hypothetical protein amb4104 [Magnetospirillum magneticum AMB-1]
 gi|123540569|sp|Q2VZR7|Y4104_MAGMM RecName: Full=UPF0133 protein amb4104
 gi|82948044|dbj|BAE52908.1| Uncharacterized protein conserved in bacteria [Magnetospirillum
           magneticum AMB-1]
          Length = 107

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 46/107 (42%), Positives = 71/107 (66%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+  ++ Q +++Q KM +M+ ++  +E  G++G GM+ V +NGK  L  VKID SL+ 
Sbjct: 1   MKNLGNLMKQAQQMQSKMAEMQATMAEMEVTGSSGAGMLQVTLNGKYELKKVKIDPSLVD 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
             +VE+LEDLI+AA +DA  K E  +A +  ++T GL +PPG K PF
Sbjct: 61  PSDVEVLEDLILAAFNDAKAKAEAAMAEEMAKMTGGLNLPPGFKLPF 107


>gi|33592642|ref|NP_880286.1| hypothetical protein BP1550 [Bordetella pertussis Tohama I]
 gi|47117482|sp|Q7VY13|Y1550_BORPE RecName: Full=UPF0133 protein BP1550
 gi|33572288|emb|CAE41840.1| conserved hypothetical protein [Bordetella pertussis Tohama I]
 gi|332382059|gb|AEE66906.1| hypothetical protein BPTD_1533 [Bordetella pertussis CS]
          Length = 108

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 40/98 (40%), Positives = 64/98 (65%), Gaps = 1/98 (1%)

Query: 10  QFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILED 69
           Q +++Q  M+K ++++  ++ EG AGGG+V V +  ++ +  V ID SLL ED  ++LED
Sbjct: 12  QAQQMQENMKKAQDALAEIQVEGAAGGGLVKVTMTCRHDVKRVAIDASLLGEDK-DMLED 70

Query: 70  LIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           L+ AA +DA +K E     K   +T G+P+PPG+K PF
Sbjct: 71  LVAAAFNDALRKAEATSQEKMASVTAGMPLPPGMKLPF 108


>gi|297182624|gb|ADI18782.1| uncharacterized protein conserved in bacteria [uncultured SAR11
           cluster bacterium HF4000_37C10]
          Length = 106

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 69/107 (64%), Gaps = 1/107 (0%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M++   ++ Q K++Q KM++ +E++  +E EG +GG  + V +NG   L  + +D +LL 
Sbjct: 1   MADFTDLITQAKKMQEKMQQTQEALKKIEVEGISGGNAIRVIMNGDGELKKISLDENLLK 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           E   EI+EDLI+AAH+DA  K++   + +  ++T G+ +PPG K PF
Sbjct: 61  ESK-EIVEDLIVAAHNDAKSKLKTKTSEEISKVTGGVSLPPGFKLPF 106


>gi|209965590|ref|YP_002298505.1| hypothetical protein RC1_2305 [Rhodospirillum centenum SW]
 gi|238058580|sp|B6IPJ0|Y2305_RHOCS RecName: Full=UPF0133 protein RC1_2305
 gi|209959056|gb|ACI99692.1| conserved hypothetical protein [Rhodospirillum centenum SW]
          Length = 107

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 74/107 (69%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+  M+ Q +++Q +M++M+  +  +E  G + GGMVS+ +NGK  L  +K+D+S++ 
Sbjct: 1   MKNLGNMMKQAQQMQARMQEMQSKLAEVEVNGVSAGGMVSILLNGKGELKQIKLDKSVVD 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            ++VE+LEDLI+AA +DA  K+E  +A +T ++  GL +PPG K PF
Sbjct: 61  PEDVEVLEDLIVAAFNDAKNKVEAHMAEETAKLMGGLKLPPGFKLPF 107


>gi|148552985|ref|YP_001260567.1| hypothetical protein Swit_0056 [Sphingomonas wittichii RW1]
 gi|148498175|gb|ABQ66429.1| conserved hypothetical protein 103 [Sphingomonas wittichii RW1]
          Length = 112

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 40/96 (41%), Positives = 59/96 (61%)

Query: 12  KEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLI 71
           + IQ +ME+ +  + ++E EG AGGG+V +R   K  + GV ID SL+     ++LEDLI
Sbjct: 16  QTIQTQMEQAQTVLDTIEVEGAAGGGLVKIRATAKGRILGVAIDDSLMELSEKQMLEDLI 75

Query: 72  IAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            AA +D   K +     +  ++T+GLPIPPG K PF
Sbjct: 76  TAAINDCRTKADAASNAEMAKLTQGLPIPPGFKMPF 111


>gi|300715626|ref|YP_003740429.1| conserved uncharacterized protein [Erwinia billingiae Eb661]
 gi|299061462|emb|CAX58576.1| conserved uncharacterized protein [Erwinia billingiae Eb661]
          Length = 109

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 70/107 (65%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           + N+MK   Q +++Q KM +++E I ++E  G +G G+V V ING +    V++D SL F
Sbjct: 7   LGNLMK---QAQQMQDKMGQVQEEIAAMEVTGESGAGLVKVTINGAHNCRRVEVDPSL-F 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           +D+ ++LEDL+ AA +DA ++I ++   K   ++ G+ +PPG K PF
Sbjct: 63  DDDKDMLEDLVAAAFNDAARRIAEVQKEKMAGVSNGMQLPPGFKMPF 109


>gi|114320665|ref|YP_742348.1| hypothetical protein Mlg_1509 [Alkalilimnicola ehrlichii MLHE-1]
 gi|122311666|sp|Q0A8H9|Y1509_ALHEH RecName: Full=UPF0133 protein Mlg_1509
 gi|114227059|gb|ABI56858.1| conserved hypothetical protein 103 [Alkalilimnicola ehrlichii
           MLHE-1]
          Length = 107

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 67/104 (64%), Gaps = 1/104 (0%)

Query: 4   IMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDN 63
           I  M+ Q +++Q +++K +E I  +E  G +GGGMV+V INGK+    V ID S LFED+
Sbjct: 5   IGNMMKQAQKLQEELKKAQEEIAKMEVTGESGGGMVAVTINGKHEARRVSIDPS-LFEDD 63

Query: 64  VEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            E++EDL+ AA +DA  K+E     +   ++EG+ +P G K PF
Sbjct: 64  REMVEDLVAAAFNDAVHKLEQESQQRMAGLSEGMNLPSGFKLPF 107


>gi|237749101|ref|ZP_04579581.1| conserved hypothetical protein [Oxalobacter formigenes OXCC13]
 gi|229380463|gb|EEO30554.1| conserved hypothetical protein [Oxalobacter formigenes OXCC13]
          Length = 109

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 66/107 (61%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           ++N+MK   Q + +Q  MEK +E +     EG +G GMVSV ++ K  ++ V ID +L+ 
Sbjct: 7   LANLMK---QAQAMQQNMEKAQEELGKTIVEGQSGAGMVSVLMSCKYYVSRVSIDPALMS 63

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           +D  E+LEDLI AA +DA +K E     K   ++ GLP+PPG K PF
Sbjct: 64  DDK-EMLEDLITAAFNDAVRKAEATSQEKMASVSAGLPMPPGFKMPF 109


>gi|325982255|ref|YP_004294657.1| hypothetical protein NAL212_1617 [Nitrosomonas sp. AL212]
 gi|325531774|gb|ADZ26495.1| UPF0133 protein ybaB [Nitrosomonas sp. AL212]
          Length = 108

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 67/105 (63%), Gaps = 1/105 (0%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           N+  M+ Q + +Q  M +M+E + ++E EG +G GMV V +  ++ +  V ID SL+ +D
Sbjct: 5   NLGNMMKQAQMVQENMRQMQEKLATIEVEGQSGAGMVKVIMTCRHDVKRVSIDDSLVGDD 64

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
             E+LEDL+ AA +DA +++E     K  E++ GL +PPG+K PF
Sbjct: 65  K-EMLEDLVAAAFNDAVRRVETTTQEKMAELSSGLGLPPGIKLPF 108


>gi|146307668|ref|YP_001188133.1| hypothetical protein Pmen_2646 [Pseudomonas mendocina ymp]
 gi|166988491|sp|A4XVN5|Y2646_PSEMY RecName: Full=UPF0133 protein Pmen_2646
 gi|145575869|gb|ABP85401.1| conserved hypothetical protein 103 [Pseudomonas mendocina ymp]
          Length = 108

 Score = 81.6 bits (200), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 69/107 (64%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M+ +MK   Q +++Q KM+KM+E + + E  G +G G+VSV + G++ +  + +D SL+ 
Sbjct: 6   MAGLMK---QAQQMQEKMQKMQEELANAEVTGQSGAGLVSVVMTGRHDVKRITLDDSLMQ 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED  E+LEDLI AA +DA +K+E     K   +T G+ +PPG K PF
Sbjct: 63  EDK-EVLEDLIAAAVNDAVRKVEQNSQEKMAGMTAGMQLPPGFKMPF 108


>gi|114778108|ref|ZP_01452995.1| hypothetical protein SPV1_00582 [Mariprofundus ferrooxydans PV-1]
 gi|114551526|gb|EAU54080.1| hypothetical protein SPV1_00582 [Mariprofundus ferrooxydans PV-1]
          Length = 105

 Score = 81.6 bits (200), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 64/105 (60%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M NI KM+ Q K++Q  M+ M+  + ++E  G AGGGMV V + G  ++  V+ID SL  
Sbjct: 1   MMNIGKMMQQAKKMQENMKLMQAELAAMEVSGEAGGGMVQVLMGGDKIVRKVEIDPSLWA 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKF 105
           E +  ++EDL+ AA + A +K E+L   K Q +  G+P+PPG   
Sbjct: 61  EQDKALIEDLVAAAFNHASQKAEELAKEKQQGLMAGMPLPPGFSL 105


>gi|299132607|ref|ZP_07025802.1| conserved hypothetical protein [Afipia sp. 1NLS2]
 gi|298592744|gb|EFI52944.1| conserved hypothetical protein [Afipia sp. 1NLS2]
          Length = 105

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 66/100 (66%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M++ + M+ Q  ++Q KM++++E +  +E EG+AGG MV++R+  K  L  V ID SL+ 
Sbjct: 1   MADFLGMMKQAAQLQSKMKEVQEQLDQIEVEGSAGGNMVTMRMTAKMELKSVSIDPSLMK 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
            +  E+LEDL++AA +DA +K ED +  + + IT G  IP
Sbjct: 61  AEEREVLEDLLVAAQNDARRKAEDAMQERMKAITGGFNIP 100


>gi|187477418|ref|YP_785442.1| hypothetical protein BAV0915 [Bordetella avium 197N]
 gi|123513971|sp|Q2KVU6|Y915_BORA1 RecName: Full=UPF0133 protein BAV0915
 gi|115422004|emb|CAJ48526.1| conserved hypothetical protein [Bordetella avium 197N]
          Length = 108

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 40/98 (40%), Positives = 64/98 (65%), Gaps = 1/98 (1%)

Query: 10  QFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILED 69
           Q +++Q  M+K ++++  +  EG AGGG+V V ++ +N +  + ID SLL +D  ++LED
Sbjct: 12  QAQQMQENMKKAQDALADILVEGAAGGGLVKVTMSCRNDVKRIAIDPSLLADDK-DMLED 70

Query: 70  LIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           L+ AA +DA +K E     K   +T GLP+PPG+K PF
Sbjct: 71  LVAAAFNDALRKAEATSQEKMSALTAGLPLPPGMKLPF 108


>gi|285017409|ref|YP_003375120.1| hypothetical protein XALc_0613 [Xanthomonas albilineans GPE PC73]
 gi|283472627|emb|CBA15132.1| hypothetical protein XALc_0613 [Xanthomonas albilineans]
          Length = 106

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 65/105 (61%), Gaps = 2/105 (1%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           NI +++ Q +++Q  +++ +E +  LE  G+AGGGMV+V + G      V+ID S+L + 
Sbjct: 4   NIAQLMQQAQKMQENLQRAQEELAKLEVTGSAGGGMVNVTLTGAKECRKVRIDPSILSDQ 63

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
             E+ EDLI AA +DA  K++     +    T G+PIPPG+K PF
Sbjct: 64  --EMAEDLIAAAFNDASNKVDAESKQRMGAATAGMPIPPGMKLPF 106


>gi|33595894|ref|NP_883537.1| hypothetical protein BPP1222 [Bordetella parapertussis 12822]
 gi|33600425|ref|NP_887985.1| hypothetical protein BB1439 [Bordetella bronchiseptica RB50]
 gi|47117489|sp|Q7WAY8|Y1222_BORPA RecName: Full=UPF0133 protein BPP1222
 gi|47117495|sp|Q7WMF2|Y1439_BORBR RecName: Full=UPF0133 protein BB1439
 gi|33565973|emb|CAE36524.1| conserved hypothetical protein [Bordetella parapertussis]
 gi|33568024|emb|CAE31937.1| conserved hypothetical protein [Bordetella bronchiseptica RB50]
          Length = 108

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 40/98 (40%), Positives = 64/98 (65%), Gaps = 1/98 (1%)

Query: 10  QFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILED 69
           Q +++Q  M+K ++++  ++ EG AGGG+V V +  ++ +  V ID SLL ED  ++LED
Sbjct: 12  QAQQMQENMKKAQDALAEIQVEGAAGGGLVKVTMTCRHDVKRVAIDPSLLGEDK-DMLED 70

Query: 70  LIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           L+ AA +DA +K E     K   +T G+P+PPG+K PF
Sbjct: 71  LVAAAFNDALRKAEATSQEKMASVTAGMPLPPGMKLPF 108


>gi|332526817|ref|ZP_08402918.1| hypothetical protein RBXJA2T_13024 [Rubrivivax benzoatilyticus JA2]
 gi|332111219|gb|EGJ11251.1| hypothetical protein RBXJA2T_13024 [Rubrivivax benzoatilyticus JA2]
          Length = 108

 Score = 81.3 bits (199), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 39/101 (38%), Positives = 68/101 (67%), Gaps = 1/101 (0%)

Query: 7   MVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEI 66
           ++ Q + +Q  M++ +E +  LE EG +G G+V V +  K+ +  + ID SLL +D  ++
Sbjct: 9   LMKQAQAMQENMKRAQEELAQLEVEGQSGAGLVKVVMTCKHDVRRLSIDPSLLADDK-DM 67

Query: 67  LEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           LEDL+ AA +DA ++ +++ A K  ++T G+P+PPG+KFPF
Sbjct: 68  LEDLVAAAFNDAVRRADEISAEKMGKLTAGMPMPPGMKFPF 108


>gi|148260991|ref|YP_001235118.1| hypothetical protein Acry_1999 [Acidiphilium cryptum JF-5]
 gi|166227506|sp|A5G017|Y1999_ACICJ RecName: Full=UPF0133 protein Acry_1999
 gi|146402672|gb|ABQ31199.1| conserved hypothetical protein 103 [Acidiphilium cryptum JF-5]
          Length = 107

 Score = 80.9 bits (198), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 58/83 (69%)

Query: 25  ITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKKIED 84
           + ++E  G AG G+V V ++GK  + G++ID  L+  ++ E+L+DLI+AAH DA  ++E 
Sbjct: 25  LEAMEIRGEAGAGLVKVTLSGKGEMKGIEIDPKLIDPNDAEMLQDLIVAAHRDAKSRLET 84

Query: 85  LVATKTQEITEGLPIPPGLKFPF 107
           L A + Q++T G+ +PPG+K PF
Sbjct: 85  LAAEEMQKVTGGISLPPGMKLPF 107


>gi|326404391|ref|YP_004284473.1| hypothetical protein ACMV_22440 [Acidiphilium multivorum AIU301]
 gi|325051253|dbj|BAJ81591.1| hypothetical protein ACMV_22440 [Acidiphilium multivorum AIU301]
          Length = 107

 Score = 80.9 bits (198), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 58/83 (69%)

Query: 25  ITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKKIED 84
           + ++E  G AG G+V V ++GK  + G++ID  L+  ++ E+L+DLI+AAH DA  ++E 
Sbjct: 25  LEAMEIRGEAGAGLVKVTLSGKGEMKGIEIDPKLIDPNDAEMLQDLIVAAHRDAKSRLET 84

Query: 85  LVATKTQEITEGLPIPPGLKFPF 107
           L A + Q++T G+ +PPG+K PF
Sbjct: 85  LAAEEMQKVTGGISLPPGMKLPF 107


>gi|239993312|ref|ZP_04713836.1| hypothetical protein AmacA2_02325 [Alteromonas macleodii ATCC
           27126]
          Length = 108

 Score = 80.9 bits (198), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 69/107 (64%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M NIMK   Q +++Q +M+K ++ +  +E  G AG GMV V +   + +  V ID SL+ 
Sbjct: 6   MGNIMK---QAQQMQERMQKAQDDLAKIEVTGEAGAGMVKVTMTCNHNVRRVDIDESLM- 61

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           +D+ +++EDL+ AA +DA +++++    K  ++T G+P+PPG K PF
Sbjct: 62  DDDKDMVEDLVAAAFNDAVRRVQETSKEKMGDVTGGMPLPPGFKMPF 108


>gi|192289050|ref|YP_001989655.1| hypothetical protein Rpal_0620 [Rhodopseudomonas palustris TIE-1]
 gi|238692585|sp|B3QCG6|Y620_RHOPT RecName: Full=UPF0133 protein Rpal_0620
 gi|192282799|gb|ACE99179.1| conserved hypothetical protein [Rhodopseudomonas palustris TIE-1]
          Length = 106

 Score = 80.9 bits (198), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 62/94 (65%)

Query: 1  MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
          M++ + M+ Q  ++Q KM+ M+  +  +E EG +GGG+V VR++ K  + G+ ID SL+ 
Sbjct: 1  MADFLGMMKQAAQLQSKMKAMQAELDQIEVEGLSGGGLVKVRMSAKMEVRGISIDPSLIK 60

Query: 61 EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEIT 94
           D  E+LEDL++AAH DAH+K E  +  K Q +T
Sbjct: 61 ADEREVLEDLLVAAHGDAHRKAEAAMQEKMQALT 94


>gi|322834004|ref|YP_004214031.1| Uncharacterized protein family UPF0133 [Rahnella sp. Y9602]
 gi|321169205|gb|ADW74904.1| Uncharacterized protein family UPF0133 [Rahnella sp. Y9602]
          Length = 109

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 69/107 (64%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           + N+MK   Q +++Q KM++ +  I  LE  G +G G+V + ING + +  V+ID SLL 
Sbjct: 7   IGNLMK---QAQQMQEKMQQAQAEIAQLEVTGESGAGLVKITINGAHNVRRVEIDPSLL- 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ ++LEDLI AA +DA ++I++    K   ++ G+ +PPG K PF
Sbjct: 63  EDDKDMLEDLIAAAFNDAARRIDETQKEKMAAVSGGMQLPPGFKMPF 109


>gi|326795605|ref|YP_004313425.1| hypothetical protein Marme_2348 [Marinomonas mediterranea MMB-1]
 gi|326546369|gb|ADZ91589.1| UPF0133 protein ybaB [Marinomonas mediterranea MMB-1]
          Length = 108

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 68/107 (63%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+M+   Q +++Q  ++K ++ + ++E EG AG G+V V + G++ +  V ID SL+ 
Sbjct: 6   MGNMMR---QAQKMQENIQKAQDEMANMEVEGQAGAGLVKVVMTGRHDVKRVSIDDSLM- 61

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ E+LEDL+ AA +DA + IE     K    TEG+ +PPG K PF
Sbjct: 62  EDDKEMLEDLVAAALNDAVRNIESTQKAKMDAATEGMSLPPGFKMPF 108


>gi|82702978|ref|YP_412544.1| hypothetical protein Nmul_A1857 [Nitrosospira multiformis ATCC
           25196]
 gi|82411043|gb|ABB75152.1| conserved hypothetical protein [Nitrosospira multiformis ATCC
           25196]
          Length = 108

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 66/107 (61%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           + N+MK   Q +++Q  M+ M+E + S+E EG +G GMV V +  +  +  V ID SL+ 
Sbjct: 6   LGNLMK---QAQQMQENMKAMQEKLASIEVEGQSGAGMVKVVMTCRYDVRRVSIDSSLMG 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           +D  E+LEDLI AA +DA +++E     K    T GL +PPG+K PF
Sbjct: 63  DDK-EMLEDLIAAAVNDAVRRVESTTQEKMAGFTSGLGLPPGMKLPF 108


>gi|213162889|ref|ZP_03348599.1| hypothetical protein Salmoneentericaenterica_23851 [Salmonella
           enterica subsp. enterica serovar Typhi str. E00-7866]
          Length = 103

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 44/101 (43%), Positives = 66/101 (65%), Gaps = 4/101 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           + N+MK   Q +++Q KM+KM+E I  LE  G +G G+V V ING +    V+ID SLL 
Sbjct: 7   LGNLMK---QAQQMQEKMQKMQEEIAQLEVTGESGAGLVKVTINGAHNCRRVEIDPSLL- 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPP 101
           ED+ E+LEDL+ AA +DA ++IE+    K   ++ G+ +PP
Sbjct: 63  EDDKEMLEDLVAAAFNDAARRIEETQKEKMASVSSGMQLPP 103


>gi|91775926|ref|YP_545682.1| hypothetical protein Mfla_1573 [Methylobacillus flagellatus KT]
 gi|91709913|gb|ABE49841.1| conserved hypothetical protein 103 [Methylobacillus flagellatus KT]
          Length = 108

 Score = 80.5 bits (197), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 66/107 (61%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           + N+MK   Q +++Q  M++ +E +  +E EG A  GMV + +  ++ +  V ID S+L 
Sbjct: 6   LGNLMK---QAQQMQENMKRAQEELGKIEVEGQAASGMVKITMTCRHEVRRVSIDDSVLG 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           +D  E+LED+I AA +DA +K E     +   +T GLPIPPG+K PF
Sbjct: 63  DDK-ELLEDMIAAAFNDAARKAEATSQERMSSLTAGLPIPPGMKLPF 108


>gi|304312974|ref|YP_003812572.1| hypothetical protein HDN1F_33570 [gamma proteobacterium HdN1]
 gi|301798707|emb|CBL46940.1| Conserved hypothetical protein [gamma proteobacterium HdN1]
          Length = 107

 Score = 80.5 bits (197), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 42/98 (42%), Positives = 62/98 (63%), Gaps = 1/98 (1%)

Query: 10  QFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILED 69
           Q +++Q +M+KM+E +   E  G +G G+V + +NG++ +  V ID SLL ED  E+LED
Sbjct: 11  QAQKVQEQMQKMQEELAHAEVIGESGAGLVKIVMNGRHDVKRVTIDPSLLSEDK-EMLED 69

Query: 70  LIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           L+ AA +DA  K E+    K   +T G+ IPPG K PF
Sbjct: 70  LVAAAFNDAVHKAEEYSQAKVAGVTSGMGIPPGFKMPF 107


>gi|85712670|ref|ZP_01043716.1| hypothetical protein OS145_10180 [Idiomarina baltica OS145]
 gi|85693520|gb|EAQ31472.1| hypothetical protein OS145_10180 [Idiomarina baltica OS145]
          Length = 108

 Score = 80.5 bits (197), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 70/107 (65%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+MK   Q +++Q +M++ ++ I  +E  G +G G+V V + G + +  V+ID SL+ 
Sbjct: 6   MGNMMK---QAQQMQERMQQAQQEIAEMEVTGESGAGLVKVTMLGNHNIKRVEIDESLM- 61

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           +D+ E+LEDLI AA +DA +++E+    +  EIT G+ +PPG K PF
Sbjct: 62  DDDKEMLEDLIAAATNDAVRRVEETSKERMSEITGGMGLPPGFKMPF 108


>gi|332142050|ref|YP_004427788.1| hypothetical protein MADE_1013280 [Alteromonas macleodii str. 'Deep
           ecotype']
 gi|238693248|sp|B4RU48|Y1098_ALTMD RecName: Full=UPF0133 protein MADE_01098
 gi|327552072|gb|AEA98790.1| hypothetical protein MADE_1013280 [Alteromonas macleodii str. 'Deep
           ecotype']
          Length = 109

 Score = 80.1 bits (196), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 40/106 (37%), Positives = 70/106 (66%), Gaps = 4/106 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M NIMK   Q +++Q +M+K+++ + +LE  G AG GMV V +   + +  V ID SL+ 
Sbjct: 6   MGNIMK---QAQQMQERMQKVQDDLANLEVTGEAGAGMVKVTMTCNHNVRRVNIDESLM- 61

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFP 106
           +D+ +++EDL+ AA +DA +++++    K  ++T G+P+PPG K P
Sbjct: 62  DDDKDMVEDLVAAAFNDAVRRVQETSKEKMGDVTGGMPLPPGFKMP 107


>gi|126733477|ref|ZP_01749224.1| hypothetical protein RCCS2_04959 [Roseobacter sp. CCS2]
 gi|126716343|gb|EBA13207.1| hypothetical protein RCCS2_04959 [Roseobacter sp. CCS2]
          Length = 114

 Score = 80.1 bits (196), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 66/107 (61%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           + ++ KM+ Q +E+QGKM +++E + ++  EG +G G+V      K  L G+ ID S+  
Sbjct: 8   LGDMAKMMKQAQEMQGKMAQIQEDLENMMVEGVSGAGLVKATATAKGELKGLDIDPSIFN 67

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            D+ E++EDLI+AA  DA  K  +    +  ++TEGL +PPG+  PF
Sbjct: 68  GDDKEVVEDLILAAIKDAQSKATERAQEEMGKMTEGLGLPPGMNLPF 114


>gi|24373577|ref|NP_717620.1| hypothetical protein SO_2014 [Shewanella oneidensis MR-1]
 gi|30316308|sp|Q8EFF9|Y2014_SHEON RecName: Full=UPF0133 protein SO_2014
 gi|24347899|gb|AAN55064.1|AE015643_11 conserved hypothetical protein TIGR00103 [Shewanella oneidensis
           MR-1]
          Length = 109

 Score = 80.1 bits (196), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 46/107 (42%), Positives = 68/107 (63%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+MK   Q + +Q +M KM+E I  +E  G +G G+V V + G + +  V+I  SL+ 
Sbjct: 7   MGNLMK---QAQMMQERMAKMQEEIARMEMVGESGAGLVKVTMTGAHTVRKVEIYPSLM- 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ E+LEDLI AA +DA + IE+    K  E+T G+ +PPG+K PF
Sbjct: 63  EDDKEMLEDLIAAACNDAARIIEENQKAKMAEVTGGMQLPPGMKMPF 109


>gi|85708100|ref|ZP_01039166.1| hypothetical protein NAP1_02655 [Erythrobacter sp. NAP1]
 gi|85689634|gb|EAQ29637.1| hypothetical protein NAP1_02655 [Erythrobacter sp. NAP1]
          Length = 113

 Score = 80.1 bits (196), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 64/107 (59%), Gaps = 1/107 (0%)

Query: 1   MSNIMKMVGQFKE-IQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLL 59
           M  +M+   Q  E IQ +M  M+  + ++E EG AGGG+V+VR   K  + GV ID SL+
Sbjct: 4   MEEMMQAAQQAAETIQNQMNDMQVKLDNIEVEGTAGGGLVTVRATAKGRILGVNIDDSLM 63

Query: 60  FEDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFP 106
            ++   I+EDL+ AA +DA  K + + A K +E+  G+ +PPG   P
Sbjct: 64  VKEEKNIVEDLVTAAFNDARDKADRVSAEKMKEMQGGMGLPPGFNLP 110


>gi|237746947|ref|ZP_04577427.1| conserved hypothetical protein [Oxalobacter formigenes HOxBLS]
 gi|229378298|gb|EEO28389.1| conserved hypothetical protein [Oxalobacter formigenes HOxBLS]
          Length = 109

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 43/98 (43%), Positives = 61/98 (62%), Gaps = 1/98 (1%)

Query: 10  QFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILED 69
           Q + +Q  MEK++E +     EG +G GMVSV ++ K  ++ V ID +L+ +D  E+LED
Sbjct: 13  QAQAMQQNMEKVQEELGRTIVEGQSGAGMVSVLMSCKFYVSRVSIDPALMSDDK-EMLED 71

Query: 70  LIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           LI AA +DA +K E     K   I+ GLP+PPG K PF
Sbjct: 72  LITAAFNDAVRKAEATTQEKMASISAGLPMPPGFKMPF 109


>gi|117925036|ref|YP_865653.1| hypothetical protein Mmc1_1739 [Magnetococcus sp. MC-1]
 gi|117608792|gb|ABK44247.1| conserved hypothetical protein 103 [Magnetococcus sp. MC-1]
          Length = 127

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 43/100 (43%), Positives = 64/100 (64%), Gaps = 3/100 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+MK   Q K++Q KM +M+E +  L+  G AGGGMV V INGK  + GVKID   + 
Sbjct: 28  MGNMMK---QAKQMQAKMAQMQEELAQLQVIGQAGGGMVEVTINGKQSVEGVKIDPKAVD 84

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
            +++E+LEDL+ AA +DA  ++  +   K  ++T G+ IP
Sbjct: 85  LEDLEMLEDLVAAAFNDAQMRMAQITQEKMAKVTGGMNIP 124


>gi|171463391|ref|YP_001797504.1| hypothetical protein Pnec_0645 [Polynucleobacter necessarius subsp.
           necessarius STIR1]
 gi|238689055|sp|B1XU63|Y645_POLNS RecName: Full=UPF0133 protein Pnec_0645
 gi|171192929|gb|ACB43890.1| conserved hypothetical protein [Polynucleobacter necessarius subsp.
           necessarius STIR1]
          Length = 107

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 66/107 (61%), Gaps = 5/107 (4%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           ++ +MK   Q +++Q KM+  +  + +LE  G A GG+V V I+GK  L  V+ID   + 
Sbjct: 6   LAGLMK---QAQQMQEKMKTTQAELAALEVTGQAAGGLVKVTISGKYELKRVQIDPGAM- 61

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            D+ E+LEDLI+ A+++A K++E   A      T G+P+PPG K PF
Sbjct: 62  -DDREMLEDLIVTAYTEAFKQVEAASAQMMSGATAGMPMPPGFKLPF 107


>gi|71281215|ref|YP_270410.1| hypothetical protein CPS_3743 [Colwellia psychrerythraea 34H]
 gi|123631453|sp|Q47XR0|Y3743_COLP3 RecName: Full=UPF0133 protein CPS_3743
 gi|71146955|gb|AAZ27428.1| conserved hypothetical protein TIGR00103 [Colwellia psychrerythraea
           34H]
          Length = 108

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 69/107 (64%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+MK   Q +++Q KM K +E +  +E  G AG GMV V + G + +  V++D SL+ 
Sbjct: 6   MGNLMK---QAQQMQAKMAKAQEELAQMEVVGEAGAGMVKVTMTGSHSVRKVELDDSLM- 61

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ +++EDL+ AA +DA +++E+    K   +T G+ +PPG+K PF
Sbjct: 62  EDDKDMIEDLLAAAVNDAVRRVEEQNKDKMGALTGGMQLPPGMKMPF 108


>gi|254448868|ref|ZP_05062324.1| conserved hypothetical protein TIGR00103 [gamma proteobacterium
           HTCC5015]
 gi|198261558|gb|EDY85847.1| conserved hypothetical protein TIGR00103 [gamma proteobacterium
           HTCC5015]
          Length = 107

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 68/107 (63%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+MK   Q + +Q + E+ ++ I ++E EG +GGG+V V + G +    V ID SL F
Sbjct: 5   MGNLMK---QAQRMQQEAERAQKEIATMEVEGQSGGGLVKVVLTGAHEARRVSIDDSL-F 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ ++LEDL+ AA +DA  K+++    +   +T G+ +P G+KFPF
Sbjct: 61  EDDKDMLEDLVAAAINDAAHKVQEKTQERMGSVTAGMNLPGGMKFPF 107


>gi|30248451|ref|NP_840521.1| hypothetical protein NE0434 [Nitrosomonas europaea ATCC 19718]
 gi|47117514|sp|Q82X61|Y434_NITEU RecName: Full=UPF0133 protein NE0434
 gi|30138337|emb|CAD84345.1| DUF149:Conserved hypothetical protein 103 [Nitrosomonas europaea
           ATCC 19718]
          Length = 107

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 40/106 (37%), Positives = 67/106 (63%), Gaps = 1/106 (0%)

Query: 2   SNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFE 61
           +N+  ++ Q +++Q  M+ M+E + ++E EG AG GMV V +  +  +  V ID SL+ +
Sbjct: 3   ANLGNLMKQAQQMQENMKAMQEKLAAIEVEGQAGAGMVKVTMTCRYDVKRVNIDSSLIGD 62

Query: 62  DNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           D  E+LEDL+ AA +DA +++E +   K   +  GL +P G+KFPF
Sbjct: 63  DK-EMLEDLVAAAVNDAVRRVETVTQEKMASVAGGLGLPAGMKFPF 107


>gi|206901016|ref|YP_002251789.1| hypothetical protein DICTH_1981 [Dictyoglomus thermophilum H-6-12]
 gi|226701110|sp|B5YCC8|Y1981_DICT6 RecName: Full=UPF0133 protein DICTH_1981
 gi|206740119|gb|ACI19177.1| conserved hypothetical protein [Dictyoglomus thermophilum H-6-12]
          Length = 104

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 44/103 (42%), Positives = 64/103 (62%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N  + + Q K++Q KM K++E +     EG AGGG+V + +N K  +  VKID  ++ 
Sbjct: 1   MKNPFEAMKQLKKLQEKMAKIEEELEQTLVEGTAGGGVVKIIMNAKEEIKEVKIDPEVVN 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGL 103
           +D V+ILEDLI AA  DA  K ++  A K   + +GLP+PPGL
Sbjct: 61  KDEVDILEDLIAAALRDALTKAKEKSAEKMGSLADGLPLPPGL 103


>gi|152996552|ref|YP_001341387.1| hypothetical protein Mmwyl1_2533 [Marinomonas sp. MWYL1]
 gi|189039735|sp|A6VYC3|Y2533_MARMS RecName: Full=UPF0133 protein Mmwyl1_2533
 gi|150837476|gb|ABR71452.1| conserved hypothetical protein 103 [Marinomonas sp. MWYL1]
          Length = 108

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 66/107 (61%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+M+   Q +++Q  M+K +E I ++E EG AG G+V + + G++ +  V ID SL F
Sbjct: 6   MGNMMR---QAQQMQENMQKAQEEIANMEVEGQAGAGLVKILMTGRHDVKRVSIDDSL-F 61

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            D+ E+LEDLI AA +DA + IE     K    T G+ +PPG K PF
Sbjct: 62  GDDKEMLEDLIAAAVNDAVRNIEVTQKEKMAAATAGMSLPPGFKMPF 108


>gi|317406001|gb|EFV86279.1| hypothetical protein HMPREF0005_02662 [Achromobacter xylosoxidans
           C54]
          Length = 108

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 38/98 (38%), Positives = 65/98 (66%), Gaps = 1/98 (1%)

Query: 10  QFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILED 69
           Q +++Q  M+K ++++  ++ EG +GGG+V V +  ++ +  V+ID SLL +D  ++LED
Sbjct: 12  QAQQMQENMKKAQDALAEIQVEGASGGGLVKVTMTCRHDVKRVEIDPSLLADDK-DMLED 70

Query: 70  LIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           L+ AA +DA +K E     K   +T G+P+PPG+K PF
Sbjct: 71  LVAAAFNDALRKAEATSQEKMASVTAGMPLPPGMKLPF 108


>gi|332980766|ref|YP_004462207.1| hypothetical protein Mahau_0162 [Mahella australiensis 50-1 BON]
 gi|332698444|gb|AEE95385.1| Uncharacterized protein family UPF0133 [Mahella australiensis 50-1
           BON]
          Length = 112

 Score = 79.3 bits (194), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 41/98 (41%), Positives = 68/98 (69%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           N+ +M+ Q +++Q +M K++E + +   E  AGGGMV+V  NGK  L  +KID  ++  D
Sbjct: 12  NVNQMMKQAQKMQQEMAKVQEELQNKTVEATAGGGMVTVVANGKKELVDIKIDPQVVDPD 71

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           +VE+L+DL++AA ++A  K ED++A + Q++T GL IP
Sbjct: 72  DVEMLQDLVLAACNEALHKAEDMMAEEMQKLTGGLNIP 109


>gi|217966692|ref|YP_002352198.1| hypothetical protein Dtur_0258 [Dictyoglomus turgidum DSM 6724]
 gi|226701621|sp|B8E1Q9|Y258_DICTD RecName: Full=UPF0133 protein Dtur_0258
 gi|217335791|gb|ACK41584.1| conserved hypothetical protein [Dictyoglomus turgidum DSM 6724]
          Length = 104

 Score = 79.3 bits (194), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 44/103 (42%), Positives = 64/103 (62%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N  + + Q K++Q KM K++E +     EG AGGG+V + +  K  +  VKID  ++ 
Sbjct: 1   MKNPFEAMKQLKKLQEKMAKIEEELEQTLVEGTAGGGVVKIVMTAKEEVKEVKIDPEVVN 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGL 103
           +D V+ILEDLI AA  DA  K ++  A K   +T+GLP+PPGL
Sbjct: 61  KDEVDILEDLIAAALRDALTKAKEKSAEKMGSLTDGLPLPPGL 103


>gi|39933693|ref|NP_945969.1| hypothetical protein RPA0616 [Rhodopseudomonas palustris CGA009]
 gi|81564123|sp|Q6NC56|Y616_RHOPA RecName: Full=UPF0133 protein RPA0616
 gi|39647539|emb|CAE26060.1| Uncharacterized BCR [Rhodopseudomonas palustris CGA009]
          Length = 106

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 61/94 (64%)

Query: 1  MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
          M++ + M+ Q  ++Q KM+ M+  +  +E EG +GGG+V VR++ K  + G+ ID SL+ 
Sbjct: 1  MADFLGMMKQAAQLQSKMKAMQAELDQIEVEGLSGGGLVKVRMSAKMEVRGISIDPSLIK 60

Query: 61 EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEIT 94
           D  E+LEDL+ AAH DAH+K E  +  K Q +T
Sbjct: 61 ADEREVLEDLLAAAHGDAHRKAEAAMQEKMQALT 94


>gi|134094278|ref|YP_001099353.1| hypothetical protein HEAR1046 [Herminiimonas arsenicoxydans]
 gi|166228130|sp|A4G3Y9|Y1046_HERAR RecName: Full=UPF0133 protein HEAR1046
 gi|133738181|emb|CAL61226.1| conserved hypothetical protein [Herminiimonas arsenicoxydans]
          Length = 108

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 41/98 (41%), Positives = 61/98 (62%), Gaps = 1/98 (1%)

Query: 10  QFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILED 69
           Q + +Q  M+KM+E +  +E EG +G G+V + ++ KN +  V ID SLL +D  ++LED
Sbjct: 12  QAQAMQDNMKKMQEQLALIEVEGQSGAGLVKIVMSCKNDVKRVSIDPSLLADDK-DMLED 70

Query: 70  LIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           L+ AA +DA +K E     K    T G+P+PPG K PF
Sbjct: 71  LVAAAFNDAVRKAEATSQEKMAGATAGMPMPPGFKMPF 108


>gi|114330606|ref|YP_746828.1| hypothetical protein Neut_0591 [Nitrosomonas eutropha C91]
 gi|122314400|sp|Q0AIG3|Y591_NITEC RecName: Full=UPF0133 protein Neut_0591
 gi|114307620|gb|ABI58863.1| conserved hypothetical protein 103 [Nitrosomonas eutropha C91]
          Length = 107

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 39/106 (36%), Positives = 67/106 (63%), Gaps = 1/106 (0%)

Query: 2   SNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFE 61
           +N+  ++ Q +++Q  M+ M+E + ++E EG AG GMV V +  ++ +  + ID SL+ +
Sbjct: 3   ANLGNLMKQAQQMQENMKAMQEKLATIEVEGQAGAGMVKVIMTCRHDVKRINIDSSLIGD 62

Query: 62  DNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           D  E+LEDL+ AA +DA +++E         +T GL +P G+KFPF
Sbjct: 63  DK-EMLEDLVAAAMNDAVRRVEAATQEHMASVTSGLGLPAGMKFPF 107


>gi|121533381|ref|ZP_01665209.1| conserved hypothetical protein 103 [Thermosinus carboxydivorans
           Nor1]
 gi|121307940|gb|EAX48854.1| conserved hypothetical protein 103 [Thermosinus carboxydivorans
           Nor1]
          Length = 108

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 39/103 (37%), Positives = 69/103 (66%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+  M+ + +++Q +M K++E +     E  AGGG V+V I G+  +  +KI  S + 
Sbjct: 5   MGNMAGMMKKVQKLQAEMAKLQEELKQRTLEATAGGGAVTVVITGEKQIKSIKIAPSAVD 64

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGL 103
            D++E+LEDL++AA ++A KK++D++A +  ++T GL +PPGL
Sbjct: 65  PDDIEMLEDLVVAAVNEAIKKVDDMMAQEMSKLTGGLNLPPGL 107


>gi|332283344|ref|YP_004415255.1| hypothetical protein PT7_0091 [Pusillimonas sp. T7-7]
 gi|330427297|gb|AEC18631.1| hypothetical protein PT7_0091 [Pusillimonas sp. T7-7]
          Length = 108

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 66/105 (62%), Gaps = 1/105 (0%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
            I  ++ Q +++Q  M+K +E++  +  EG +GGG+V V +  ++ +  V ID SLL +D
Sbjct: 5   QIAGLMRQAQQMQENMKKAQEALADIVVEGASGGGLVKVSMTCRHDVKRVTIDPSLLADD 64

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
             ++LEDL+ AA +DA +K E     K   +T G+P+PPG+K PF
Sbjct: 65  K-DMLEDLVAAAFNDALRKAEATSQEKMSAVTAGMPMPPGMKLPF 108


>gi|226944094|ref|YP_002799167.1| hypothetical protein Avin_19840 [Azotobacter vinelandii DJ]
 gi|259646542|sp|C1DEK7|Y1984_AZOVD RecName: Full=UPF0133 protein Avin_19840
 gi|226719021|gb|ACO78192.1| Conserved hypothetical protein 103 [Azotobacter vinelandii DJ]
          Length = 108

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 46/107 (42%), Positives = 68/107 (63%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M+ +MK   Q + +Q KM+K++E I + E  G +G G+VSV + G++ +  V +D SL+ 
Sbjct: 6   MAGLMK---QAQLMQEKMQKLQEEIANAEVTGQSGAGLVSVVMTGRHDVRRVTLDDSLMQ 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED  E+LEDLI AA +DA +KIE     K   +T G+ +PPG K PF
Sbjct: 63  EDK-EVLEDLIAAAVNDAVRKIEQNNQEKMAGMTAGMGLPPGFKMPF 108


>gi|311108170|ref|YP_003981023.1| hypothetical protein AXYL_05001 [Achromobacter xylosoxidans A8]
 gi|310762859|gb|ADP18308.1| hypothetical protein AXYL_05001 [Achromobacter xylosoxidans A8]
          Length = 108

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 38/98 (38%), Positives = 64/98 (65%), Gaps = 1/98 (1%)

Query: 10  QFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILED 69
           Q +++Q  M+K ++++  ++ EG +GGG+V V +  ++ +  V ID SLL +D  ++LED
Sbjct: 12  QAQQMQENMKKAQDALADIQVEGASGGGLVKVTMTCRHDVKRVAIDPSLLGDDK-DMLED 70

Query: 70  LIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           L+ AA +DA +K E     K   +T G+P+PPG+K PF
Sbjct: 71  LVAAAFNDALRKAEATSQEKMASVTAGMPLPPGMKLPF 108


>gi|332763774|gb|EGJ94012.1| hypothetical protein SFK671_0474 [Shigella flexneri K-671]
          Length = 86

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 40/87 (45%), Positives = 56/87 (64%), Gaps = 1/87 (1%)

Query: 21  MKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHK 80
           M+E I  LE  G +G G+V V ING +    V+ID SLL ED+ E+LEDL+ AA +DA +
Sbjct: 1   MQEEIAQLEVTGESGAGLVKVTINGAHNCRRVEIDPSLL-EDDKEMLEDLVAAAFNDAAR 59

Query: 81  KIEDLVATKTQEITEGLPIPPGLKFPF 107
           +IE+    K   ++ G+ +PPG K PF
Sbjct: 60  RIEETQKEKMASVSSGMQLPPGFKMPF 86


>gi|149909473|ref|ZP_01898127.1| hypothetical protein PE36_16745 [Moritella sp. PE36]
 gi|149807378|gb|EDM67329.1| hypothetical protein PE36_16745 [Moritella sp. PE36]
          Length = 109

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 70/107 (65%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M  +MK   Q +++Q KM K++E + ++E  G +G GMV + + G + +  V+ID  L+ 
Sbjct: 7   MGQLMK---QAQQMQDKMAKVQEELANMEVVGESGAGMVKITMTGSHNVRRVQIDPELM- 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ E+LEDLI AA +DA +++E+   +K  + T G+ +PPG+K PF
Sbjct: 63  EDDKEMLEDLIAAAINDAARRVEEENKSKMADATGGMKLPPGMKMPF 109


>gi|315126895|ref|YP_004068898.1| hypothetical protein PSM_A1823 [Pseudoalteromonas sp. SM9913]
 gi|315015409|gb|ADT68747.1| hypothetical protein PSM_A1823 [Pseudoalteromonas sp. SM9913]
          Length = 108

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 71/107 (66%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+MK   Q +++Q +M+K +E I ++E  G AG G+V V + G + +  V++D SL+ 
Sbjct: 6   MGNMMK---QAQQMQERMQKAQEEIATMEVVGEAGAGLVKVTMLGNHNVRRVELDESLM- 61

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ +++EDL+ AA +DA +++ D    +  ++T G+ +PPG+K PF
Sbjct: 62  EDDKDMIEDLLAAACNDAVRRVADETQERMGKVTGGMQLPPGMKMPF 108


>gi|229591982|ref|YP_002874101.1| hypothetical protein PFLU4577 [Pseudomonas fluorescens SBW25]
 gi|312962440|ref|ZP_07776931.1| UPF0133 protein [Pseudomonas fluorescens WH6]
 gi|259647054|sp|C3K0S7|Y4577_PSEFS RecName: Full=UPF0133 protein PFLU_4577
 gi|229363848|emb|CAY51307.1| conserved hypothetical protein [Pseudomonas fluorescens SBW25]
 gi|311283367|gb|EFQ61957.1| UPF0133 protein [Pseudomonas fluorescens WH6]
          Length = 112

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 47/110 (42%), Positives = 69/110 (62%), Gaps = 6/110 (5%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLL- 59
           M+ +MK   Q +++Q KM KM+E + + E  G AGG MVSV + G++ +  V ID S+L 
Sbjct: 6   MAGLMK---QAQQMQEKMAKMQEELANAEVTGKAGGDMVSVVMTGRHDIKRVSIDPSVLP 62

Query: 60  --FEDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
              ED++E+LE L  AA +DA +KIE     K   +T G+ +PPG+K PF
Sbjct: 63  GVGEDDLEMLEALFAAAVNDAVRKIEANSQEKMGGVTAGMQLPPGMKLPF 112


>gi|116750216|ref|YP_846903.1| hypothetical protein Sfum_2790 [Syntrophobacter fumaroxidans MPOB]
 gi|166228453|sp|A0LM16|Y2790_SYNFM RecName: Full=UPF0133 protein Sfum_2790
 gi|116699280|gb|ABK18468.1| conserved hypothetical protein 103 [Syntrophobacter fumaroxidans
           MPOB]
          Length = 110

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 65/97 (67%), Gaps = 1/97 (1%)

Query: 10  QFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILED 69
           Q K +Q KM +M+E +     E +AGGGMV+V +NG+  +  VK+DR ++  +++E+L+D
Sbjct: 12  QVKALQDKMARMQEELALKTVEASAGGGMVAVVVNGRQEVLSVKVDRQVVDPEDIEMLQD 71

Query: 70  LIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFP 106
           LI+AA +D  +K +++ A +  +I  GL I PGLK P
Sbjct: 72  LIVAAVNDGLRKSQEMAAQEMGKIAGGLNI-PGLKIP 107


>gi|332992406|gb|AEF02461.1| hypothetical protein ambt_04555 [Alteromonas sp. SN2]
          Length = 108

 Score = 78.6 bits (192), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 69/107 (64%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+MK   Q +++Q +M+K+++ +  LE  G AG GMV V +   + +  V ID +L+ 
Sbjct: 6   MGNMMK---QAQQMQDRMQKVQDDLAKLEVTGEAGAGMVKVTMTCNHNVRRVDIDDTLM- 61

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ +++EDL+ AA +DA +++++    K  ++T G+ +PPG K PF
Sbjct: 62  EDDKDMIEDLVAAAFNDAVRRVQETSKEKMGDVTGGMSLPPGFKMPF 108


>gi|316932085|ref|YP_004107067.1| hypothetical protein Rpdx1_0697 [Rhodopseudomonas palustris DX-1]
 gi|315599799|gb|ADU42334.1| conserved hypothetical protein [Rhodopseudomonas palustris DX-1]
          Length = 106

 Score = 78.6 bits (192), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 62/94 (65%)

Query: 1  MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
          M++ + M+ Q  ++Q KM+ M+  +  +E EG +GGG+V VR++ K  + G+ ID SL+ 
Sbjct: 1  MADFLGMMKQAAQLQSKMKAMQAELDQIEVEGLSGGGLVKVRMSAKMEVRGISIDPSLIN 60

Query: 61 EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEIT 94
           +  E+LEDL++AAH DAH+K E  +  K Q +T
Sbjct: 61 PEEREVLEDLLVAAHGDAHRKAEAAMQEKMQALT 94


>gi|301058448|ref|ZP_07199469.1| DNA-binding protein, YbaB/EbfC family [delta proteobacterium
           NaphS2]
 gi|300447504|gb|EFK11248.1| DNA-binding protein, YbaB/EbfC family [delta proteobacterium
           NaphS2]
          Length = 109

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 66/100 (66%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+ +++ Q ++ Q KM K++E +     E +AGGGMVSV  NGK  L  +KIDR ++ 
Sbjct: 4   MPNMGQLMKQAQKFQSKMTKLQEELGEKTVEASAGGGMVSVVANGKQELISIKIDREVVD 63

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
            ++VE+LEDL++AA +DA  +  D++     E+T+G+ IP
Sbjct: 64  PEDVEMLEDLVMAAANDALTQARDMMNNGMGELTKGMNIP 103


>gi|167041263|gb|ABZ06019.1| putative uncharacterized BCR, YbaB family COG0718 [uncultured
           marine microorganism HF4000_005D21]
 gi|167045768|gb|ABZ10414.1| putative uncharacterized BCR, YbaB family COG0718 [uncultured
           marine bacterium HF4000_APKG3108]
          Length = 106

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 68/107 (63%), Gaps = 1/107 (0%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M++   ++ Q K++Q KM++ +E++  +E EG +GG  + V +NG   L  + +D +LL 
Sbjct: 1   MADFTDLITQAKKMQEKMQQTQEALKKIEVEGISGGNAIRVIMNGDGELIKISLDDNLLK 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           E   EI+EDLI+AAH+DA  K++   + +  ++T  + +PPG K PF
Sbjct: 61  ESK-EIVEDLIVAAHNDAKSKLKKKTSEEISKVTGDVSLPPGFKLPF 106


>gi|78046684|ref|YP_362859.1| hypothetical protein XCV1128 [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|123585702|sp|Q3BWK4|Y1128_XANC5 RecName: Full=UPF0133 protein XCV1128
 gi|78035114|emb|CAJ22759.1| conserved hypothetical protein [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
          Length = 106

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 64/105 (60%), Gaps = 2/105 (1%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           NI +++ Q +++Q  +++ +E +  LE  G+AGGGMVSV + G      V+ID S+L + 
Sbjct: 4   NIAQLMQQAQKMQENLQRAQEELAKLEVTGSAGGGMVSVTLTGAKECRKVRIDPSILSDQ 63

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
             E+ EDLI AA +DA  KI+     +    T G+ +PPG+K PF
Sbjct: 64  --EMAEDLIAAAFNDASNKIDAESKDRMGSATAGMQLPPGMKLPF 106


>gi|21230461|ref|NP_636378.1| hypothetical protein XCC1002 [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
 gi|66769545|ref|YP_244307.1| hypothetical protein XC_3243 [Xanthomonas campestris pv. campestris
           str. 8004]
 gi|188992753|ref|YP_001904763.1| hypothetical protein xccb100_3358 [Xanthomonas campestris pv.
           campestris str. B100]
 gi|25009603|sp|Q8PBW5|Y1002_XANCP RecName: Full=UPF0133 protein XCC1002
 gi|81304500|sp|Q4URN6|Y3243_XANC8 RecName: Full=UPF0133 protein XC_3243
 gi|229554236|sp|B0RYK3|Y3358_XANCB RecName: Full=UPF0133 protein xcc-b100_3358
 gi|21112025|gb|AAM40302.1| conserved hypothetical protein [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66574877|gb|AAY50287.1| conserved hypothetical protein [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|167734513|emb|CAP52723.1| Conserved hypothetical protein [Xanthomonas campestris pv.
           campestris]
          Length = 106

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 64/105 (60%), Gaps = 2/105 (1%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           NI +++ Q +++Q  +++ +E +  LE  G+AGGGMVSV + G      V+ID S+L + 
Sbjct: 4   NIAQLMQQAQKMQENLQRAQEELAKLEVTGSAGGGMVSVTLTGAKECRKVRIDPSILSDQ 63

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
             E+ EDLI AA +DA  KI+     +    T G+ +PPG+K PF
Sbjct: 64  --EMAEDLIAAAFNDASNKIDAESKERMGSATAGMQLPPGMKLPF 106


>gi|83645394|ref|YP_433829.1| hypothetical protein HCH_02614 [Hahella chejuensis KCTC 2396]
 gi|123533424|sp|Q2SIX0|Y2614_HAHCH RecName: Full=UPF0133 protein HCH_02614
 gi|83633437|gb|ABC29404.1| uncharacterized protein conserved in bacteria [Hahella chejuensis
           KCTC 2396]
          Length = 108

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 69/107 (64%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M ++MK   Q ++IQ +M+K +E + + E  G +GGG++ + +NG++ +  V+ID SL+ 
Sbjct: 6   MGDLMK---QAQKIQEQMQKAQEELANAEVSGESGGGLIKIVMNGRHDVKKVEIDASLMQ 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           E+  EILEDL+ AA +DA +K+E     K   +T GL IPP  K PF
Sbjct: 63  EEK-EILEDLLAAAVNDAVRKVEKNNQDKMSNMTAGLGIPPNFKMPF 108


>gi|21241865|ref|NP_641447.1| hypothetical protein XAC1110 [Xanthomonas axonopodis pv. citri str.
           306]
 gi|166710950|ref|ZP_02242157.1| hypothetical protein Xoryp_05640 [Xanthomonas oryzae pv. oryzicola
           BLS256]
 gi|289662388|ref|ZP_06483969.1| hypothetical protein XcampvN_04660 [Xanthomonas campestris pv.
           vasculorum NCPPB702]
 gi|289669155|ref|ZP_06490230.1| hypothetical protein XcampmN_11823 [Xanthomonas campestris pv.
           musacearum NCPPB4381]
 gi|294627933|ref|ZP_06706512.1| conserved hypothetical protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|294666542|ref|ZP_06731783.1| conserved hypothetical protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
 gi|325917358|ref|ZP_08179573.1| hypothetical protein TIGR00103 [Xanthomonas vesicatoria ATCC 35937]
 gi|25009606|sp|Q8PNG1|Y1110_XANAC RecName: Full=UPF0133 protein XAC1110
 gi|21107247|gb|AAM35983.1| conserved hypothetical protein [Xanthomonas axonopodis pv. citri
           str. 306]
 gi|292597847|gb|EFF42005.1| conserved hypothetical protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|292603686|gb|EFF47096.1| conserved hypothetical protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
 gi|325536399|gb|EGD08180.1| hypothetical protein TIGR00103 [Xanthomonas vesicatoria ATCC 35937]
          Length = 106

 Score = 78.2 bits (191), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 63/105 (60%), Gaps = 2/105 (1%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           NI +++ Q +++Q  +++ +E +  LE  G AGGGMVSV + G      V+ID S+L + 
Sbjct: 4   NIAQLMQQAQKMQENLQRAQEELAKLEVTGTAGGGMVSVTLTGAKECRKVRIDPSILSDQ 63

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
             E+ EDLI AA +DA  KI+     +    T G+ +PPG+K PF
Sbjct: 64  --EMAEDLIAAAFNDASNKIDAESKDRMGSATAGMQLPPGMKLPF 106


>gi|254480734|ref|ZP_05093981.1| conserved hypothetical protein TIGR00103 [marine gamma
           proteobacterium HTCC2148]
 gi|214039317|gb|EEB79977.1| conserved hypothetical protein TIGR00103 [marine gamma
           proteobacterium HTCC2148]
          Length = 106

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 64/107 (59%), Gaps = 1/107 (0%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M NI  ++ Q +++Q  M+K +E +   E  G +G GMVSV + G++ +  V ID ++L 
Sbjct: 1   MKNISDLMQQAQKMQADMQKAQEELAKAEVLGESGAGMVSVVMTGRHDVKRVTIDPAVLS 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED  E+LEDL+ AA +DA +K+E         +  GL IPPG K PF
Sbjct: 61  EDK-EVLEDLLAAAVNDAVRKVESHNQQAMSGLASGLNIPPGFKMPF 106


>gi|254514491|ref|ZP_05126552.1| conserved hypothetical protein TIGR00103 [gamma proteobacterium
           NOR5-3]
 gi|219676734|gb|EED33099.1| conserved hypothetical protein TIGR00103 [gamma proteobacterium
           NOR5-3]
          Length = 107

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 68/107 (63%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           + +IM+   Q +++Q  M+K +E +   E  G AG GMV+V + G++ +  V+ID S+L 
Sbjct: 5   LGDIMQ---QAQKMQADMQKAQEEMAEREVVGEAGAGMVTVTMTGRHDVRRVQIDPSVLG 61

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED   +LEDL+ AA +DA +++E+      Q++T GL +P G KFPF
Sbjct: 62  EDKT-VLEDLLAAAVNDAVRRVEETNRQAMQDLTGGLSLPAGFKFPF 107


>gi|138893696|ref|YP_001124149.1| hypothetical protein GTNG_0017 [Geobacillus thermodenitrificans
           NG80-2]
 gi|196251182|ref|ZP_03149857.1| conserved hypothetical protein [Geobacillus sp. G11MC16]
 gi|166227762|sp|A4IJA0|Y017_GEOTN RecName: Full=UPF0133 protein GTNG_0017
 gi|134265209|gb|ABO65404.1| Conserved hypothetical protein [Geobacillus thermodenitrificans
           NG80-2]
 gi|196209308|gb|EDY04092.1| conserved hypothetical protein [Geobacillus sp. G11MC16]
          Length = 108

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 65/100 (65%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+ KM+ Q +++Q +M+K +E +     EG AGGGMV+V  NG   +  VKI   ++ 
Sbjct: 6   MGNMQKMLKQMQKMQKEMQKAQEELAEKTVEGTAGGGMVTVVANGHKQILEVKIKEEVVD 65

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
            D++E+L+DLI+AA +DA KK+++L      + T+GL IP
Sbjct: 66  PDDIEMLQDLILAATNDALKKVDELANDMMGQFTKGLNIP 105


>gi|220934249|ref|YP_002513148.1| hypothetical protein Tgr7_1074 [Thioalkalivibrio sp. HL-EbGR7]
 gi|219995559|gb|ACL72161.1| conserved hypothetical protein [Thioalkalivibrio sp. HL-EbGR7]
          Length = 108

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 69/107 (64%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           + N+MK   Q +++Q +M + ++ + ++E  G +GGG+VSV + GK+ +  V ID SLL 
Sbjct: 6   LGNLMK---QAQKMQEQMARAQQELANMEVTGQSGGGLVSVVMTGKHEVRRVAIDPSLLA 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           +D  ++LEDL+ AA +DA  ++E+    +   +T G+ +PPG K PF
Sbjct: 63  DDK-DMLEDLVAAAINDAVHRVEETTKERMAGLTAGMSLPPGFKLPF 108


>gi|86747793|ref|YP_484289.1| hypothetical protein RPB_0667 [Rhodopseudomonas palustris HaA2]
 gi|123408908|sp|Q2J2D2|Y667_RHOP2 RecName: Full=UPF0133 protein RPB_0667
 gi|86570821|gb|ABD05378.1| conserved hypothetical protein [Rhodopseudomonas palustris HaA2]
          Length = 106

 Score = 77.8 bits (190), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 62/94 (65%)

Query: 1  MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
          M++ + M+ Q  ++Q KM+ M+  +  +E EG +GGG+V +R++ K  + GV ID SLL 
Sbjct: 1  MADFLGMMKQAAQLQSKMKAMQAELDQIEVEGLSGGGLVKIRMSAKMEVRGVSIDPSLLK 60

Query: 61 EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEIT 94
           D  E+LEDL++AA +DAH+K E  +  K Q +T
Sbjct: 61 ADEGEVLEDLLVAALADAHRKAEAAMQEKMQALT 94


>gi|77360145|ref|YP_339720.1| hypothetical protein PSHAa1202 [Pseudoalteromonas haloplanktis
           TAC125]
 gi|123589321|sp|Q3IKN3|Y1202_PSEHT RecName: Full=UPF0133 protein PSHAa1202
 gi|76875056|emb|CAI86277.1| conserved protein of unknown function likely to be involved in DNA
           repair [Pseudoalteromonas haloplanktis TAC125]
          Length = 108

 Score = 77.8 bits (190), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 71/107 (66%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+MK   Q +++Q +M+K ++ I +LE  G AG G+V V + G + +  V++D SL+ 
Sbjct: 6   MGNMMK---QAQQMQDRMQKAQDEIATLEVVGEAGAGLVKVTMLGNHNVRRVELDESLM- 61

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           +D+ +++EDL+ AA +DA +++ D    +  ++T G+ +PPG+K PF
Sbjct: 62  QDDKDMIEDLLAAACNDAVRRVADETQERMGKVTGGMQLPPGMKMPF 108


>gi|83859371|ref|ZP_00952892.1| hypothetical protein OA2633_13240 [Oceanicaulis alexandrii
           HTCC2633]
 gi|83852818|gb|EAP90671.1| hypothetical protein OA2633_13240 [Oceanicaulis alexandrii
           HTCC2633]
          Length = 114

 Score = 77.8 bits (190), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 67/107 (62%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M ++  ++ + +E+Q KM + ++ + +LE  G AG G+V + +  K  + G++ID+S++ 
Sbjct: 1   MKDLGGLMKKAQEMQAKMTEAQQRLETLEVTGEAGAGLVKLTLTAKGEMRGLEIDKSVID 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            +   +LEDLI AAH+DA +K +   A    E T+G+ +PPG+  PF
Sbjct: 61  PEYPAMLEDLIKAAHNDAKRKADQAQAEAMSEATKGMGLPPGIDLPF 107


>gi|163744803|ref|ZP_02152163.1| hypothetical protein OIHEL45_04430 [Oceanibulbus indolifex HEL-45]
 gi|161381621|gb|EDQ06030.1| hypothetical protein OIHEL45_04430 [Oceanibulbus indolifex HEL-45]
          Length = 114

 Score = 77.8 bits (190), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 66/107 (61%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           + ++  M+ + +E+QGKM +++E + ++  EG +G G+V    + K  L G+ ID S+  
Sbjct: 8   LGDMAGMMKKAQEMQGKMAELQEEMHNITVEGESGAGLVKATCSAKGELKGLDIDPSIFN 67

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           +D  E++EDLI+AA  DA  K  +    +  ++TEG+ +P G+K PF
Sbjct: 68  KDEKEVVEDLILAAIKDAQSKASERAQAEMSKLTEGMGLPAGMKLPF 114


>gi|254490457|ref|ZP_05103643.1| conserved hypothetical protein TIGR00103 [Methylophaga thiooxidans
           DMS010]
 gi|224464201|gb|EEF80464.1| conserved hypothetical protein TIGR00103 [Methylophaga thiooxydans
           DMS010]
          Length = 102

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 72/107 (67%), Gaps = 9/107 (8%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           + N+MK   Q +E+Q  MEK ++ + ++E  G +GGGMV + + GK+ +  V+I+ + LF
Sbjct: 5   LGNLMK---QAQEMQANMEKAQQELANVEVTGQSGGGMVKITMTGKHDVKRVEIEDT-LF 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ E+LEDLI AA +DA++++E      TQ+   G+ +PPG+K PF
Sbjct: 61  EDDKEMLEDLIAAAINDANRQVE----KTTQDRMSGM-MPPGMKMPF 102


>gi|255021193|ref|ZP_05293243.1| conserved protein of unknown function likely to be involved in DNA
           repair [Acidithiobacillus caldus ATCC 51756]
 gi|254969308|gb|EET26820.1| conserved protein of unknown function likely to be involved in DNA
           repair [Acidithiobacillus caldus ATCC 51756]
          Length = 107

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 68/107 (63%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           + NIMK   Q +++Q +++K +E +  +E +G+AGG +V V +  +N +  V+ID SLL 
Sbjct: 5   LGNIMK---QAQQLQERLQKAQEELAQVEVQGHAGGNLVEVTMTCRNDVRRVRIDPSLLA 61

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           E++ E+LEDLI AA +DA +  E   A +   +T G+ I PGL  PF
Sbjct: 62  ENDPEMLEDLIAAAVNDALRNAEKTSAERMSALTGGMNI-PGLNLPF 107


>gi|37523067|ref|NP_926444.1| hypothetical protein glr3498 [Gloeobacter violaceus PCC 7421]
 gi|47117440|sp|Q7NFM6|Y3498_GLOVI RecName: Full=UPF0133 protein glr3498
 gi|35214070|dbj|BAC91439.1| glr3498 [Gloeobacter violaceus PCC 7421]
          Length = 111

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 64/105 (60%), Gaps = 1/105 (0%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M    + + + K+IQ    K+++ + +L  EG AGGG+V V ++G    TGV ID  LL 
Sbjct: 8   MGQFQEALKRVKQIQEGSAKLQDELAALSIEGVAGGGLVKVTLSGNQEPTGVTIDPQLLS 67

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKF 105
           E   E++EDL++ A+ DA+ K  + +  K QE+T G+ +PPGL F
Sbjct: 68  ESK-EVVEDLLLTAYKDAYTKSAETMKAKMQELTGGMELPPGLGF 111


>gi|114568987|ref|YP_755667.1| hypothetical protein Mmar10_0436 [Maricaulis maris MCS10]
 gi|122316785|sp|Q0ASK8|Y436_MARMM RecName: Full=UPF0133 protein Mmar10_0436
 gi|114339449|gb|ABI64729.1| conserved hypothetical protein 103 [Maricaulis maris MCS10]
          Length = 107

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 38/107 (35%), Positives = 63/107 (58%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M ++M ++ Q + +Q KM + +  +   E  G AG G+V V +  K  +  + +D+SL+ 
Sbjct: 1   MKDLMGLMKQAQAMQQKMTEAQARLAETEVTGEAGAGLVRVVLTAKGDMVSIHVDKSLMD 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            D  EILEDL+ AAH+DA +K E+      ++   GL +PPG++ PF
Sbjct: 61  PDEPEILEDLLKAAHADARRKGEEAQQDIMKDAAGGLQLPPGMQMPF 107


>gi|332185690|ref|ZP_08387437.1| hypothetical protein SUS17_1026 [Sphingomonas sp. S17]
 gi|332014048|gb|EGI56106.1| hypothetical protein SUS17_1026 [Sphingomonas sp. S17]
          Length = 107

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 66/107 (61%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+ +++   + +Q +++K + ++ ++E EG +GGG+V V+ + K  + G+ ID SL+ 
Sbjct: 1   MKNLDEILAMAQNVQNELQKAQANLDTIEVEGVSGGGLVKVKASAKGRIIGIAIDDSLMQ 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
                +LEDL+ AA +DA  K +     +  ++T GLP+PPG K PF
Sbjct: 61  PLEKGMLEDLLAAAINDARTKADTASGAEMSKMTNGLPLPPGFKLPF 107


>gi|145588886|ref|YP_001155483.1| hypothetical protein Pnuc_0701 [Polynucleobacter necessarius subsp.
           asymbioticus QLW-P1DMWA-1]
 gi|229890247|sp|A4SWQ5|Y701_POLSQ RecName: Full=UPF0133 protein Pnuc_0701
 gi|145047292|gb|ABP33919.1| conserved hypothetical protein 103 [Polynucleobacter necessarius
           subsp. asymbioticus QLW-P1DMWA-1]
          Length = 107

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 65/107 (60%), Gaps = 5/107 (4%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           ++ +MK   Q +++Q KM+  +  + +LE  G A GG+V V I+GK  L  V+ID   + 
Sbjct: 6   LAGLMK---QAQQMQEKMKTAQAELAALEVNGQAAGGLVKVAISGKYELKRVQIDPGAM- 61

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            D+ E+LEDLI+ A+++A K++E          T G+P+PPG K PF
Sbjct: 62  -DDREMLEDLIVTAYTEAFKQVEAASTQLMSGATAGMPMPPGFKLPF 107


>gi|332535326|ref|ZP_08411125.1| hypothetical protein PH505_cn00070 [Pseudoalteromonas haloplanktis
           ANT/505]
 gi|332035239|gb|EGI71746.1| hypothetical protein PH505_cn00070 [Pseudoalteromonas haloplanktis
           ANT/505]
          Length = 108

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 71/107 (66%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+MK   Q +++Q +M+K ++ I +LE  G AG G+V V + G + +  V++D SL+ 
Sbjct: 6   MGNMMK---QAQQMQDRMQKAQDEIATLEVVGEAGAGLVKVTMLGNHNVRRVQLDESLM- 61

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ +++EDL+ AA +DA +++ +    +  ++T G+ +PPG+K PF
Sbjct: 62  EDDKDMIEDLLAAACNDAVRRVAEETQERMGKVTGGMQLPPGMKMPF 108


>gi|319787609|ref|YP_004147084.1| hypothetical protein Psesu_2016 [Pseudoxanthomonas suwonensis 11-1]
 gi|317466121|gb|ADV27853.1| Uncharacterized protein family UPF0133 [Pseudoxanthomonas
           suwonensis 11-1]
          Length = 106

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 66/105 (62%), Gaps = 2/105 (1%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           NI +++ Q +++Q  +++ +E +  LE  G+AGGGMVSV + G      V+ID SLL + 
Sbjct: 4   NIAQLMQQAQKMQENLQRAQEELAKLEVTGSAGGGMVSVTLTGTKECRKVRIDPSLLSDQ 63

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
             E++EDL+ AA +DA  KI+     K    + G+P+PPG+K PF
Sbjct: 64  --EMVEDLVAAAFNDASNKIDAESKAKMAAASAGMPLPPGMKLPF 106


>gi|78484875|ref|YP_390800.1| hypothetical protein Tcr_0530 [Thiomicrospira crunogena XCL-2]
 gi|78363161|gb|ABB41126.1| conserved hypothetical protein [Thiomicrospira crunogena XCL-2]
          Length = 109

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 41/98 (41%), Positives = 62/98 (63%), Gaps = 2/98 (2%)

Query: 10  QFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILED 69
           Q +E+Q  M+  ++ I  +E  G AGGGMV V + GK+ L  V+ID SL+  D+ E+LED
Sbjct: 14  QAQEMQKNMQAAQDEIAKMEISGEAGGGMVKVIMTGKHELVKVEIDDSLM--DDKEMLED 71

Query: 70  LIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           L  AA + A +++E+    K   +T G+ +PPG+K PF
Sbjct: 72  LFAAAVNSAARRVEETTQEKMGGLTGGIDLPPGMKMPF 109


>gi|56476073|ref|YP_157662.1| hypothetical protein ebA1202 [Aromatoleum aromaticum EbN1]
 gi|81358352|sp|Q5P7F0|Y639_AZOSE RecName: Full=UPF0133 protein AZOSEA06390
 gi|56312116|emb|CAI06761.1| conserved hypothetical protein [Aromatoleum aromaticum EbN1]
          Length = 107

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 40/98 (40%), Positives = 62/98 (63%), Gaps = 2/98 (2%)

Query: 10  QFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILED 69
           Q +++Q  M+KM++ + S+E EG +G GMV V +  K  +  V ID S++  D+ E+LED
Sbjct: 12  QAQQMQENMKKMQDQLASVEVEGQSGAGMVKVLMTCKYDVRRVTIDDSVM--DDKEMLED 69

Query: 70  LIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           L+ AA +DA +++E     K    T GL +PPG+K PF
Sbjct: 70  LLAAAVNDAVRRVETTTQEKMAGFTSGLNLPPGMKLPF 107


>gi|15838407|ref|NP_299095.1| hypothetical protein XF1808 [Xylella fastidiosa 9a5c]
 gi|12644644|sp|Q9PCH2|Y1808_XYLFA RecName: Full=UPF0133 protein XF_1808
 gi|9106886|gb|AAF84615.1|AE004002_5 conserved hypothetical protein [Xylella fastidiosa 9a5c]
          Length = 107

 Score = 77.4 bits (189), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 66/105 (62%), Gaps = 2/105 (1%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           NI +++ Q +++Q  +++ +E +  LE  G+AGGGMVSV ++G      V+ID S+L  +
Sbjct: 5   NIAQLMQQAQKMQENLQRAQEELAKLEVTGSAGGGMVSVILSGTKECRKVRIDPSIL--N 62

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           + E++EDLI AA +DA  K++     +    T G+ +PPG K PF
Sbjct: 63  DQEMIEDLIAAAFNDASNKVDTESKERMGSATLGMSLPPGFKLPF 107


>gi|88812992|ref|ZP_01128235.1| hypothetical protein NB231_03927 [Nitrococcus mobilis Nb-231]
 gi|88789770|gb|EAR20894.1| hypothetical protein NB231_03927 [Nitrococcus mobilis Nb-231]
          Length = 109

 Score = 77.4 bits (189), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 38/107 (35%), Positives = 70/107 (65%), Gaps = 5/107 (4%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           + N+MK   Q +++Q  +++ +E I +LE  G AGGG+V+V + G++ +  + ID S+  
Sbjct: 8   IGNLMK---QAQKMQENLQRAQEEIANLEVSGQAGGGLVNVVMTGRHEVRRINIDESVY- 63

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            D+ E++EDL+ AA +DA +K+E +   +   + +G+ +PPG+K PF
Sbjct: 64  -DDREMVEDLVAAAFNDAVQKLEKVTQERMSGLAQGMGLPPGMKLPF 109


>gi|303228683|ref|ZP_07315508.1| DNA-binding protein, YbaB/EbfC family [Veillonella atypica
           ACS-134-V-Col7a]
 gi|303231326|ref|ZP_07318061.1| DNA-binding protein, YbaB/EbfC family [Veillonella atypica
           ACS-049-V-Sch6]
 gi|302514006|gb|EFL56013.1| DNA-binding protein, YbaB/EbfC family [Veillonella atypica
           ACS-049-V-Sch6]
 gi|302516663|gb|EFL58580.1| DNA-binding protein, YbaB/EbfC family [Veillonella atypica
           ACS-134-V-Col7a]
          Length = 109

 Score = 77.4 bits (189), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 38/103 (36%), Positives = 72/103 (69%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+  M+ + +++Q  M+KM+E + +   E + GGG V+V +NG+ M+  +K++ S + 
Sbjct: 6   MGNMAGMMKKVQKMQADMKKMQEELKTRTVEASVGGGAVTVVMNGEKMIESLKLNPSAVD 65

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGL 103
            ++VE+LEDL++AA ++A KK++DL++ +  ++T GL +P GL
Sbjct: 66  PEDVEMLEDLVMAAVNEASKKVDDLLSQEMGKVTGGLNLPTGL 108


>gi|325925319|ref|ZP_08186722.1| hypothetical protein TIGR00103 [Xanthomonas perforans 91-118]
 gi|325544310|gb|EGD15690.1| hypothetical protein TIGR00103 [Xanthomonas perforans 91-118]
          Length = 106

 Score = 77.0 bits (188), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 63/105 (60%), Gaps = 2/105 (1%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           NI +++ Q +++Q  +++ +E +  LE  G AGGGMVSV + G      V+ID S+L + 
Sbjct: 4   NIAQLMQQAQKMQENLQRAQEELAKLEVIGTAGGGMVSVTLTGAKECRKVRIDPSILSDQ 63

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
             E+ EDLI AA +DA  KI+     +    T G+ +PPG+K PF
Sbjct: 64  --EMAEDLIAAAFNDASNKIDAESRDRMGSATAGMQLPPGMKLPF 106


>gi|58580688|ref|YP_199704.1| hypothetical protein XOO1065 [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|84622622|ref|YP_449994.1| hypothetical protein XOO_0965 [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|75436433|sp|Q5H402|Y1065_XANOR RecName: Full=UPF0133 protein XOO1065
 gi|123522962|sp|Q2P6V7|Y965_XANOM RecName: Full=UPF0133 protein XOO0965
 gi|58425282|gb|AAW74319.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|84366562|dbj|BAE67720.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae MAFF
           311018]
          Length = 106

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 63/105 (60%), Gaps = 2/105 (1%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           NI +++ Q +++Q  +++ +E +  LE  G AGGGMV+V + G      V+ID S+L + 
Sbjct: 4   NIAQLMQQAQKMQENLQRAQEELAKLEVTGTAGGGMVNVTLTGAKECRKVRIDPSILSDQ 63

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
             E+ EDLI AA +DA  KI+     +    T G+ +PPG+K PF
Sbjct: 64  --EMAEDLIAAAFNDASNKIDAESKDRMGSATAGMQLPPGMKLPF 106


>gi|171058658|ref|YP_001791007.1| hypothetical protein Lcho_1975 [Leptothrix cholodnii SP-6]
 gi|238689105|sp|B1Y1E3|Y1975_LEPCP RecName: Full=UPF0133 protein Lcho_1975
 gi|170776103|gb|ACB34242.1| conserved hypothetical protein [Leptothrix cholodnii SP-6]
          Length = 108

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 37/101 (36%), Positives = 67/101 (66%), Gaps = 1/101 (0%)

Query: 7   MVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEI 66
           ++ Q + +Q  ++K ++ + ++E EG +G G+V V +  K+ +  + ID SLL +D  ++
Sbjct: 9   LMKQAQAMQDNLKKAQDELANVEVEGQSGAGLVKVVMTCKHDVKRLSIDPSLLADDK-DM 67

Query: 67  LEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           LEDL+ AA +DA ++ E +   K  ++T G+P+PPG+KFPF
Sbjct: 68  LEDLVAAAFNDAVRRAEAVSQEKMGKLTAGMPLPPGMKFPF 108


>gi|119897249|ref|YP_932462.1| hypothetical protein azo0958 [Azoarcus sp. BH72]
 gi|119669662|emb|CAL93575.1| conserved hypothetical protein [Azoarcus sp. BH72]
          Length = 109

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 40/98 (40%), Positives = 61/98 (62%), Gaps = 2/98 (2%)

Query: 10  QFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILED 69
           Q +++Q  M+KM++ + S+E EG AG G+V V +  K  +  V ID +++  D+ E+LED
Sbjct: 14  QAQQMQDNMKKMQDQLASVEVEGQAGAGVVKVVMTCKYDVRRVSIDDAVM--DDKEMLED 71

Query: 70  LIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           L+ AA +DA +K+E     K    T GL +PPG K PF
Sbjct: 72  LVAAALNDAVRKVETTTQEKMAGFTAGLNLPPGFKLPF 109


>gi|238018440|ref|ZP_04598866.1| hypothetical protein VEIDISOL_00267 [Veillonella dispar ATCC 17748]
 gi|237864911|gb|EEP66201.1| hypothetical protein VEIDISOL_00267 [Veillonella dispar ATCC 17748]
          Length = 109

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 38/103 (36%), Positives = 72/103 (69%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+  M+ + +++Q  M+KM+E + +   E + GGG V+V +NG+ ++  +K++ S + 
Sbjct: 6   MGNMAGMMKKVQKMQADMKKMQEELKTRTVEASVGGGAVTVVMNGEKIIESLKLNPSAVD 65

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGL 103
            ++VE+LEDL++AA ++A KK++DL+A +  ++T GL +P GL
Sbjct: 66  PEDVEMLEDLVMAAVNEASKKVDDLLAQEMGKVTGGLNLPTGL 108


>gi|88705063|ref|ZP_01102775.1| Conserved hypothetical protein 103 [Congregibacter litoralis KT71]
 gi|88700758|gb|EAQ97865.1| Conserved hypothetical protein 103 [Congregibacter litoralis KT71]
          Length = 107

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 40/98 (40%), Positives = 63/98 (64%), Gaps = 1/98 (1%)

Query: 10  QFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILED 69
           Q +++Q  M+K +E++  LE  G +G G+VSV + GK+ +  V ID S+L E+   +LED
Sbjct: 11  QAQKMQADMQKAQEAMAELEVVGESGAGLVSVTMTGKHDVRRVAIDPSVLNEEK-SVLED 69

Query: 70  LIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           L+ AA +DA +++E       QE+T G+ +P G KFPF
Sbjct: 70  LLAAAVNDAVRRVEQSNRKAMQELTGGMSLPAGFKFPF 107


>gi|113868362|ref|YP_726851.1| recombinational DNA repair protein (RecF pathway) [Ralstonia
           eutropha H16]
 gi|113527138|emb|CAJ93483.1| Recombinational DNA repair protein (RecF pathway) [Ralstonia
           eutropha H16]
          Length = 318

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 43/106 (40%), Positives = 66/106 (62%), Gaps = 4/106 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           ++ +MK   Q +++Q  M+KM+E +  +E EG +G G+V V +  KN +  V ID SLL 
Sbjct: 6   LAGLMK---QAQQMQENMKKMQEQLAQIEVEGQSGAGLVKVVMTCKNDVKRVTIDPSLLA 62

Query: 61  E-DNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKF 105
           E ++ ++LEDL+ AA +DA +K E     K   +T GLP+PPG K 
Sbjct: 63  EGEDKDLLEDLVAAAFNDAVRKAEATSQEKMGSMTSGLPLPPGFKL 108


>gi|77917990|ref|YP_355805.1| hypothetical protein Pcar_0375 [Pelobacter carbinolicus DSM 2380]
 gi|77544073|gb|ABA87635.1| conserved hypothetical protein TIGR00103 [Pelobacter carbinolicus
           DSM 2380]
          Length = 104

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 69/100 (69%), Gaps = 3/100 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           + NIMK   Q + +Q KME+M++ + + + E +AGGGMV+  +NG+  L  +KI+ S++ 
Sbjct: 5   LGNIMK---QAQLMQQKMERMQQELETRQVEASAGGGMVTAVVNGRQQLVDLKIEASVVD 61

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
            ++VE+L+DL++AA ++A KK +D+   +  ++T GL IP
Sbjct: 62  PEDVEMLQDLVLAAVNEALKKSQDMAQQEMSKVTGGLNIP 101


>gi|238751046|ref|ZP_04612542.1| hypothetical protein yrohd0001_1790 [Yersinia rohdei ATCC 43380]
 gi|238710736|gb|EEQ02958.1| hypothetical protein yrohd0001_1790 [Yersinia rohdei ATCC 43380]
          Length = 110

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 38/83 (45%), Positives = 53/83 (63%)

Query: 25  ITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKKIED 84
           I  LE  G +G G+V V ING +    V+ID SLL ED+ E+LEDLI AA +DA ++I++
Sbjct: 28  IAKLEVTGESGAGLVKVTINGAHNCRRVEIDPSLLVEDDKEMLEDLIAAAINDAARRIDE 87

Query: 85  LVATKTQEITEGLPIPPGLKFPF 107
               K   ++ G+ +PPG K PF
Sbjct: 88  TQKEKMASVSSGMQLPPGFKMPF 110


>gi|332305803|ref|YP_004433654.1| hypothetical protein Glaag_1427 [Glaciecola agarilytica
           4H-3-7+YE-5]
 gi|332173132|gb|AEE22386.1| Uncharacterized protein family UPF0133 [Glaciecola agarilytica
           4H-3-7+YE-5]
          Length = 108

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 38/107 (35%), Positives = 68/107 (63%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+MK   Q +++Q +M+K +E +  +E  G +G G+V V +   + +  V ID SL+ 
Sbjct: 6   MGNVMK---QAQQMQERMQKKQEELAKMEVTGESGAGLVKVTMTCNHNVRRVDIDDSLM- 61

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ E++EDL+ AA +DA +++++    +  ++T G+ +PPG K PF
Sbjct: 62  EDDKEMIEDLVAAAINDAVRRVQETTKEQMADVTGGMAMPPGFKMPF 108


>gi|119469546|ref|ZP_01612450.1| hypothetical protein ATW7_06803 [Alteromonadales bacterium TW-7]
 gi|119447081|gb|EAW28351.1| hypothetical protein ATW7_06803 [Alteromonadales bacterium TW-7]
          Length = 108

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 38/107 (35%), Positives = 71/107 (66%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+MK   Q +++Q +M+K ++ I ++E  G AG G+V V + G + +  V++D SL+ 
Sbjct: 6   MGNMMK---QAQQMQERMQKAQDEIATMEVVGEAGAGLVKVTMLGNHNVRRVELDESLM- 61

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ +++EDL+ AA +DA +++ +    +  ++T G+ +PPG+K PF
Sbjct: 62  EDDKDMIEDLLAAACNDAVRRVAEETQERMSKVTGGMQLPPGMKMPF 108


>gi|311694775|gb|ADP97648.1| protein belonging to uncharacterized protein family UPF0133 [marine
           bacterium HP15]
          Length = 107

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 68/107 (63%), Gaps = 1/107 (0%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M+N+  M+ + +++Q +M+K +E I   E  G AG G+V V +NG++ +  V ID SL+ 
Sbjct: 2   MNNMGDMMKKAQKMQEEMQKAQEEIAKAEVTGEAGAGLVKVTMNGRHDVRKVDIDSSLMT 61

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           E+  +ILEDL+ AA +DA +++E+    K   +  G+ +PPG K PF
Sbjct: 62  EEK-DILEDLLAAAVNDAVRRVEENQKEKMSGMMSGMGLPPGFKMPF 107


>gi|56418553|ref|YP_145871.1| hypothetical protein GK0018 [Geobacillus kaustophilus HTA426]
 gi|261417517|ref|YP_003251199.1| hypothetical protein GYMC61_0017 [Geobacillus sp. Y412MC61]
 gi|297528393|ref|YP_003669668.1| hypothetical protein GC56T3_0017 [Geobacillus sp. C56-T3]
 gi|319765175|ref|YP_004130676.1| hypothetical protein GYMC52_0018 [Geobacillus sp. Y412MC52]
 gi|81348392|sp|Q5L3X5|Y018_GEOKA RecName: Full=UPF0133 protein GK0018
 gi|56378395|dbj|BAD74303.1| hypothetical conserved protein [Geobacillus kaustophilus HTA426]
 gi|261373974|gb|ACX76717.1| conserved hypothetical protein [Geobacillus sp. Y412MC61]
 gi|297251645|gb|ADI25091.1| hypothetical protein GC56T3_0017 [Geobacillus sp. C56-T3]
 gi|317110041|gb|ADU92533.1| Uncharacterized protein family UPF0133 [Geobacillus sp. Y412MC52]
          Length = 108

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 64/100 (64%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+ KM+ Q +++Q +M+K +E +     EG AGGGMV+V  NG   +  VKI   ++ 
Sbjct: 6   MGNMQKMLKQMQKMQKEMQKAQEELAEKTVEGTAGGGMVTVVANGHKQILEVKIKEEVVD 65

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
            D++E+L+DLI+AA +DA KK ++L      + T+GL IP
Sbjct: 66  PDDIEMLQDLILAATNDALKKADELANEMMGQFTKGLNIP 105


>gi|325919110|ref|ZP_08181169.1| hypothetical protein TIGR00103 [Xanthomonas gardneri ATCC 19865]
 gi|325550419|gb|EGD21214.1| hypothetical protein TIGR00103 [Xanthomonas gardneri ATCC 19865]
          Length = 106

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 63/105 (60%), Gaps = 2/105 (1%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           NI +++ Q +++Q  +++ +E +  LE  G AGGG+VSV + G      V+ID S+L + 
Sbjct: 4   NIAQLMQQAQKMQENLQRAQEELAKLEVTGTAGGGIVSVTLTGAKECRKVRIDPSILSDQ 63

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
             E+ EDLI AA +DA  KI+     +    T G+ +PPG+K PF
Sbjct: 64  --EMAEDLIAAAFNDASNKIDAESKDRMGSATAGMQLPPGMKLPF 106


>gi|307822530|ref|ZP_07652761.1| conserved hypothetical protein [Methylobacter tundripaludum SV96]
 gi|307736134|gb|EFO06980.1| conserved hypothetical protein [Methylobacter tundripaludum SV96]
          Length = 107

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 68/107 (63%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           + NIM+   Q +++Q  ++K +E + +++  G +GGG+V++ + GK     V ID SLL 
Sbjct: 5   LGNIMQ---QAQKMQEDLKKAQEELNAMQVMGESGGGLVTILMTGKREARKVTIDPSLLG 61

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           +D  ++LEDL+ AA +DA  K+  +   K  ++T GLP+PPG + PF
Sbjct: 62  DDK-DMLEDLVAAAINDAVNKVAKMKKEKMADVTAGLPLPPGFQLPF 107


>gi|163857865|ref|YP_001632163.1| hypothetical protein Bpet3552 [Bordetella petrii DSM 12804]
 gi|229544502|sp|A9HZ13|Y3552_BORPD RecName: Full=UPF0133 protein Bpet3552
 gi|163261593|emb|CAP43895.1| conserved hypothetical protein [Bordetella petrii]
          Length = 108

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 37/98 (37%), Positives = 64/98 (65%), Gaps = 1/98 (1%)

Query: 10  QFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILED 69
           Q +++Q  M+K ++++  +  EG +GGG+V V ++ ++ +  V ID SLL +D  ++LED
Sbjct: 12  QAQQMQENMKKAQDALAEIIVEGESGGGLVKVSMSCRHDVKRVAIDPSLLADDK-DMLED 70

Query: 70  LIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           L+ AA +DA +K+E     K   +T G+P+P G+K PF
Sbjct: 71  LVAAAFNDALRKVESTSQEKMASVTAGMPLPAGMKLPF 108


>gi|282857783|ref|ZP_06266992.1| DNA-binding protein, YbaB/EbfC family [Pyramidobacter piscolens
           W5455]
 gi|282584453|gb|EFB89812.1| DNA-binding protein, YbaB/EbfC family [Pyramidobacter piscolens
           W5455]
          Length = 109

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 62/95 (65%)

Query: 6   KMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVE 65
           +M+ Q + +Q KM K +E +     EG+AGGGMVS  +NG+  L GVK+ + ++  ++VE
Sbjct: 14  QMLKQAQAMQAKMMKAQEELKEARVEGSAGGGMVSATVNGQGELVGVKLSKEVVDPEDVE 73

Query: 66  ILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           +LEDLI+AA SDA  K  +++  +   +T G+ +P
Sbjct: 74  MLEDLILAAVSDAANKAREMMEQRMGSLTGGMKLP 108


>gi|167468905|ref|ZP_02333609.1| hypothetical protein YpesF_13634 [Yersinia pestis FV-1]
          Length = 95

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 37/83 (44%), Positives = 53/83 (63%)

Query: 25  ITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKKIED 84
           +  LE  G +G G+V V ING +    V+ID SLL ED+ E+LEDLI AA +DA ++I++
Sbjct: 13  VAKLEVTGESGAGLVKVTINGAHNCRRVEIDPSLLVEDDKEMLEDLIAAALNDAARRIDE 72

Query: 85  LVATKTQEITEGLPIPPGLKFPF 107
               K   ++ G+ +PPG K PF
Sbjct: 73  TQKEKMASVSNGMQLPPGFKMPF 95


>gi|238754274|ref|ZP_04615631.1| hypothetical protein yruck0001_22230 [Yersinia ruckeri ATCC 29473]
 gi|238795501|ref|ZP_04639016.1| hypothetical protein ymoll0001_10910 [Yersinia mollaretii ATCC
           43969]
 gi|238707521|gb|EEP99881.1| hypothetical protein yruck0001_22230 [Yersinia ruckeri ATCC 29473]
 gi|238720620|gb|EEQ12421.1| hypothetical protein ymoll0001_10910 [Yersinia mollaretii ATCC
           43969]
          Length = 110

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 37/83 (44%), Positives = 53/83 (63%)

Query: 25  ITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKKIED 84
           +  LE  G +G G+V V ING +    V+ID SLL ED+ E+LEDLI AA +DA ++I++
Sbjct: 28  VAKLEVTGESGAGLVKVTINGAHNCRRVEIDPSLLVEDDKEMLEDLIAAALNDAARRIDE 87

Query: 85  LVATKTQEITEGLPIPPGLKFPF 107
               K   ++ G+ +PPG K PF
Sbjct: 88  TQKEKMASVSSGMQLPPGFKMPF 110


>gi|22124968|ref|NP_668391.1| hypothetical protein y1061 [Yersinia pestis KIM 10]
 gi|45440657|ref|NP_992196.1| hypothetical protein YP_0808 [Yersinia pestis biovar Microtus str.
           91001]
 gi|51595343|ref|YP_069534.1| hypothetical protein YPTB0993 [Yersinia pseudotuberculosis IP
           32953]
 gi|108808606|ref|YP_652522.1| hypothetical protein YPA_2615 [Yersinia pestis Antiqua]
 gi|108811132|ref|YP_646899.1| hypothetical protein YPN_0967 [Yersinia pestis Nepal516]
 gi|145600017|ref|YP_001164093.1| hypothetical protein YPDSF_2758 [Yersinia pestis Pestoides F]
 gi|149365030|ref|ZP_01887065.1| hypothetical protein YPE_0156 [Yersinia pestis CA88-4125]
 gi|153949887|ref|YP_001402018.1| hypothetical protein YpsIP31758_3058 [Yersinia pseudotuberculosis
           IP 31758]
 gi|162418200|ref|YP_001607271.1| hypothetical protein YpAngola_A2890 [Yersinia pestis Angola]
 gi|165927642|ref|ZP_02223474.1| conserved hypothetical protein TIGR00103 [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165936005|ref|ZP_02224575.1| conserved hypothetical protein TIGR00103 [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|166011095|ref|ZP_02231993.1| conserved hypothetical protein TIGR00103 [Yersinia pestis biovar
           Antiqua str. E1979001]
 gi|166213023|ref|ZP_02239058.1| conserved hypothetical protein TIGR00103 [Yersinia pestis biovar
           Antiqua str. B42003004]
 gi|167399301|ref|ZP_02304825.1| conserved hypothetical protein TIGR00103 [Yersinia pestis biovar
           Antiqua str. UG05-0454]
 gi|167422734|ref|ZP_02314487.1| conserved hypothetical protein TIGR00103 [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167423293|ref|ZP_02315046.1| conserved hypothetical protein TIGR00103 [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|170025414|ref|YP_001721919.1| hypothetical protein YPK_3197 [Yersinia pseudotuberculosis YPIII]
 gi|186894362|ref|YP_001871474.1| hypothetical protein YPTS_1036 [Yersinia pseudotuberculosis PB1/+]
 gi|218930154|ref|YP_002348029.1| hypothetical protein YPO3121 [Yersinia pestis CO92]
 gi|229838720|ref|ZP_04458879.1| conserved protein [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229896123|ref|ZP_04511293.1| conserved protein [Yersinia pestis Pestoides A]
 gi|229899288|ref|ZP_04514431.1| conserved protein [Yersinia pestis biovar Orientalis str. India
           195]
 gi|229901364|ref|ZP_04516486.1| conserved protein [Yersinia pestis Nepal516]
 gi|270489549|ref|ZP_06206623.1| DNA-binding protein, YbaB/EbfC family [Yersinia pestis KIM D27]
 gi|294504860|ref|YP_003568922.1| hypothetical protein YPZ3_2750 [Yersinia pestis Z176003]
 gi|21264176|sp|Q8ZC96|Y3121_YERPE RecName: Full=UPF0133 protein YPO3121/y1061/YP_0808
 gi|81640180|sp|Q66DQ0|Y993_YERPS RecName: Full=UPF0133 protein YPTB0993
 gi|122382952|sp|Q1C4P5|Y2615_YERPA RecName: Full=UPF0133 protein YPA_2615
 gi|122385068|sp|Q1CL31|Y967_YERPN RecName: Full=UPF0133 protein YPN_0967
 gi|166228450|sp|A4TPA8|Y2758_YERPP RecName: Full=UPF0133 protein YPDSF_2758
 gi|166988578|sp|A7FL90|Y3058_YERP3 RecName: Full=UPF0133 protein YpsIP31758_3058
 gi|238687262|sp|A9R0Q3|Y2890_YERPG RecName: Full=UPF0133 protein YpAngola_A2890
 gi|238688400|sp|B1JHN4|Y3197_YERPY RecName: Full=UPF0133 protein YPK_3197
 gi|238691420|sp|B2K6Z3|Y1036_YERPB RecName: Full=UPF0133 protein YPTS_1036
 gi|21957810|gb|AAM84642.1|AE013709_11 hypothetical protein y1061 [Yersinia pestis KIM 10]
 gi|45435515|gb|AAS61073.1| conserved hypothetical protein [Yersinia pestis biovar Microtus
           str. 91001]
 gi|51588625|emb|CAH20233.1| conserved hypothetical protein [Yersinia pseudotuberculosis IP
           32953]
 gi|108774780|gb|ABG17299.1| hypothetical protein YPN_0967 [Yersinia pestis Nepal516]
 gi|108780519|gb|ABG14577.1| hypothetical protein YPA_2615 [Yersinia pestis Antiqua]
 gi|115348765|emb|CAL21717.1| conserved hypothetical protein [Yersinia pestis CO92]
 gi|145211713|gb|ABP41120.1| hypothetical protein YPDSF_2758 [Yersinia pestis Pestoides F]
 gi|149291443|gb|EDM41517.1| hypothetical protein YPE_0156 [Yersinia pestis CA88-4125]
 gi|152961382|gb|ABS48843.1| conserved hypothetical protein TIGR00103 [Yersinia
           pseudotuberculosis IP 31758]
 gi|162351015|gb|ABX84963.1| conserved hypothetical protein TIGR00103 [Yersinia pestis Angola]
 gi|165916150|gb|EDR34757.1| conserved hypothetical protein TIGR00103 [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|165920396|gb|EDR37673.1| conserved hypothetical protein TIGR00103 [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165990095|gb|EDR42396.1| conserved hypothetical protein TIGR00103 [Yersinia pestis biovar
           Antiqua str. E1979001]
 gi|166205810|gb|EDR50290.1| conserved hypothetical protein TIGR00103 [Yersinia pestis biovar
           Antiqua str. B42003004]
 gi|166958325|gb|EDR55346.1| conserved hypothetical protein TIGR00103 [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167051805|gb|EDR63213.1| conserved hypothetical protein TIGR00103 [Yersinia pestis biovar
           Antiqua str. UG05-0454]
 gi|167057463|gb|EDR67209.1| conserved hypothetical protein TIGR00103 [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|169751948|gb|ACA69466.1| conserved hypothetical protein [Yersinia pseudotuberculosis YPIII]
 gi|186697388|gb|ACC88017.1| conserved hypothetical protein [Yersinia pseudotuberculosis PB1/+]
 gi|229681293|gb|EEO77387.1| conserved protein [Yersinia pestis Nepal516]
 gi|229687690|gb|EEO79763.1| conserved protein [Yersinia pestis biovar Orientalis str. India
           195]
 gi|229695086|gb|EEO85133.1| conserved protein [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229701046|gb|EEO89075.1| conserved protein [Yersinia pestis Pestoides A]
 gi|262362924|gb|ACY59645.1| hypothetical protein YPD4_2738 [Yersinia pestis D106004]
 gi|262366845|gb|ACY63402.1| hypothetical protein YPD8_2729 [Yersinia pestis D182038]
 gi|270338053|gb|EFA48830.1| DNA-binding protein, YbaB/EbfC family [Yersinia pestis KIM D27]
 gi|294355319|gb|ADE65660.1| hypothetical protein YPZ3_2750 [Yersinia pestis Z176003]
 gi|320016307|gb|ADV99878.1| conserved protein [Yersinia pestis biovar Medievalis str. Harbin
           35]
          Length = 110

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 37/83 (44%), Positives = 53/83 (63%)

Query: 25  ITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKKIED 84
           +  LE  G +G G+V V ING +    V+ID SLL ED+ E+LEDLI AA +DA ++I++
Sbjct: 28  VAKLEVTGESGAGLVKVTINGAHNCRRVEIDPSLLVEDDKEMLEDLIAAALNDAARRIDE 87

Query: 85  LVATKTQEITEGLPIPPGLKFPF 107
               K   ++ G+ +PPG K PF
Sbjct: 88  TQKEKMASVSNGMQLPPGFKMPF 110


>gi|288940169|ref|YP_003442409.1| hypothetical protein Alvin_0418 [Allochromatium vinosum DSM 180]
 gi|288895541|gb|ADC61377.1| conserved hypothetical protein [Allochromatium vinosum DSM 180]
          Length = 107

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 38/101 (37%), Positives = 64/101 (63%), Gaps = 1/101 (0%)

Query: 7   MVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEI 66
           ++ Q +++Q  M++ +  +   E  G AGGG+V V +NG++    V+ID SL+ +D  E+
Sbjct: 7   LLKQAQKMQEDMQQAQARLAQEETTGEAGGGLVKVTLNGQHQAKRVEIDPSLMGDDK-EM 65

Query: 67  LEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           LEDLI AA + A ++I +       E+T G+P+PPG+K P+
Sbjct: 66  LEDLITAAINAASQRIAEKTKETMSELTAGMPLPPGMKLPW 106


>gi|110834635|ref|YP_693494.1| hypothetical protein ABO_1774 [Alcanivorax borkumensis SK2]
 gi|123149376|sp|Q0VNM6|Y1774_ALCBS RecName: Full=UPF0133 protein ABO_1774
 gi|110647746|emb|CAL17222.1| conserved hypothetical protein [Alcanivorax borkumensis SK2]
          Length = 105

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 63/102 (61%), Gaps = 1/102 (0%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           +I  ++ Q + +Q KM+KM++   + E  G +G G+V V +NG++ + GV ID SL+ ED
Sbjct: 4   DINNLMQQAQAMQEKMKKMQDEAANAEVVGESGAGLVKVTMNGRHDVKGVDIDPSLMSED 63

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLK 104
             E+LEDL+ AA +DA ++IE       Q +  G P PPG K
Sbjct: 64  K-ELLEDLLAAAVNDAVRRIEKQQQDSMQNMAGGFPFPPGFK 104


>gi|254487773|ref|ZP_05100978.1| conserved hypothetical protein TIGR00103 [Roseobacter sp. GAI101]
 gi|214044642|gb|EEB85280.1| conserved hypothetical protein TIGR00103 [Roseobacter sp. GAI101]
          Length = 114

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 62/107 (57%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M ++ KM+   +E+QGKM +M+E + ++  EG +G G+V      K  L  + ID S+  
Sbjct: 8   MGDMAKMMKAAQEMQGKMAQMQEDMHNIIVEGESGAGLVKATCTAKGELKTLDIDPSIFN 67

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            D  E++EDLI+AA  DA  K  D    +  ++TEG+ +P  +K PF
Sbjct: 68  GDEKEVVEDLILAAIKDAQTKATDRAQAEMSKLTEGMGLPADMKLPF 114


>gi|53804577|ref|YP_113789.1| hypothetical protein MCA1327 [Methylococcus capsulatus str. Bath]
 gi|81682210|sp|Q609A8|Y1327_METCA RecName: Full=UPF0133 protein MCA1327
 gi|53758338|gb|AAU92629.1| conserved hypothetical protein TIGR00103 [Methylococcus capsulatus
           str. Bath]
          Length = 107

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 65/107 (60%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           ++N+M+   +F+E     +K +E I + E +  +GGG+V +R+NGK  +  V+ID SL  
Sbjct: 5   LANLMQQAQRFQET---FQKTQEEIAATEIQAESGGGLVKIRMNGKREVLKVEIDPSLRQ 61

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           E++ E+LEDLI AA +D  +++  L   K   +T  L IPPG   PF
Sbjct: 62  EEH-EVLEDLIAAAFNDGVRRVAKLKQEKMAGLTGSLGIPPGFNLPF 107


>gi|56414360|ref|YP_151435.1| hypothetical protein SPA2237 [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|197363280|ref|YP_002142917.1| hypothetical protein SSPA2080 [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|81360117|sp|Q5PFK5|YBAB_SALPA RecName: Full=UPF0133 protein ybaB
 gi|238689939|sp|B5BD47|YBAB_SALPK RecName: Full=UPF0133 protein ybaB
 gi|56128617|gb|AAV78123.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|197094757|emb|CAR60290.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
          Length = 109

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 39/85 (45%), Positives = 54/85 (63%), Gaps = 1/85 (1%)

Query: 23  ESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKKI 82
           E I  LE  G +G G+V V ING +    V+ID SLL ED+ E+LEDL+ AA +DA ++I
Sbjct: 26  EEIAQLEVTGESGAGLVKVTINGAHNCRRVEIDPSLL-EDDKEMLEDLVAAAFNDAARRI 84

Query: 83  EDLVATKTQEITEGLPIPPGLKFPF 107
           E+    K   ++ G+ +PPG K PF
Sbjct: 85  EETQKEKMASVSSGMQLPPGFKMPF 109


>gi|269798691|ref|YP_003312591.1| hypothetical protein Vpar_1635 [Veillonella parvula DSM 2008]
 gi|294794412|ref|ZP_06759548.1| transcriptional regulatory protein [Veillonella sp. 3_1_44]
 gi|269095320|gb|ACZ25311.1| conserved hypothetical protein [Veillonella parvula DSM 2008]
 gi|294454742|gb|EFG23115.1| transcriptional regulatory protein [Veillonella sp. 3_1_44]
          Length = 109

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 37/103 (35%), Positives = 72/103 (69%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+  M+ + +++Q  M+KM+E + +   E + GGG V+V +NG+ ++  +K++ + + 
Sbjct: 6   MGNMTGMMKKVQKMQADMKKMQEELKTRTVEASVGGGAVTVVMNGEKIIESLKLNPTAVD 65

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGL 103
            ++VE+LEDL++AA ++A KK++DL+A +  ++T GL +P GL
Sbjct: 66  PEDVEMLEDLVMAAVNEASKKVDDLLAQEMGKVTGGLNLPTGL 108


>gi|298528794|ref|ZP_07016198.1| conserved hypothetical protein [Desulfonatronospira thiodismutans
           ASO3-1]
 gi|298512446|gb|EFI36348.1| conserved hypothetical protein [Desulfonatronospira thiodismutans
           ASO3-1]
          Length = 100

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 66/94 (70%)

Query: 7   MVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEI 66
           +V Q + +Q KM KM+E + + E E +AGGGMV+V++NG   +  V+I++ ++  ++VE+
Sbjct: 4   LVKQAQMMQKKMAKMQEELNAREVEASAGGGMVTVKVNGGQEVLEVRIEKDVVDPEDVEM 63

Query: 67  LEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           L+DLI+AA +DA K+  ++V  +  ++T G+ IP
Sbjct: 64  LQDLILAATNDALKRAREMVQGEMSQLTGGMKIP 97


>gi|330808464|ref|YP_004352926.1| hypothetical protein PSEBR_a1713 [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327376572|gb|AEA67922.1| Conserved hypothetical protein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 112

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 45/110 (40%), Positives = 68/110 (61%), Gaps = 6/110 (5%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSL-- 58
           M+ +MK   Q +++Q KM KM+E + + E  G +GG MV+V + G++ +  V ID S+  
Sbjct: 6   MAGLMK---QAQQMQEKMAKMQEELANAEVTGKSGGDMVTVVMTGRHDIKRVSIDPSVVE 62

Query: 59  -LFEDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            L ED+ E+LE L  AA +DA +KIE     K   +T G+ +PPG+K PF
Sbjct: 63  GLSEDDKEMLEALFAAAVNDAVRKIEANSQDKMSGMTAGMQLPPGMKLPF 112


>gi|294792633|ref|ZP_06757780.1| transcriptional regulatory protein [Veillonella sp. 6_1_27]
 gi|313894181|ref|ZP_07827746.1| DNA-binding protein, YbaB/EbfC family [Veillonella sp. oral taxon
           158 str. F0412]
 gi|294456532|gb|EFG24895.1| transcriptional regulatory protein [Veillonella sp. 6_1_27]
 gi|313441005|gb|EFR59432.1| DNA-binding protein, YbaB/EbfC family [Veillonella sp. oral taxon
           158 str. F0412]
          Length = 109

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 37/103 (35%), Positives = 72/103 (69%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+  M+ + +++Q  M+KM+E + +   E + GGG V+V +NG+ ++  +K++ + + 
Sbjct: 6   MGNMAGMMKKVQKMQADMKKMQEELKTRTVEASVGGGAVTVVMNGEKIIESLKLNPTAVD 65

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGL 103
            ++VE+LEDL++AA ++A KK++DL+A +  ++T GL +P GL
Sbjct: 66  PEDVEMLEDLVMAAVNEASKKVDDLLAQEMGKVTGGLNLPTGL 108


>gi|159043202|ref|YP_001531996.1| hypothetical protein Dshi_0649 [Dinoroseobacter shibae DFL 12]
 gi|157910962|gb|ABV92395.1| conserved hypothetical protein DUF149 [Dinoroseobacter shibae DFL
           12]
          Length = 114

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 64/107 (59%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           + ++ K++ Q +E+Q KM +M+E++ ++   G +G G+V      K  LTG+ ID S+  
Sbjct: 8   LGDMAKVMKQAQEMQAKMAEMQENLKTITVTGESGAGLVKATATAKGELTGLDIDPSIFN 67

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            +  E+ EDLI+AA  DA  K  D    +  ++TEGL +P G+K PF
Sbjct: 68  PEEKEVAEDLILAAIKDAQAKALDKGREEMAKVTEGLNLPEGMKLPF 114


>gi|317120922|ref|YP_004100925.1| hypothetical protein Tmar_0073 [Thermaerobacter marianensis DSM
           12885]
 gi|315590902|gb|ADU50198.1| Uncharacterized protein family UPF0133 [Thermaerobacter marianensis
           DSM 12885]
          Length = 110

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 36/101 (35%), Positives = 65/101 (64%)

Query: 6   KMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVE 65
           KM+ Q +++Q +M +++E +   E E  AGGGMV   +NG+  L  ++I R  +  D+VE
Sbjct: 8   KMLKQLEKVQQEMARLQEELAQREVEATAGGGMVKAVVNGRQELLRLEIAREAVDPDDVE 67

Query: 66  ILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFP 106
           +L+D+I+AA ++A++K ++L+  +   +T GL +P    FP
Sbjct: 68  LLQDMIVAAVNEANRKAQELLQAEMARVTGGLKLPKLPGFP 108


>gi|225181514|ref|ZP_03734956.1| conserved hypothetical protein [Dethiobacter alkaliphilus AHT 1]
 gi|225167762|gb|EEG76571.1| conserved hypothetical protein [Dethiobacter alkaliphilus AHT 1]
          Length = 106

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 39/103 (37%), Positives = 69/103 (66%), Gaps = 3/103 (2%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+MK   Q +++Q +M KM+E I     E  +GGGMV V +NGK  +  + ID   + 
Sbjct: 6   MGNMMK---QVQKMQKQMAKMQEEIQEKVVEATSGGGMVRVEVNGKKEMVSLTIDPEAVD 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGL 103
            ++VE+L+D+I+AA ++  +K+++L A++ +++T G+ +PPGL
Sbjct: 63  PEDVEMLQDMILAAVNEGLRKMDELSASEMKKLTGGMNLPPGL 105


>gi|254427859|ref|ZP_05041566.1| conserved hypothetical protein TIGR00103 [Alcanivorax sp. DG881]
 gi|196194028|gb|EDX88987.1| conserved hypothetical protein TIGR00103 [Alcanivorax sp. DG881]
          Length = 105

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 63/102 (61%), Gaps = 1/102 (0%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           +I  ++ Q + +Q KM+KM++   + E  G +G G+V V +NG++ + GV ID SL+ ED
Sbjct: 4   DINNLMQQAQAMQEKMKKMQDEAANSEVVGESGAGLVKVTMNGRHDVKGVDIDASLMSED 63

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLK 104
             E+LEDL+ AA +DA +++E       Q +  G P PPG K
Sbjct: 64  K-ELLEDLLAAAVNDAVRRVEKQQQDNMQNMAGGFPFPPGFK 104


>gi|146276572|ref|YP_001166731.1| hypothetical protein Rsph17025_0520 [Rhodobacter sphaeroides ATCC
           17025]
 gi|145554813|gb|ABP69426.1| conserved hypothetical protein 103 [Rhodobacter sphaeroides ATCC
           17025]
          Length = 114

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 62/107 (57%), Gaps = 3/107 (2%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M+ +MK    F+E   KM +++E + S+   G +G G+V      K  LTG++ID S+  
Sbjct: 11  MAKMMKAAQGFQE---KMAQLQEDLGSMTVVGESGAGLVRATATAKGELTGLEIDPSIFV 67

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
               E++EDLI+AA  DA  K  +    +  ++T+GL +PPG+K PF
Sbjct: 68  ASEKEVVEDLILAAIKDAQSKASERAKQEMGKLTDGLGLPPGMKLPF 114


>gi|123443300|ref|YP_001007274.1| hypothetical protein YE3092 [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|332160792|ref|YP_004297369.1| hypothetical protein YE105_C1170 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|166229375|sp|A1JNB8|Y3092_YERE8 RecName: Full=UPF0133 protein YE3092
 gi|122090261|emb|CAL13127.1| conserved hypothetical protein [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|318604678|emb|CBY26176.1| hypothetical protein co-occurring with RecR [Yersinia
           enterocolitica subsp. palearctica Y11]
 gi|325665022|gb|ADZ41666.1| hypothetical protein YE105_C1170 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|330863113|emb|CBX73243.1| UPF0133 protein YE3092 [Yersinia enterocolitica W22703]
          Length = 110

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 53/83 (63%)

Query: 25  ITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKKIED 84
           +  LE  G +G G+V V ING +    V+ID SLL E++ E+LEDLI AA +DA ++I++
Sbjct: 28  VAKLEVTGESGAGLVKVTINGAHNCRRVEIDPSLLVEEDKEMLEDLIAAAFNDAARRIDE 87

Query: 85  LVATKTQEITEGLPIPPGLKFPF 107
               K   ++ G+ +PPG K PF
Sbjct: 88  TQKEKMASVSSGMQLPPGFKMPF 110


>gi|87199379|ref|YP_496636.1| hypothetical protein Saro_1358 [Novosphingobium aromaticivorans DSM
           12444]
 gi|87135060|gb|ABD25802.1| conserved hypothetical protein 103 [Novosphingobium aromaticivorans
           DSM 12444]
          Length = 111

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 40/94 (42%), Positives = 56/94 (59%)

Query: 14  IQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIA 73
           IQ +ME  + ++ ++E EG AGGG+V +R + K  + GV ID SLL      ILEDL+ A
Sbjct: 18  IQKQMEDAQATLDAIEVEGAAGGGLVKIRASAKGRVIGVAIDDSLLAPSEKGILEDLVAA 77

Query: 74  AHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           A +DA  K +   A + Q++     IPPG K PF
Sbjct: 78  AFNDARGKADAAAAEEMQKVQMAAGIPPGFKLPF 111


>gi|300691829|ref|YP_003752824.1| hypothetical protein RPSI07_2185 [Ralstonia solanacearum PSI07]
 gi|299078889|emb|CBJ51550.1| conserved protein of unknown function [Ralstonia solanacearum
           PSI07]
          Length = 115

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 44/111 (39%), Positives = 66/111 (59%), Gaps = 6/111 (5%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFE- 61
            I  ++ Q +++Q  M+KM+E ++ +E EG +G G+V V +  KN +  V ID SLL E 
Sbjct: 5   QIAGLMKQAQQMQDNMKKMQEQLSQIEVEGVSGAGLVKVVMTCKNDVKRVSIDPSLLAEG 64

Query: 62  DNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLP-----IPPGLKFPF 107
           ++ E+LEDL+ AA +DA +K E     K   +T GL      +PPG K PF
Sbjct: 65  EDKELLEDLVAAAFNDAVRKAEATTQEKMGSVTSGLGGMASMLPPGFKLPF 115


>gi|292493700|ref|YP_003529139.1| hypothetical protein Nhal_3732 [Nitrosococcus halophilus Nc4]
 gi|291582295|gb|ADE16752.1| conserved hypothetical protein [Nitrosococcus halophilus Nc4]
          Length = 106

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 65/107 (60%), Gaps = 5/107 (4%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           + N+MK   Q +++Q  MEK +E + ++E  G AGGGMVS+ + G+     + I+  L  
Sbjct: 5   LGNLMK---QAQQLQSNMEKAQEELANMEVTGQAGGGMVSIVMTGRYDCRRITINNELWQ 61

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED  E++EDL+ AA +DA ++IE     K   +T G+ +PPG K PF
Sbjct: 62  EDK-EMVEDLVAAAINDAVRQIETQSKEKMASMTSGM-LPPGFKMPF 106


>gi|226939892|ref|YP_002794965.1| hypothetical protein LHK_00964 [Laribacter hongkongensis HLHK9]
 gi|226714818|gb|ACO73956.1| hypothetical protein LHK_00964 [Laribacter hongkongensis HLHK9]
          Length = 108

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 39/104 (37%), Positives = 64/104 (61%), Gaps = 2/104 (1%)

Query: 4   IMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDN 63
           I  ++ Q +++Q  M+K +E +  +E EG +G GMV + ++  + +  V ID  ++  D+
Sbjct: 7   IAGLMKQAQQMQDNMKKAQEELAQIEVEGQSGAGMVKITMSCNHDVKRVTIDDGVM--DD 64

Query: 64  VEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            E+LEDLI AA +DA+++IE     K    T GL +PPG+K PF
Sbjct: 65  KEMLEDLIAAAINDANRRIETTTQDKMSGFTSGLNLPPGMKLPF 108


>gi|126725865|ref|ZP_01741707.1| hypothetical protein RB2150_06653 [Rhodobacterales bacterium
           HTCC2150]
 gi|126705069|gb|EBA04160.1| hypothetical protein RB2150_06653 [Rhodobacterales bacterium
           HTCC2150]
          Length = 117

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 62/105 (59%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           ++ KM+    E+Q KM +M+E + ++   G +G G+V      K  L G+ ID S+   D
Sbjct: 13  DMAKMMKTATEMQEKMGQMQEDLANITVTGESGAGLVKATATAKGTLVGLDIDPSIFHPD 72

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
             E++EDLI+AA  DA +K E+   ++  ++TEGL +P  +K PF
Sbjct: 73  EKEVVEDLILAAVKDAQQKAEERGKSEMTKLTEGLGLPADMKLPF 117


>gi|28198955|ref|NP_779269.1| hypothetical protein PD1058 [Xylella fastidiosa Temecula1]
 gi|32130342|sp|Q87CK7|Y1058_XYLFT RecName: Full=UPF0133 protein PD_1058
 gi|28057053|gb|AAO28918.1| conserved hypothetical protein [Xylella fastidiosa Temecula1]
 gi|307580100|gb|ADN64069.1| hypothetical protein XFLM_11045 [Xylella fastidiosa subsp.
           fastidiosa GB514]
          Length = 106

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 65/105 (61%), Gaps = 2/105 (1%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           NI +++ Q +++Q  +++ +E +  LE  G+AGG MVSV ++G      V+ID S+L  +
Sbjct: 4   NIAQLMQQAQKMQENLQRAQEELAKLEVTGSAGGSMVSVILSGTKECRKVRIDPSIL--N 61

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           + E++EDLI AA +DA  K++     +    T G+ +PPG K PF
Sbjct: 62  DQEMIEDLIAAAFNDASNKVDAESKERMGSATLGMSLPPGFKLPF 106


>gi|71275384|ref|ZP_00651670.1| Conserved hypothetical protein 103 [Xylella fastidiosa Dixon]
 gi|71898556|ref|ZP_00680727.1| Conserved hypothetical protein 103 [Xylella fastidiosa Ann-1]
 gi|71900520|ref|ZP_00682649.1| Conserved hypothetical protein 103 [Xylella fastidiosa Ann-1]
 gi|170730361|ref|YP_001775794.1| hypothetical protein Xfasm12_1216 [Xylella fastidiosa M12]
 gi|182681664|ref|YP_001829824.1| hypothetical protein XfasM23_1122 [Xylella fastidiosa M23]
 gi|238687920|sp|B0U2T5|Y1216_XYLFM RecName: Full=UPF0133 protein Xfasm12_1216
 gi|238691040|sp|B2I5A7|Y1122_XYLF2 RecName: Full=UPF0133 protein XfasM23_1122
 gi|71163684|gb|EAO13400.1| Conserved hypothetical protein 103 [Xylella fastidiosa Dixon]
 gi|71729696|gb|EAO31798.1| Conserved hypothetical protein 103 [Xylella fastidiosa Ann-1]
 gi|71731680|gb|EAO33740.1| Conserved hypothetical protein 103 [Xylella fastidiosa Ann-1]
 gi|167965154|gb|ACA12164.1| conserved hypothetical protein [Xylella fastidiosa M12]
 gi|182631774|gb|ACB92550.1| conserved hypothetical protein [Xylella fastidiosa M23]
          Length = 107

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 65/105 (61%), Gaps = 2/105 (1%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           NI +++ Q +++Q  +++ +E +  LE  G+AGG MVSV ++G      V+ID S+L  +
Sbjct: 5   NIAQLMQQAQKMQENLQRAQEELAKLEVTGSAGGSMVSVILSGTKECRKVRIDPSIL--N 62

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           + E++EDLI AA +DA  K++     +    T G+ +PPG K PF
Sbjct: 63  DQEMIEDLIAAAFNDASNKVDAESKERMGSATLGMSLPPGFKLPF 107


>gi|296136311|ref|YP_003643553.1| hypothetical protein Tint_1855 [Thiomonas intermedia K12]
 gi|294340547|emb|CAZ88932.1| conserved hypothetical protein ybaB [Thiomonas sp. 3As]
 gi|295796433|gb|ADG31223.1| conserved hypothetical protein [Thiomonas intermedia K12]
          Length = 109

 Score = 74.7 bits (182), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 66/107 (61%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           +S +MK   Q +++Q  ++++++ +  +E EG +G G+V V +  K  +  V ID SL+ 
Sbjct: 7   LSGLMK---QAQQMQDNLKRVQDELGQIEVEGQSGAGLVKVTMTCKYGVKRVNIDPSLVA 63

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED  ++LEDL+ AA +DA +K E     K    T G+P+PPG+K PF
Sbjct: 64  EDR-DMLEDLVAAAFNDAVRKAEATSQEKMGAATAGMPLPPGMKLPF 109


>gi|224825856|ref|ZP_03698960.1| conserved hypothetical protein [Lutiella nitroferrum 2002]
 gi|224602080|gb|EEG08259.1| conserved hypothetical protein [Lutiella nitroferrum 2002]
          Length = 112

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 42/106 (39%), Positives = 65/106 (61%), Gaps = 2/106 (1%)

Query: 4   IMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLL--FE 61
           I  ++ Q +++Q  M+K +E +  +E EG +G G+V V +  ++ +  V ID SLL   +
Sbjct: 7   IAGLMKQAQQMQENMKKAQEELGKVEVEGQSGAGLVKVVMTCQHDIKRVSIDDSLLEDAK 66

Query: 62  DNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           D+ E+LEDLI AA +DA +K+E     K    T GL +PPG+K PF
Sbjct: 67  DDKEMLEDLIAAAVNDAVRKVESTTQDKMSGFTAGLNLPPGMKLPF 112


>gi|293607023|ref|ZP_06689367.1| conserved hypothetical protein [Achromobacter piechaudii ATCC
           43553]
 gi|292814620|gb|EFF73757.1| conserved hypothetical protein [Achromobacter piechaudii ATCC
           43553]
          Length = 108

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 38/98 (38%), Positives = 63/98 (64%), Gaps = 1/98 (1%)

Query: 10  QFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILED 69
           Q +++Q  M+K ++++  +  EG +GGG+V V +  ++ +  V ID SLL +D  ++LED
Sbjct: 12  QAQQMQENMKKAQDALAEILVEGASGGGLVKVTMTCRHDVKRVVIDPSLLGDDK-DMLED 70

Query: 70  LIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           L+ AA +DA +K E     K   +T G+P+PPG+K PF
Sbjct: 71  LVAAAFNDALRKAETTSQEKMAGVTAGMPLPPGMKLPF 108


>gi|198283700|ref|YP_002220021.1| hypothetical protein Lferr_1592 [Acidithiobacillus ferrooxidans
           ATCC 53993]
 gi|218666428|ref|YP_002426329.1| conserved hypothetical protein TIGR00103 [Acidithiobacillus
           ferrooxidans ATCC 23270]
 gi|226732160|sp|B7JC17|Y1920_ACIF2 RecName: Full=UPF0133 protein AFE_1920
 gi|238690896|sp|B5EJE0|Y1592_ACIF5 RecName: Full=UPF0133 protein Lferr_1592
 gi|198248221|gb|ACH83814.1| conserved hypothetical protein [Acidithiobacillus ferrooxidans ATCC
           53993]
 gi|218518641|gb|ACK79227.1| conserved hypothetical protein TIGR00103 [Acidithiobacillus
           ferrooxidans ATCC 23270]
          Length = 107

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 69/107 (64%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           + NIMK   Q +++Q +++K +E +  +E +G+AGG +V V +  ++ +  V+ID SLL 
Sbjct: 5   LGNIMK---QAQQLQERLQKTQEELAQVEVQGHAGGNLVEVTMTCRHDVRRVRIDPSLLT 61

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           + + E+LEDL+ AA +DA +  E + A +  E+T G+ I PG+  PF
Sbjct: 62  DGDQEMLEDLVAAAINDAVRTAEKVSAERMSEVTGGMNI-PGMNLPF 107


>gi|319778424|ref|YP_004129337.1| hypothetical protein TEQUI_0242 [Taylorella equigenitalis MCE9]
 gi|317108448|gb|ADU91194.1| hypothetical protein TEQUI_0242 [Taylorella equigenitalis MCE9]
          Length = 108

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 65/104 (62%), Gaps = 1/104 (0%)

Query: 4   IMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDN 63
           I  ++ Q +++Q KM++ ++ +++   EG AGG +V+V +   + +  V ID S+L ED 
Sbjct: 6   IAGLMKQAQQMQDKMKQTQDELSNTLVEGVAGGNLVTVSMTCNHEVKRVSIDDSVLEEDK 65

Query: 64  VEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            E LEDLI AA +DAH+K E+    K   +T GL +P G+K PF
Sbjct: 66  -EFLEDLIAAALNDAHRKAEETSQEKMSAVTGGLSLPGGMKLPF 108


>gi|28373436|pdb|1J8B|A Chain A, Structure Of Ybab From Haemophilus Influenzae (Hi0442), A
           Protein Of Unknown Function
          Length = 112

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 39/83 (46%), Positives = 51/83 (61%), Gaps = 1/83 (1%)

Query: 25  ITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKKIED 84
           I  LE  G +G G+V + ING +    + ID SL  ED+ E LEDLI AA +DA ++ E+
Sbjct: 31  IAQLEVTGESGAGLVKITINGAHNCRRIDIDPSLX-EDDKEXLEDLIAAAFNDAVRRAEE 89

Query: 85  LVATKTQEITEGLPIPPGLKFPF 107
           L   K   +T G P+PPG KFPF
Sbjct: 90  LQKEKXASVTAGXPLPPGXKFPF 112


>gi|260654560|ref|ZP_05860050.1| putative cytoplasmic protein [Jonquetella anthropi E3_33 E1]
 gi|260630576|gb|EEX48770.1| putative cytoplasmic protein [Jonquetella anthropi E3_33 E1]
          Length = 108

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 67/100 (67%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+  M+ Q +++Q +M+K++  + + + EG AGGGMV+  +NG+  L GVKI   ++ 
Sbjct: 8   MGNMSSMIKQAQKMQQEMQKIQADLANEKVEGTAGGGMVTATVNGQGDLLGVKISPEVVN 67

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
              V++LEDL++AA S+A +K ++L+ ++   +T G+ +P
Sbjct: 68  PSEVDVLEDLVLAAVSEASRKAKELMQSRMGRLTGGMNLP 107


>gi|90416005|ref|ZP_01223938.1| hypothetical protein GB2207_02192 [marine gamma proteobacterium
           HTCC2207]
 gi|90332379|gb|EAS47576.1| hypothetical protein GB2207_02192 [marine gamma proteobacterium
           HTCC2207]
          Length = 105

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 65/105 (61%), Gaps = 1/105 (0%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           +I +++ Q +++QGKM +M+E   + E  G +G GMV V + G++ +  V +D SL+ ED
Sbjct: 2   DINELMKQAQQMQGKMAEMQEQAANAEVTGESGAGMVKVTMTGRHDVRKVTLDPSLMMED 61

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
             E LEDL+ AA +DA +K+E        ++T G+ +P G K PF
Sbjct: 62  K-EFLEDLLAAAVNDAVRKVEAQSVDALGKMTGGMNLPAGFKMPF 105


>gi|83855098|ref|ZP_00948628.1| hypothetical protein NAS141_10221 [Sulfitobacter sp. NAS-14.1]
 gi|83842941|gb|EAP82108.1| hypothetical protein NAS141_10221 [Sulfitobacter sp. NAS-14.1]
          Length = 107

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 63/107 (58%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M ++ KM+   +++QGKM +++E + ++  EG +G G+V      K  L  + ID S+  
Sbjct: 1   MGDMAKMMKTAQQMQGKMAQLQEDMHNIIVEGESGAGLVKATCTAKGELKSLDIDPSIFN 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            D  E++EDLI+AA  DA  K  D   ++  ++TEG+ +P  +K PF
Sbjct: 61  GDEKEVVEDLILAAIKDAQTKATDRAQSEMSKLTEGMGLPADMKLPF 107


>gi|77464284|ref|YP_353788.1| hypothetical protein RSP_0711 [Rhodobacter sphaeroides 2.4.1]
 gi|126463126|ref|YP_001044240.1| hypothetical protein Rsph17029_2366 [Rhodobacter sphaeroides ATCC
           17029]
 gi|221640168|ref|YP_002526430.1| hypothetical protein RSKD131_2069 [Rhodobacter sphaeroides KD131]
 gi|332559173|ref|ZP_08413495.1| hypothetical protein RSWS8N_08960 [Rhodobacter sphaeroides WS8N]
 gi|77388702|gb|ABA79887.1| conserved hypothetical protein [Rhodobacter sphaeroides 2.4.1]
 gi|126104790|gb|ABN77468.1| conserved hypothetical protein 103 [Rhodobacter sphaeroides ATCC
           17029]
 gi|221160949|gb|ACM01929.1| Hypothetical Protein RSKD131_2069 [Rhodobacter sphaeroides KD131]
 gi|332276885|gb|EGJ22200.1| hypothetical protein RSWS8N_08960 [Rhodobacter sphaeroides WS8N]
          Length = 114

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 61/107 (57%), Gaps = 3/107 (2%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M+ +MK    F+E   KM +++E +  +   G +G G+V      K  LTG++ID S+  
Sbjct: 11  MAKMMKAAQGFQE---KMAQLQEDLGGMTVVGESGAGLVRATATAKGELTGLEIDPSIFV 67

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
               E++EDLI+AA  DA  K  +    +  ++TEGL +PPG+K PF
Sbjct: 68  ASEKEVVEDLILAAIKDAQSKASERAKEEMGKLTEGLGLPPGMKLPF 114


>gi|83749761|ref|ZP_00946737.1| Hypothetical transcriptional regulatory protein [Ralstonia
           solanacearum UW551]
 gi|207743467|ref|YP_002259859.1| hypothetical protein RSIPO_01645 [Ralstonia solanacearum IPO1609]
 gi|83723581|gb|EAP70783.1| Hypothetical transcriptional regulatory protein [Ralstonia
           solanacearum UW551]
 gi|206594864|emb|CAQ61791.1| conserved hypothetical protein [Ralstonia solanacearum IPO1609]
          Length = 115

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 44/111 (39%), Positives = 66/111 (59%), Gaps = 6/111 (5%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFE- 61
            I  ++ Q +++Q  M+KM+E ++ +E EG +G G+V V +  KN +  V ID SLL E 
Sbjct: 5   QIAGLMKQAQQMQENMKKMQEQLSQIEVEGVSGAGLVKVVMTCKNDVKRVSIDPSLLAEG 64

Query: 62  DNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLP-----IPPGLKFPF 107
           ++ E+LEDL+ AA +DA +K E     K   +T GL      +PPG K PF
Sbjct: 65  EDKELLEDLVAAAFNDAVRKAEATTQEKMGSVTSGLGGMAGMLPPGFKLPF 115


>gi|83941621|ref|ZP_00954083.1| hypothetical protein EE36_05293 [Sulfitobacter sp. EE-36]
 gi|83847441|gb|EAP85316.1| hypothetical protein EE36_05293 [Sulfitobacter sp. EE-36]
          Length = 114

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 63/107 (58%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M ++ KM+   +++QGKM +++E + ++  EG +G G+V      K  L  + ID S+  
Sbjct: 8   MGDMAKMMKTAQQMQGKMAQLQEDMHNIIVEGESGAGLVKATCTAKGELKSLDIDPSIFN 67

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            D  E++EDLI+AA  DA  K  D   ++  ++TEG+ +P  +K PF
Sbjct: 68  GDEKEVVEDLILAAIKDAQTKATDRAQSEMSKLTEGMGLPADMKLPF 114


>gi|310826415|ref|YP_003958772.1| hypothetical protein ELI_0795 [Eubacterium limosum KIST612]
 gi|308738149|gb|ADO35809.1| hypothetical protein ELI_0795 [Eubacterium limosum KIST612]
          Length = 116

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 63/92 (68%)

Query: 7   MVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEI 66
           M+ Q +++Q +M K +  +   E E  AGGG V V ++GK M+T VKID  ++ ED+VE+
Sbjct: 22  MMKQIQKMQDEMLKAQAELEEKEVEATAGGGAVKVTVSGKKMVTSVKIDPDVIDEDDVEM 81

Query: 67  LEDLIIAAHSDAHKKIEDLVATKTQEITEGLP 98
           LEDLI+AA ++A  K+E++  ++  ++T G+P
Sbjct: 82  LEDLIMAACNEALSKVEEMTESQMGKLTGGIP 113


>gi|17545911|ref|NP_519313.1| hypothetical protein RSc1192 [Ralstonia solanacearum GMI1000]
 gi|21264147|sp|Q8Y052|Y1192_RALSO RecName: Full=UPF0133 protein RSc1192
 gi|17428206|emb|CAD14894.1| conserved hypothetical protein [Ralstonia solanacearum GMI1000]
 gi|299067244|emb|CBJ38441.1| conserved protein of unknown function [Ralstonia solanacearum
           CMR15]
          Length = 115

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 44/111 (39%), Positives = 66/111 (59%), Gaps = 6/111 (5%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFE- 61
            I  ++ Q +++Q  M+KM+E ++ +E EG +G G+V V +  KN +  V ID SLL E 
Sbjct: 5   QIAGLMKQAQQMQENMKKMQEQLSQIEVEGVSGAGLVKVVMTCKNDVKRVSIDPSLLAEG 64

Query: 62  DNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLP-----IPPGLKFPF 107
           ++ E+LEDL+ AA +DA +K E     K   +T GL      +PPG K PF
Sbjct: 65  EDKELLEDLVAAAFNDAVRKAEATTQEKMGTVTSGLGGMASMLPPGFKLPF 115


>gi|109899203|ref|YP_662458.1| hypothetical protein Patl_2896 [Pseudoalteromonas atlantica T6c]
 gi|109701484|gb|ABG41404.1| conserved hypothetical protein 103 [Pseudoalteromonas atlantica
           T6c]
          Length = 99

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 34/98 (34%), Positives = 63/98 (64%), Gaps = 1/98 (1%)

Query: 10  QFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILED 69
           Q +++Q +M+K +E +  +E  G +G G+V V +   + +  V ID SL+ ED+ E++ED
Sbjct: 3   QAQQMQERMQKKQEELAKMEVTGESGAGLVKVTMTCNHNVRRVDIDDSLM-EDDKEMIED 61

Query: 70  LIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           L+ AA +DA +++++    +  ++T G+ +PPG K PF
Sbjct: 62  LVAAATNDAVRRVQETTKEQMADVTGGMAMPPGFKMPF 99


>gi|261855383|ref|YP_003262666.1| hypothetical protein Hneap_0770 [Halothiobacillus neapolitanus c2]
 gi|261835852|gb|ACX95619.1| conserved hypothetical protein [Halothiobacillus neapolitanus c2]
          Length = 108

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 66/105 (62%), Gaps = 4/105 (3%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           N+MK   Q +++Q KM++M+E +  +E  G +G G+V V + GK+ +  + ID SL+ +D
Sbjct: 8   NLMK---QAQQMQEKMQRMQEEVAKIEVTGESGAGLVKVTMTGKHEVRRLVIDDSLMGDD 64

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
             E+LEDLI AA +DA +++E         +T G+ +P G+K PF
Sbjct: 65  K-EMLEDLIAAAVNDAVRRVEHNQQEMMSSVTAGMNLPAGMKLPF 108


>gi|282849745|ref|ZP_06259129.1| DNA-binding protein, YbaB/EbfC family [Veillonella parvula ATCC
           17745]
 gi|282580682|gb|EFB86081.1| DNA-binding protein, YbaB/EbfC family [Veillonella parvula ATCC
           17745]
          Length = 109

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 37/103 (35%), Positives = 72/103 (69%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+  M+ + +++Q  M+KM+E + +   E + GGG V+V +NG+ ++  +K++ + + 
Sbjct: 6   MGNMAGMMKKVQKMQEDMKKMQEELKTRTVEASVGGGAVTVVMNGEKIIESLKLNPTAVD 65

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGL 103
            ++VE+LEDL++AA ++A KK++DL+A +  ++T GL +P GL
Sbjct: 66  PEDVEMLEDLVMAAVNEASKKVDDLLAQEMGKVTGGLNLPTGL 108


>gi|329896155|ref|ZP_08271368.1| Hypothetical protein IMCC3088_1912 [gamma proteobacterium IMCC3088]
 gi|328921974|gb|EGG29339.1| Hypothetical protein IMCC3088_1912 [gamma proteobacterium IMCC3088]
          Length = 109

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 38/98 (38%), Positives = 63/98 (64%), Gaps = 1/98 (1%)

Query: 10  QFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILED 69
           Q +E+Q KM+ ++  I +L+  G +G G+V V +NG++ +T V ID  ++ E+   ILED
Sbjct: 13  QAQEMQAKMQSVQAEIEALKVVGESGAGLVKVTMNGRHDVTAVDIDPMVMTEEKA-ILED 71

Query: 70  LIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           L+ AA +DA +++E     K  E+T G+ +P G+K PF
Sbjct: 72  LLAAAVNDAVRRVETQNREKMAEVTAGMNLPAGMKMPF 109


>gi|15617080|ref|NP_240293.1| hypothetical protein BU482 [Buchnera aphidicola str. APS
           (Acyrthosiphon pisum)]
 gi|219681832|ref|YP_002468218.1| hypothetical protein BUAP5A_475 [Buchnera aphidicola str. 5A
           (Acyrthosiphon pisum)]
 gi|219682387|ref|YP_002468771.1| hypothetical protein BUAPTUC7_476 [Buchnera aphidicola str. Tuc7
           (Acyrthosiphon pisum)]
 gi|257471535|ref|ZP_05635534.1| hypothetical protein BaphL_02410 [Buchnera aphidicola str. LSR1
           (Acyrthosiphon pisum)]
 gi|12644611|sp|P57554|Y482_BUCAI RecName: Full=UPF0133 protein BU482
 gi|254803948|sp|B8D9Q9|Y475_BUCA5 RecName: Full=UPF0133 protein BUAP5A_475
 gi|254803950|sp|B8D811|Y476_BUCAT RecName: Full=UPF0133 protein BUAPTUC7_476
 gi|25302532|pir||C84986 hypothetical protein [imported] - Buchnera sp. (strain APS)
 gi|10039145|dbj|BAB13179.1| hypothetical protein [Buchnera aphidicola str. APS (Acyrthosiphon
           pisum)]
 gi|219622120|gb|ACL30276.1| hypothetical protein BUAPTUC7_476 [Buchnera aphidicola str. Tuc7
           (Acyrthosiphon pisum)]
 gi|219624675|gb|ACL30830.1| hypothetical protein BUAP5A_475 [Buchnera aphidicola str. 5A
           (Acyrthosiphon pisum)]
 gi|311086206|gb|ADP66288.1| hypothetical protein CWO_02555 [Buchnera aphidicola str. LL01
           (Acyrthosiphon pisum)]
 gi|311086784|gb|ADP66865.1| hypothetical protein CWQ_02585 [Buchnera aphidicola str. TLW03
           (Acyrthosiphon pisum)]
 gi|311087372|gb|ADP67452.1| hypothetical protein CWS_02510 [Buchnera aphidicola str. JF99
           (Acyrthosiphon pisum)]
 gi|311087869|gb|ADP67948.1| hypothetical protein CWU_03170 [Buchnera aphidicola str. JF98
           (Acyrthosiphon pisum)]
          Length = 109

 Score = 74.3 bits (181), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 41/106 (38%), Positives = 65/106 (61%), Gaps = 4/106 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           + N+MK   Q +++Q KM K++E I  +E  G AG G+V V ING +    V++D SLL 
Sbjct: 7   LGNLMK---QAQQMQEKMAKIQEEIAQMEVTGEAGAGLVKVTINGAHNCRRVEVDPSLL- 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFP 106
           +D+ ++LEDL  AA +DA ++I ++   K   I+ G+ +P G   P
Sbjct: 63  QDDKDMLEDLAAAAFNDATRRISEVQKKKMSAISTGMQLPNGFNMP 108


>gi|88857872|ref|ZP_01132514.1| hypothetical protein PTD2_10819 [Pseudoalteromonas tunicata D2]
 gi|88819489|gb|EAR29302.1| hypothetical protein PTD2_10819 [Pseudoalteromonas tunicata D2]
          Length = 107

 Score = 74.3 bits (181), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 70/107 (65%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+MK   Q + +Q +M+K +E I ++E  G +G G+V V + G + +  V++D SL+ 
Sbjct: 5   MGNLMK---QAQMMQERMQKAQEEIANMEVVGESGAGLVKVTMLGNHNVRRVELDDSLM- 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ +++EDL+ AA +DA +++E+    +  ++T G+ +PPG K PF
Sbjct: 61  EDDKDMIEDLLAAAVNDAVRRVEEQSKDRMAKVTGGMQMPPGFKMPF 107


>gi|300704437|ref|YP_003746040.1| hypothetical protein RCFBP_20241 [Ralstonia solanacearum CFBP2957]
 gi|299072101|emb|CBJ43433.1| conserved protein of unknown function [Ralstonia solanacearum
           CFBP2957]
          Length = 115

 Score = 73.9 bits (180), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 44/111 (39%), Positives = 66/111 (59%), Gaps = 6/111 (5%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFE- 61
            I  ++ Q +++Q  M+KM+E ++ +E EG +G G+V V +  KN +  V ID SLL E 
Sbjct: 5   QIAGLMKQAQQMQENMKKMQEQLSQIEVEGVSGAGLVKVVMTCKNDVKRVSIDPSLLAEG 64

Query: 62  DNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLP-----IPPGLKFPF 107
           ++ E+LEDL+ AA +DA +K E     K   +T GL      +PPG K PF
Sbjct: 65  EDKELLEDLVAAAFNDAVRKAEATTQEKMGTVTSGLGGMAGMLPPGFKLPF 115


>gi|220932910|ref|YP_002509818.1| conserved hypothetical protein TIGR00103 [Halothermothrix orenii H
           168]
 gi|219994220|gb|ACL70823.1| conserved hypothetical protein TIGR00103 [Halothermothrix orenii H
           168]
          Length = 102

 Score = 73.9 bits (180), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 40/98 (40%), Positives = 64/98 (65%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           N+ K++ Q +++Q KM KM+E +     E  AGGG+V V +NGK  L  +KID   +  +
Sbjct: 2   NMNKLMKQAQKMQAKMAKMQEELEEKTVEATAGGGVVKVVLNGKQQLVDLKIDPDAVDPE 61

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           +VE+LEDLI+AA ++  +K+ D+V  +  +IT G+ IP
Sbjct: 62  DVEMLEDLILAAVNEGMRKVTDMVNKEMGKITGGMNIP 99


>gi|207723140|ref|YP_002253539.1| hypothetical protein RSMK00362 [Ralstonia solanacearum MolK2]
 gi|206588334|emb|CAQ35297.1| conserved hypothetical protein [Ralstonia solanacearum MolK2]
          Length = 115

 Score = 73.9 bits (180), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 63/104 (60%), Gaps = 6/104 (5%)

Query: 10  QFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFE-DNVEILE 68
           Q +++Q  M+KM+E ++ +E EG +G G+V V +  KN +  V ID SLL E ++ E+LE
Sbjct: 12  QAQQMQENMKKMQEQLSQIEVEGVSGAGLVKVVMTCKNDVKRVSIDPSLLAEGEDKELLE 71

Query: 69  DLIIAAHSDAHKKIEDLVATKTQEITEGLP-----IPPGLKFPF 107
           DL+ AA +DA +K E     K   +T GL      +PPG K PF
Sbjct: 72  DLVAAAFNDAVRKAEATTQEKMGSVTSGLGGMAGMLPPGFKLPF 115


>gi|197284052|ref|YP_002149924.1| hypothetical protein PMI0140 [Proteus mirabilis HI4320]
 gi|227358076|ref|ZP_03842418.1| conserved hypothetical protein [Proteus mirabilis ATCC 29906]
 gi|238693155|sp|B4EU78|Y140_PROMH RecName: Full=UPF0133 protein PMI0140
 gi|194681539|emb|CAR40453.1| conserved hypothetical protein [Proteus mirabilis HI4320]
 gi|227161811|gb|EEI46843.1| conserved hypothetical protein [Proteus mirabilis ATCC 29906]
          Length = 109

 Score = 73.9 bits (180), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 38/83 (45%), Positives = 54/83 (65%), Gaps = 1/83 (1%)

Query: 25  ITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKKIED 84
           I +LE  G +G G+V + ING +    V+ID SLL ED+ E+LEDLI AA +DA ++IE+
Sbjct: 28  IANLEVTGESGAGLVKITINGAHNCRRVEIDPSLL-EDDKEMLEDLIAAAFNDAARRIEE 86

Query: 85  LVATKTQEITEGLPIPPGLKFPF 107
               K   ++ G+ +PPG K PF
Sbjct: 87  TQKEKMASVSNGMQLPPGFKMPF 109


>gi|157146902|ref|YP_001454221.1| hypothetical protein CKO_02678 [Citrobacter koseri ATCC BAA-895]
 gi|283784298|ref|YP_003364163.1| hypothetical protein ROD_05291 [Citrobacter rodentium ICC168]
 gi|166228428|sp|A8AJX2|Y2678_CITK8 RecName: Full=UPF0133 protein CKO_02678
 gi|157084107|gb|ABV13785.1| hypothetical protein CKO_02678 [Citrobacter koseri ATCC BAA-895]
 gi|282947752|emb|CBG87308.1| conserved hypothetical protein [Citrobacter rodentium ICC168]
          Length = 109

 Score = 73.9 bits (180), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 38/83 (45%), Positives = 53/83 (63%), Gaps = 1/83 (1%)

Query: 25  ITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKKIED 84
           I  LE  G +G G+V V ING +    V+ID SLL ED+ E+LEDL+ AA +DA ++IE+
Sbjct: 28  IAKLEVTGESGAGLVKVTINGAHNCRRVEIDPSLL-EDDKEMLEDLVAAAFNDAARRIEE 86

Query: 85  LVATKTQEITEGLPIPPGLKFPF 107
               K   ++ G+ +PPG K PF
Sbjct: 87  TQKEKMASVSSGMQLPPGFKMPF 109


>gi|254460837|ref|ZP_05074253.1| conserved hypothetical protein TIGR00103 [Rhodobacterales bacterium
           HTCC2083]
 gi|206677426|gb|EDZ41913.1| conserved hypothetical protein TIGR00103 [Rhodobacteraceae
           bacterium HTCC2083]
          Length = 114

 Score = 73.9 bits (180), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 65/107 (60%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           + ++  M+ + KE+Q +M +++E + S+   G +GGG+V      K  L G+ ID S+  
Sbjct: 8   LGDMAGMMKKAKEMQDQMGQLQEDLASMTVVGESGGGLVKATATAKGELIGLDIDPSIFN 67

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            D  EI+EDLI+AA  +A +K  +  AT+  ++TEGL +P  +K PF
Sbjct: 68  GDEKEIVEDLILAAIKEAQQKASEKSATEMGKLTEGLGLPADMKLPF 114


>gi|119386356|ref|YP_917411.1| hypothetical protein Pden_3648 [Paracoccus denitrificans PD1222]
 gi|119376951|gb|ABL71715.1| conserved hypothetical protein 103 [Paracoccus denitrificans
           PD1222]
          Length = 113

 Score = 73.9 bits (180), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 61/105 (58%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           ++ KM+   +++QGKM +M+E +  L   G AG G+V      K  LT + ID S+   +
Sbjct: 9   DLSKMMEAAQQMQGKMAEMQEGLARLTVTGEAGAGLVKATATAKGELTALDIDPSIFKAE 68

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           + E++EDLI+AA  DA ++ +D  A +   +T  L +P  +K PF
Sbjct: 69  DKEVVEDLILAAIKDAQRRAQDKAAEEMARLTRELGLPGDMKMPF 113


>gi|256822249|ref|YP_003146212.1| hypothetical protein Kkor_1025 [Kangiella koreensis DSM 16069]
 gi|256795788|gb|ACV26444.1| conserved hypothetical protein [Kangiella koreensis DSM 16069]
          Length = 109

 Score = 73.9 bits (180), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 71/107 (66%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           + N+MK   Q +++Q KM++ +E I +LE    AG GMV V + G++ +  V+ID SL+ 
Sbjct: 7   LGNMMK---QAQQMQEKMQQAQEEIGNLEVTAEAGAGMVKVTMTGRHDVKRVEIDPSLM- 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ ++LEDL+ AA + A +K+E+    +  E+T+G+ +PPG+  PF
Sbjct: 63  EDDKDLLEDLVAAAVNAAVRKVEETTKARMAEVTKGMNLPPGMNLPF 109


>gi|313902766|ref|ZP_07836163.1| uncharacterized protein family UPF0133 [Thermaerobacter
           subterraneus DSM 13965]
 gi|313466886|gb|EFR62403.1| uncharacterized protein family UPF0133 [Thermaerobacter
           subterraneus DSM 13965]
          Length = 110

 Score = 73.9 bits (180), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 65/100 (65%), Gaps = 2/100 (2%)

Query: 6   KMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVE 65
           KM+ Q +++Q +M +++E +   E E  AGGGMV   +NG+  L  ++I R  +  D+VE
Sbjct: 8   KMLKQLEKMQQEMARLQEELGQREVEATAGGGMVKAVVNGRQELLRLEIAREAVDPDDVE 67

Query: 66  ILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP--PGL 103
           +L+D+I+AA ++A +K +++V  +   +T GL +P  PGL
Sbjct: 68  LLQDMIVAAVNEASRKAQEMVQAEMARVTGGLKLPKLPGL 107


>gi|310815374|ref|YP_003963338.1| hypothetical protein EIO_0890 [Ketogulonicigenium vulgare Y25]
 gi|308754109|gb|ADO42038.1| conserved hypothetical protein [Ketogulonicigenium vulgare Y25]
          Length = 114

 Score = 73.9 bits (180), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 34/107 (31%), Positives = 63/107 (58%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           + ++ KM+   +++Q KM++++E + +   EG +G G+V V +  K  +  + ID S+L 
Sbjct: 8   LGDMAKMMKTAQDMQEKMQRLQEDLENTVVEGQSGAGLVRVSVTAKGEIRALSIDPSILV 67

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
               E++EDLI+AA  D   +  +  A +T+ + +GL +PP  K PF
Sbjct: 68  ASEKEVVEDLILAAIRDGQSRAAERSAQETRRMADGLGLPPDFKLPF 114


>gi|21672732|ref|NP_660799.1| hypothetical protein BUsg467 [Buchnera aphidicola str. Sg
           (Schizaphis graminum)]
 gi|25009597|sp|Q8K982|Y467_BUCAP RecName: Full=UPF0133 protein BUsg_467
 gi|21623377|gb|AAM68010.1| hypothetical 12.0 kDa protein [Buchnera aphidicola str. Sg
           (Schizaphis graminum)]
          Length = 109

 Score = 73.9 bits (180), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 65/107 (60%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           + N+MK   Q +++Q KM K++E I  +E  G AG G+V V ING +    V++D SLL 
Sbjct: 7   LGNLMK---QAQQMQEKMAKVQEEIAKMEVTGEAGAGLVKVTINGAHNCRRVEVDPSLL- 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           +D+ ++LEDL  AA +DA ++I ++   K   I+ G+ +P G   P 
Sbjct: 63  KDDKDMLEDLAAAAFNDATRRISEVQKKKMSAISTGMQLPTGFNIPI 109


>gi|149916415|ref|ZP_01904934.1| 30S ribosomal protein S21 [Roseobacter sp. AzwK-3b]
 gi|149809685|gb|EDM69539.1| 30S ribosomal protein S21 [Roseobacter sp. AzwK-3b]
          Length = 114

 Score = 73.6 bits (179), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 38/107 (35%), Positives = 63/107 (58%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M ++ KM+   +E+Q KM  ++E + ++  EG +G G+V    + K  L  + ID S+  
Sbjct: 8   MGDMAKMMKAAQEMQQKMADLQEDMHNMMVEGVSGAGLVKATCSAKGELKALDIDPSIFN 67

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            D+ E++EDLI+AA  DA +K  D    +  ++TEGL +P  +K PF
Sbjct: 68  SDDKEVVEDLILAAIKDAQQKASDRAQEEMGKLTEGLGLPKDMKLPF 114


>gi|260427025|ref|ZP_05781004.1| conserved hypothetical protein [Citreicella sp. SE45]
 gi|260421517|gb|EEX14768.1| conserved hypothetical protein [Citreicella sp. SE45]
          Length = 114

 Score = 73.6 bits (179), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 35/107 (32%), Positives = 64/107 (59%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           + ++ KM+   +E+QGKM +++E + ++E  G +G G+V    + K  L  + ID S+  
Sbjct: 8   LGDMAKMMKAAQEMQGKMTQLQEDLKTMEVTGESGAGLVKATASAKGELRALDIDPSIFN 67

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            D+ E++EDLI+AA  DA  K ++    + Q++T  + +P  +K PF
Sbjct: 68  ADDKEVVEDLILAAVKDAQAKAQERAQEEMQKLTSEMGLPADMKLPF 114


>gi|149189266|ref|ZP_01867552.1| hypothetical protein VSAK1_10078 [Vibrio shilonii AK1]
 gi|148836825|gb|EDL53776.1| hypothetical protein VSAK1_10078 [Vibrio shilonii AK1]
          Length = 109

 Score = 73.6 bits (179), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 37/85 (43%), Positives = 55/85 (64%), Gaps = 1/85 (1%)

Query: 23  ESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKKI 82
           E I ++E  G +G G+V V I G +    V+ID SL+ ED+ E+LEDLI AA +DA +++
Sbjct: 26  EEIANMEVTGESGAGLVKVTITGSHSTRRVEIDESLM-EDDKEMLEDLIAAAFNDAARRV 84

Query: 83  EDLVATKTQEITEGLPIPPGLKFPF 107
           E+    K   +T G+ +PPG+K PF
Sbjct: 85  EETQKEKMASVTGGMQLPPGMKMPF 109


>gi|270263612|ref|ZP_06191881.1| hypothetical protein SOD_e02360 [Serratia odorifera 4Rx13]
 gi|270042496|gb|EFA15591.1| hypothetical protein SOD_e02360 [Serratia odorifera 4Rx13]
          Length = 109

 Score = 73.6 bits (179), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 54/83 (65%), Gaps = 1/83 (1%)

Query: 25  ITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKKIED 84
           +  LE  G +G G+V V ING +    V+ID+SL+ ED+ E+LEDLI AA +DA ++I++
Sbjct: 28  VAKLEVTGESGAGLVKVTINGAHNCRRVEIDQSLM-EDDKEMLEDLIAAAFNDAARRIDE 86

Query: 85  LVATKTQEITEGLPIPPGLKFPF 107
               K   ++ G+ +PPG K PF
Sbjct: 87  TQKEKMASVSSGMQLPPGFKMPF 109


>gi|255263800|ref|ZP_05343142.1| conserved hypothetical protein [Thalassiobium sp. R2A62]
 gi|255106135|gb|EET48809.1| conserved hypothetical protein [Thalassiobium sp. R2A62]
          Length = 114

 Score = 73.6 bits (179), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 63/107 (58%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M ++ KM+   +E+QGKM +++E + ++  +G +G G+V      K  L  + ID S+  
Sbjct: 8   MGDMGKMMKAAQEMQGKMAQLQEDMHNIMVQGESGAGLVKATATAKGELKTLDIDPSIFS 67

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            D+ E++EDLI+AA  DA  K  D    +  ++TEG+ +P  +K PF
Sbjct: 68  GDDKEVVEDLILAAIKDAQSKATDRAQQEMSKLTEGMGLPADMKLPF 114


>gi|237730454|ref|ZP_04560935.1| conserved hypothetical protein [Citrobacter sp. 30_2]
 gi|283834203|ref|ZP_06353944.1| putative cytoplasmic protein [Citrobacter youngae ATCC 29220]
 gi|226905993|gb|EEH91911.1| conserved hypothetical protein [Citrobacter sp. 30_2]
 gi|291070356|gb|EFE08465.1| putative cytoplasmic protein [Citrobacter youngae ATCC 29220]
          Length = 109

 Score = 73.6 bits (179), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 37/83 (44%), Positives = 53/83 (63%), Gaps = 1/83 (1%)

Query: 25  ITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKKIED 84
           +  LE  G +G G+V V ING +    V+ID SLL ED+ E+LEDL+ AA +DA ++IE+
Sbjct: 28  VAKLEVTGESGAGLVKVTINGAHNCRRVEIDPSLL-EDDKEMLEDLVAAAFNDAARRIEE 86

Query: 85  LVATKTQEITEGLPIPPGLKFPF 107
               K   ++ G+ +PPG K PF
Sbjct: 87  TQKEKMASVSSGMQLPPGFKMPF 109


>gi|163732698|ref|ZP_02140143.1| hypothetical protein RLO149_12690 [Roseobacter litoralis Och 149]
 gi|161394058|gb|EDQ18382.1| hypothetical protein RLO149_12690 [Roseobacter litoralis Och 149]
          Length = 104

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 37/101 (36%), Positives = 60/101 (59%)

Query: 7   MVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEI 66
           M+ + +E+Q KM +M+E + ++  EG +G G+V      K  L G+ ID S+   D+ E+
Sbjct: 4   MMKKAQEMQSKMAQMQEDMQNVIVEGVSGAGLVKATCTAKGELKGLDIDPSIFNSDDKEV 63

Query: 67  LEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           +EDLI+AA  DA  K  D    +  ++TEG+ +P  +K PF
Sbjct: 64  VEDLILAAIKDAQTKAADKAQEEMAKLTEGMGLPADMKLPF 104


>gi|269467849|gb|EEZ79592.1| hypothetical protein Sup05_0922 [uncultured SUP05 cluster
           bacterium]
          Length = 107

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 37/101 (36%), Positives = 64/101 (63%), Gaps = 2/101 (1%)

Query: 7   MVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEI 66
           M+ + +++Q  M+K +  I +L A G A GG V + +NG++  T ++ID  ++  D+ ++
Sbjct: 9   MMQKAQKMQEDMQKAQAEIKNLTATGKAAGGSVQITLNGEHQATNIQIDEGVM--DDKDM 66

Query: 67  LEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           LEDLI+ A +DA K+I D  A K + +T G+ +P G+  PF
Sbjct: 67  LEDLILTAINDATKQISDTAADKMKGVTGGMKLPDGMSLPF 107


>gi|296284717|ref|ZP_06862715.1| hypothetical protein CbatJ_13903 [Citromicrobium bathyomarinum
           JL354]
          Length = 113

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 34/93 (36%), Positives = 56/93 (60%)

Query: 14  IQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIA 73
           IQ +M   +  + S+E EG AGGG+V+V+   +  + GV ID SL+  +  +++EDL+ A
Sbjct: 18  IQSQMGDAQAKLDSIEVEGTAGGGLVTVKCTARGRILGVSIDESLMKPEEKQMVEDLVAA 77

Query: 74  AHSDAHKKIEDLVATKTQEITEGLPIPPGLKFP 106
           A +DA  K + + + + Q I  G+ +PPG   P
Sbjct: 78  AFNDARGKADRVSSEEMQRIQSGMGLPPGFNLP 110


>gi|291613733|ref|YP_003523890.1| hypothetical protein Slit_1266 [Sideroxydans lithotrophicus ES-1]
 gi|291583845|gb|ADE11503.1| conserved hypothetical protein [Sideroxydans lithotrophicus ES-1]
          Length = 107

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 36/98 (36%), Positives = 62/98 (63%), Gaps = 2/98 (2%)

Query: 10  QFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILED 69
           Q +++Q  M+K ++ + ++E EG +G GMV V +   + +  V +D+S+L  D+ E+LED
Sbjct: 12  QAQQMQANMKKAQDELATVEVEGQSGSGMVKVIMTCAHEVRRVNLDQSVL--DDKEMLED 69

Query: 70  LIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           LI+AA +DA+KK  +    +    T G+ +PPG+  PF
Sbjct: 70  LIVAALNDANKKAAETSQKRMSGFTAGMNLPPGMSLPF 107


>gi|34497066|ref|NP_901281.1| hypothetical protein CV_1611 [Chromobacterium violaceum ATCC 12472]
 gi|34102923|gb|AAQ59287.1| conserved hypothetical protein [Chromobacterium violaceum ATCC
           12472]
          Length = 115

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 65/108 (60%), Gaps = 2/108 (1%)

Query: 2   SNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLL-- 59
           + I  ++ Q +++Q  M+K +E +  +E EG +G GMV V +   + +  V ID S+L  
Sbjct: 8   AGIAGLMKQAQQMQENMKKAQEELAKVEVEGQSGAGMVKVTMTCSHDVKRVAIDDSVLED 67

Query: 60  FEDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            +++ E+LEDLI AA +DA +K+E     +    T GL +P G+KFPF
Sbjct: 68  AKEDKEMLEDLIAAAFNDAVRKVEATTQERMSGFTNGLNLPAGMKFPF 115


>gi|114565607|ref|YP_752761.1| hypothetical protein Swol_0031 [Syntrophomonas wolfei subsp. wolfei
           str. Goettingen]
 gi|114336542|gb|ABI67390.1| conserved hypothetical protein [Syntrophomonas wolfei subsp. wolfei
           str. Goettingen]
          Length = 99

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 36/95 (37%), Positives = 66/95 (69%)

Query: 6   KMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVE 65
           KM+ Q K++Q K+ KM+E +   E E ++GGG+V+V++NGK  L  ++I    +  D++E
Sbjct: 3   KMIKQAKQVQEKIVKMQEELREREIEASSGGGVVTVKVNGKQELVSIQIKPEAVDPDDLE 62

Query: 66  ILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           +LEDL++AA ++  +K +++V+++  +IT G  IP
Sbjct: 63  MLEDLVLAAVNEGIRKSQEMVSSEMAKITGGFNIP 97


>gi|255037753|ref|YP_003088374.1| hypothetical protein Dfer_4005 [Dyadobacter fermentans DSM 18053]
 gi|254950509|gb|ACT95209.1| conserved hypothetical protein [Dyadobacter fermentans DSM 18053]
          Length = 115

 Score = 72.8 bits (177), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 38/106 (35%), Positives = 67/106 (63%), Gaps = 1/106 (0%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M+++M ++G+ K+IQ +M++ +E +  +     +GGGMV   ++GK  L  + ID+ L+ 
Sbjct: 5   MADMMGLMGKMKDIQSRMKEAQEQLVHITETAESGGGMVKATVDGKRKLLTLDIDKDLIN 64

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEG-LPIPPGLKF 105
            D+ E+L+DLI+AA + A++ IE  +    Q+ T+G LP  PGL  
Sbjct: 65  SDDKEMLQDLIVAAVNKANENIESKIQQHLQKATDGVLPNIPGLDL 110


>gi|47117449|sp|Q7NXL5|Y1611_CHRVO RecName: Full=UPF0133 protein CV_1611
          Length = 112

 Score = 72.8 bits (177), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 65/108 (60%), Gaps = 2/108 (1%)

Query: 2   SNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLL-- 59
           + I  ++ Q +++Q  M+K +E +  +E EG +G GMV V +   + +  V ID S+L  
Sbjct: 5   AGIAGLMKQAQQMQENMKKAQEELAKVEVEGQSGAGMVKVTMTCSHDVKRVAIDDSVLED 64

Query: 60  FEDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            +++ E+LEDLI AA +DA +K+E     +    T GL +P G+KFPF
Sbjct: 65  AKEDKEMLEDLIAAAFNDAVRKVEATTQERMSGFTNGLNLPAGMKFPF 112


>gi|118578742|ref|YP_899992.1| hypothetical protein Ppro_0300 [Pelobacter propionicus DSM 2379]
 gi|118501452|gb|ABK97934.1| conserved hypothetical protein 103 [Pelobacter propionicus DSM
           2379]
          Length = 104

 Score = 72.8 bits (177), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 65/100 (65%), Gaps = 3/100 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           ++NIMK   Q + IQ KM K++E      AE  AGGG V+V +NGKN +  + I +  + 
Sbjct: 5   LANIMK---QAQMIQNKMAKLQEEAAQKTAESTAGGGAVTVTVNGKNEIISLSIKKEAVD 61

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
            ++VE+L+DL+IAA +DA KK++  ++ +  +IT G+ IP
Sbjct: 62  PEDVEMLQDLVIAAVNDALKKVQAELSEEMSKITGGMNIP 101


>gi|300113234|ref|YP_003759809.1| hypothetical protein Nwat_0524 [Nitrosococcus watsonii C-113]
 gi|299539171|gb|ADJ27488.1| conserved hypothetical protein [Nitrosococcus watsonii C-113]
          Length = 106

 Score = 72.8 bits (177), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 64/107 (59%), Gaps = 5/107 (4%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           + N+MK   Q +++Q  MEK +E + ++E  G AGGGMVS+ + G+     + I+  L  
Sbjct: 5   LGNLMK---QAQQLQSNMEKAQEELANMEVTGQAGGGMVSIVMTGRYDCRRISINNELWQ 61

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED  E++EDL+ AA +DA +++E     K   +T G+ +PPG K P 
Sbjct: 62  EDK-EMVEDLVAAAINDAVRQVETQSKEKMSSMTSGM-LPPGFKLPL 106


>gi|284041213|ref|YP_003391143.1| hypothetical protein Slin_6386 [Spirosoma linguale DSM 74]
 gi|283820506|gb|ADB42344.1| conserved hypothetical protein [Spirosoma linguale DSM 74]
          Length = 109

 Score = 72.8 bits (177), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 38/104 (36%), Positives = 65/104 (62%), Gaps = 1/104 (0%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           N+M M G+ KE+Q +M+  +E+++++   G+AG G+V V +NG   +  ++ID  L+  D
Sbjct: 2   NMMDMFGKMKEVQSRMKDAQENLSAVTETGDAGAGLVKVTVNGLKNVLKIEIDPDLIKPD 61

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEG-LPIPPGLKF 105
           + E+L+DLI+AA + A   +E     + ++ TEG LP  PGL  
Sbjct: 62  DREMLQDLIVAATNKAMSNVETKAREQLRQATEGLLPNIPGLNL 105


>gi|85717151|ref|ZP_01048110.1| hypothetical protein NB311A_02757 [Nitrobacter sp. Nb-311A]
 gi|85696042|gb|EAQ33941.1| hypothetical protein NB311A_02757 [Nitrobacter sp. Nb-311A]
          Length = 106

 Score = 72.8 bits (177), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 59/94 (62%)

Query: 1  MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
          M++ + M+ Q  + Q KM+ M++ +  +E EG +GGG+V+VR+  K  + G+ ID SL+ 
Sbjct: 1  MADFLGMMKQAAQFQSKMKAMQDELDHIEVEGTSGGGLVTVRMTAKMDVKGISIDPSLIK 60

Query: 61 EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEIT 94
           D  EILEDL++ A  DA +K E  +  K Q +T
Sbjct: 61 PDEREILEDLVVTALGDARRKAEVAMQEKMQALT 94


>gi|75674566|ref|YP_316987.1| hypothetical protein Nwi_0368 [Nitrobacter winogradskyi Nb-255]
 gi|123614210|sp|Q3SVQ6|Y368_NITWN RecName: Full=UPF0133 protein Nwi_0368
 gi|74419436|gb|ABA03635.1| Conserved hypothetical protein [Nitrobacter winogradskyi Nb-255]
          Length = 106

 Score = 72.8 bits (177), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 60/94 (63%)

Query: 1  MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
          M++ + M+ Q  + Q KM+ M++ +  +E +G +GGG+V+VR+  K  + G+ ID SL+ 
Sbjct: 1  MADFLGMMKQAAQFQSKMKAMQDELDQIEVDGASGGGLVTVRMTAKMEVKGISIDPSLIK 60

Query: 61 EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEIT 94
           D  EILEDL++ A +DA +K E  +  K Q +T
Sbjct: 61 PDEREILEDLVVTALADARRKAEVAMQEKMQALT 94


>gi|258593672|emb|CBE70013.1| conserved hypothetical protein; putative YbaB family protein [NC10
           bacterium 'Dutch sediment']
          Length = 104

 Score = 72.8 bits (177), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 35/103 (33%), Positives = 65/103 (63%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+  ++ Q + ++ + ++++    +   EG AGGGMV+V  NG+  +  VKID  +  
Sbjct: 1   MKNLGNLMKQAQRMKAEADRIQAEAATKRVEGTAGGGMVTVVCNGQGEVVAVKIDPEVAG 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGL 103
            D +E+L+DL++AA ++A +K  +L++ +   +T GL +PPGL
Sbjct: 61  PDELEMLQDLVVAATNEALRKARELLSQEMGRLTGGLGLPPGL 103


>gi|92116084|ref|YP_575813.1| hypothetical protein Nham_0463 [Nitrobacter hamburgensis X14]
 gi|122418735|sp|Q1QQZ4|Y463_NITHX RecName: Full=UPF0133 protein Nham_0463
 gi|91798978|gb|ABE61353.1| conserved hypothetical protein 103 [Nitrobacter hamburgensis X14]
          Length = 106

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 60/94 (63%)

Query: 1  MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
          M++ + M+ Q  ++Q KM+ M++ +  +E EG +GGG+VSVR+  K  +  + ID SL+ 
Sbjct: 1  MADFLGMMKQAAQLQSKMKAMQDELDHVEVEGASGGGLVSVRMTAKMEVKAISIDPSLMK 60

Query: 61 EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEIT 94
           D  EILEDL+++A  DA +K E  +  K Q +T
Sbjct: 61 PDEREILEDLVVSALGDARRKAEVAMQEKMQALT 94


>gi|297624593|ref|YP_003706027.1| hypothetical protein Trad_2375 [Truepera radiovictrix DSM 17093]
 gi|297165773|gb|ADI15484.1| conserved hypothetical protein [Truepera radiovictrix DSM 17093]
          Length = 106

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 33/83 (39%), Positives = 59/83 (71%)

Query: 3  NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
          N+ K++ + +  Q KM++ +E + +L  EG+AGGG+V+   NG+  +T +KID S +  D
Sbjct: 2  NMQKLMKEAQRAQQKMQEAQERLATLSVEGSAGGGLVTATANGEGTITAIKIDPSTVDPD 61

Query: 63 NVEILEDLIIAAHSDAHKKIEDL 85
          ++E+LEDL++AA +DA +K ++L
Sbjct: 62 DLELLEDLVMAAVNDAQRKAKEL 84


>gi|188578334|ref|YP_001915263.1| hypothetical protein PXO_02442 [Xanthomonas oryzae pv. oryzae
           PXO99A]
 gi|188522786|gb|ACD60731.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae
           PXO99A]
          Length = 98

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 38/98 (38%), Positives = 58/98 (59%), Gaps = 2/98 (2%)

Query: 10  QFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILED 69
           Q +++Q  +++ +E +  LE  G AGGGMV+V + G      V+ID S+L +   E+ ED
Sbjct: 3   QAQKMQENLQRAQEELAKLEVTGTAGGGMVNVTLTGAKECRKVRIDPSILSDQ--EMAED 60

Query: 70  LIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           LI AA +DA  KI+     +    T G+ +PPG+K PF
Sbjct: 61  LIAAAFNDASNKIDAESKDRMGSATAGMQLPPGMKLPF 98


>gi|157826352|ref|YP_001494072.1| hypothetical protein A1C_06705 [Rickettsia akari str. Hartford]
 gi|166228816|sp|A8GQ89|Y6705_RICAH RecName: Full=UPF0133 protein A1C_06705
 gi|157800310|gb|ABV75564.1| hypothetical protein A1C_06705 [Rickettsia akari str. Hartford]
          Length = 107

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 38/107 (35%), Positives = 59/107 (55%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N  + + Q + +Q KM++ +E + +    G AGGG+V + I GK  +  + ID SLL 
Sbjct: 1   MVNFNQFLKQAQSMQKKMQEAQEQMANARYTGKAGGGLVEIIITGKGEVAKISIDESLLK 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            +  E+LEDLI  A +DA +K ++           G+ +PPG K PF
Sbjct: 61  SEEKEMLEDLIKVAFNDAKQKCDEDSQNSLSGALNGMSLPPGFKMPF 107


>gi|302035664|ref|YP_003795986.1| hypothetical protein NIDE0279 [Candidatus Nitrospira defluvii]
 gi|300603728|emb|CBK40059.1| conserved protein of unknown function, UPF0133 [Candidatus
           Nitrospira defluvii]
          Length = 107

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 65/100 (65%), Gaps = 3/100 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           MSNI+K   Q + +Q +M K++E   +    G AGGG+V+V +NG   L  VKID  ++ 
Sbjct: 8   MSNILK---QAQAMQEQMAKVQEQAATKTVSGTAGGGIVTVTVNGAMDLLSVKIDPEVVK 64

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
             +VE+L+DL++AA +DA KK  +++A + + +T G+ IP
Sbjct: 65  AGDVEMLQDLVVAAGNDALKKSREMMAEEMKAVTGGMKIP 104


>gi|77166052|ref|YP_344577.1| hypothetical protein Noc_2594 [Nitrosococcus oceani ATCC 19707]
 gi|254436304|ref|ZP_05049810.1| conserved hypothetical protein TIGR00103 [Nitrosococcus oceani
           AFC27]
 gi|123593517|sp|Q3J7Z9|Y2594_NITOC RecName: Full=UPF0133 protein Noc_2594
 gi|76884366|gb|ABA59047.1| Conserved hypothetical protein 103 [Nitrosococcus oceani ATCC
           19707]
 gi|207087994|gb|EDZ65267.1| conserved hypothetical protein TIGR00103 [Nitrosococcus oceani
           AFC27]
          Length = 106

 Score = 72.0 bits (175), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 66/107 (61%), Gaps = 5/107 (4%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           + N+MK   Q +++Q  MEK +E + ++E  G AGGGMVS+ + G+     + I  S L+
Sbjct: 5   LGNLMK---QAQQLQSNMEKAQEELANMEVTGQAGGGMVSIVMTGRYDCRRISI-HSELW 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           +++ E++EDL+ AA +DA +++E     K   +T G+ +PPG K P 
Sbjct: 61  QEDKEMVEDLVAAAINDAVRQVETQSKEKMSSMTSGM-LPPGFKLPL 106


>gi|291278575|ref|YP_003495410.1| hypothetical protein DEFDS_0142 [Deferribacter desulfuricans SSM1]
 gi|290753277|dbj|BAI79654.1| conserved hypothetical protein [Deferribacter desulfuricans SSM1]
          Length = 104

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 39/104 (37%), Positives = 70/104 (67%), Gaps = 4/104 (3%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           NI +++ Q +++Q KM +M+E       E +AGGGMV+V++NGK  L  +KI++ ++  +
Sbjct: 2   NIQQLMKQAQKMQKKMLEMQEEAAKEVVEASAGGGMVTVKVNGKQELVEIKIEKDVVDPE 61

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFP 106
           +VE+L+DL++AA ++  KK ++L+  K  ++T G+    GL FP
Sbjct: 62  DVEMLQDLVLAAVNEGIKKSQELMQEKMSKLTGGM----GLNFP 101


>gi|241762402|ref|ZP_04760481.1| conserved hypothetical protein [Zymomonas mobilis subsp. mobilis
           ATCC 10988]
 gi|241373089|gb|EER62738.1| conserved hypothetical protein [Zymomonas mobilis subsp. mobilis
           ATCC 10988]
          Length = 110

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 57/90 (63%)

Query: 18  MEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSD 77
           M + +  + +++ EG +GGG+V ++   K  +TGV+ID +LL     ++LEDLI+AA +D
Sbjct: 21  MGEAQAKLDTIDVEGASGGGLVKIKATAKGRITGVEIDETLLVPAEKQMLEDLIVAACND 80

Query: 78  AHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
              K ++    +  ++T+G+P+PPG+  P 
Sbjct: 81  VKAKADEASNAEMSKMTQGMPLPPGMNLPL 110


>gi|56551758|ref|YP_162597.1| hypothetical protein ZMO0862 [Zymomonas mobilis subsp. mobilis ZM4]
 gi|260752671|ref|YP_003225564.1| hypothetical protein Za10_0430 [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
 gi|56543332|gb|AAV89486.1| conserved hypothetical protein [Zymomonas mobilis subsp. mobilis
           ZM4]
 gi|258552034|gb|ACV74980.1| conserved hypothetical protein [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
          Length = 110

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 57/90 (63%)

Query: 18  MEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSD 77
           M + +  + +++ EG +GGG+V ++   K  +TGV+ID +LL     ++LEDLI+AA +D
Sbjct: 21  MGEAQAKLDTIDVEGASGGGLVKIKATAKGRITGVEIDETLLVPAEKQMLEDLIVAACND 80

Query: 78  AHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
              K ++    +  ++T+G+P+PPG+  P 
Sbjct: 81  VKAKADEASNAEMSKMTQGMPLPPGMNLPL 110


>gi|297183473|gb|ADI19604.1| uncharacterized protein conserved in bacteria [uncultured SAR11
           cluster bacterium HF0770_37D02]
          Length = 93

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 61/94 (64%), Gaps = 1/94 (1%)

Query: 14  IQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIA 73
           +Q KM++ +E++  +E EG +GG  V + +NG   L  + ++ +LL E   EI+EDLI+A
Sbjct: 1   MQEKMKETQEALKKIEVEGISGGNAVRIIMNGDGELKKISLNDTLLKESK-EIVEDLIVA 59

Query: 74  AHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           AH+DA  K++   + +  ++T G+ +PPG K PF
Sbjct: 60  AHNDAKSKLKKKTSEEISKVTGGVTLPPGFKLPF 93


>gi|326385523|ref|ZP_08207162.1| hypothetical protein Y88_1728 [Novosphingobium nitrogenifigens DSM
           19370]
 gi|326210062|gb|EGD60840.1| hypothetical protein Y88_1728 [Novosphingobium nitrogenifigens DSM
           19370]
          Length = 111

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 54/94 (57%)

Query: 14  IQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIA 73
           IQ +ME  +  +  +E EG AGGG+V ++ + K  + GV ID SLL      ILEDL++A
Sbjct: 18  IQKQMEDAQSRLDGIEVEGVAGGGLVRIKASAKGRVIGVAIDDSLLVPSEKGILEDLVVA 77

Query: 74  AHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           A +DA  K +   + + Q++     IP G K PF
Sbjct: 78  AFNDARGKADGAASEEMQKVQMASGIPAGFKLPF 111


>gi|89069707|ref|ZP_01157043.1| hypothetical protein OG2516_09203 [Oceanicola granulosus HTCC2516]
 gi|89044653|gb|EAR50764.1| hypothetical protein OG2516_09203 [Oceanicola granulosus HTCC2516]
          Length = 114

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 34/107 (31%), Positives = 64/107 (59%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           + ++ KM+   +E+Q KM +++E +  +E  G +G G+V    + K  L  + ID S+  
Sbjct: 8   LGDMAKMMKSAQEMQAKMAELQEQMDQMEVTGESGAGLVKAVASVKGELKSLDIDPSIFD 67

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            +  E++EDLI+AA  DA  + ++ +  + + + EG+ +PPG+K PF
Sbjct: 68  PNEKEVVEDLILAAIKDAQSRAQERMQKEMERMAEGMGLPPGMKLPF 114


>gi|149186800|ref|ZP_01865110.1| hypothetical protein ED21_25217 [Erythrobacter sp. SD-21]
 gi|148829467|gb|EDL47908.1| hypothetical protein ED21_25217 [Erythrobacter sp. SD-21]
          Length = 113

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 35/93 (37%), Positives = 57/93 (61%)

Query: 14  IQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIA 73
           IQ +M + +  + ++E EG AGGG+V VR   +  + GV+ID SL+  +  +++EDL+ A
Sbjct: 18  IQTQMNEAQAKLDTIEVEGAAGGGLVKVRATARGRIIGVEIDESLMKPEEKQMVEDLVAA 77

Query: 74  AHSDAHKKIEDLVATKTQEITEGLPIPPGLKFP 106
           A +DA  K +   A + Q I  G+ +PPG+  P
Sbjct: 78  AFNDARDKADRKSAEEMQAIQGGMGLPPGMNIP 110


>gi|260574232|ref|ZP_05842237.1| conserved hypothetical protein [Rhodobacter sp. SW2]
 gi|259023698|gb|EEW26989.1| conserved hypothetical protein [Rhodobacter sp. SW2]
          Length = 114

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 61/107 (57%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           + ++ KM+   K++Q KM +++  +  +   G +G G+V  R   K  LTG++ID S+  
Sbjct: 8   LGDMGKMMKAAKDLQEKMAQLQSDMDRIVVIGESGAGLVKARCTAKGELTGLEIDPSIFV 67

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
               E++EDLI+AA  DA  K       +  ++TEGL +PPG+  PF
Sbjct: 68  ASEKEVVEDLILAAIKDAQGKAGARSQQEMAKLTEGLGLPPGMNLPF 114


>gi|90407633|ref|ZP_01215813.1| hypothetical protein PCNPT3_08784 [Psychromonas sp. CNPT3]
 gi|90311224|gb|EAS39329.1| hypothetical protein PCNPT3_08784 [Psychromonas sp. CNPT3]
          Length = 110

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 66/107 (61%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M ++MK   + +E+Q  M+K +  I + E  G +G G+V + + G + +  V+ID  L+ 
Sbjct: 8   MGDLMK---KAQEMQANMQKAQAEIANTEVVGESGAGLVKITLLGNHNVRKVEIDDELMS 64

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           +D  E+LEDLI AA +DA ++IE++   K   IT G+ +PPG K PF
Sbjct: 65  DDK-EMLEDLIAAAVNDAVRRIEEVNKDKMSGITGGMELPPGFKMPF 110


>gi|85857924|ref|YP_460126.1| hypothetical protein SYN_00162 [Syntrophus aciditrophicus SB]
 gi|85721015|gb|ABC75958.1| hypothetical protein SYN_00162 [Syntrophus aciditrophicus SB]
          Length = 104

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 36/98 (36%), Positives = 67/98 (68%), Gaps = 3/98 (3%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           NIMK   Q K +Q KM +++E + S   E  AGGGMVSV +NG+  +  ++I++ ++  +
Sbjct: 7   NIMK---QAKALQEKMARLQEELASRTVEATAGGGMVSVTVNGRFEVVSLRIEKDVVNPE 63

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           ++E+L+DLI+AA ++  +K +++ +++  +IT G+ IP
Sbjct: 64  DLEMLQDLIVAAVNEGIRKAQEMTSSEMAKITGGMNIP 101


>gi|258510126|ref|YP_003183560.1| hypothetical protein Aaci_0107 [Alicyclobacillus acidocaldarius
           subsp. acidocaldarius DSM 446]
 gi|257476852|gb|ACV57171.1| conserved hypothetical protein [Alicyclobacillus acidocaldarius
           subsp. acidocaldarius DSM 446]
          Length = 103

 Score = 71.6 bits (174), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 63/100 (63%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+ +++ Q K++Q ++ K + S+     EG AGGG V VR+NG   +  V+ID+S++ 
Sbjct: 1   MKNMNQLMRQAKKMQEEILKAQASLAEKVVEGTAGGGAVKVRMNGHKDVVAVEIDKSVVS 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
            D+V++L+DLI+ A  DA +K  DLV     + T GL +P
Sbjct: 61  PDDVDMLQDLILVAIQDASQKANDLVEEVMGKYTRGLNLP 100


>gi|167038579|ref|YP_001666157.1| hypothetical protein Teth39_2199 [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|307267451|ref|ZP_07548939.1| conserved hypothetical protein [Thermoanaerobacter wiegelii Rt8.B1]
 gi|320116974|ref|YP_004187133.1| hypothetical protein Thebr_2245 [Thermoanaerobacter brockii subsp.
           finnii Ako-1]
 gi|238687644|sp|B0K801|Y2199_THEP3 RecName: Full=UPF0133 protein Teth39_2199
 gi|166857413|gb|ABY95821.1| conserved hypothetical protein 103 [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|306917532|gb|EFN47818.1| conserved hypothetical protein [Thermoanaerobacter wiegelii Rt8.B1]
 gi|319930065|gb|ADV80750.1| Uncharacterized protein family UPF0133 [Thermoanaerobacter brockii
           subsp. finnii Ako-1]
          Length = 111

 Score = 71.6 bits (174), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 37/98 (37%), Positives = 64/98 (65%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           NI  M+ Q +++Q +++KM+E +     E  AGGGMV    NG+  L  ++I+  ++ +D
Sbjct: 11  NINNMIKQAQQMQEEIKKMQEELMQKTVEATAGGGMVKAVANGRKELVSIEINPDVVDKD 70

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           +VE LEDL++AA + A +  E+++A++  +IT GL IP
Sbjct: 71  DVETLEDLVLAAVNQALRNAEEMIASEMAKITGGLNIP 108


>gi|293392502|ref|ZP_06636822.1| conserved hypothetical protein [Serratia odorifera DSM 4582]
 gi|291424904|gb|EFE98113.1| conserved hypothetical protein [Serratia odorifera DSM 4582]
          Length = 109

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 53/83 (63%), Gaps = 1/83 (1%)

Query: 25  ITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKKIED 84
           +  LE  G +G G+V V ING +    V+ID SL+ ED+ ++LEDLI AA +DA +++E+
Sbjct: 28  VAKLEVTGESGAGLVKVTINGAHNCRRVEIDPSLM-EDDKDMLEDLIAAAFNDAARRVEE 86

Query: 85  LVATKTQEITEGLPIPPGLKFPF 107
               K   ++ G+ +PPG K PF
Sbjct: 87  TQKEKMASVSSGMQLPPGFKMPF 109


>gi|331005833|ref|ZP_08329188.1| hypothetical protein IMCC1989_2509 [gamma proteobacterium IMCC1989]
 gi|330420353|gb|EGG94664.1| hypothetical protein IMCC1989_2509 [gamma proteobacterium IMCC1989]
          Length = 106

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 66/107 (61%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           + +IMK   Q + +Q  M+KM+E + + +  G +G GMV V +NG++ +  V ID SLL 
Sbjct: 4   LGDIMK---QAQAMQENMKKMQEELANKQVCGESGAGMVKVTMNGRHDVKKVDIDPSLLS 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           E+   I+EDL+ AA +DA +K+E        ++T GL +PPG K PF
Sbjct: 61  EEKT-IIEDLLAAAVNDAVRKVELENKNMMGDLTGGLQMPPGFKMPF 106


>gi|85373564|ref|YP_457626.1| hypothetical protein ELI_03685 [Erythrobacter litoralis HTCC2594]
 gi|84786647|gb|ABC62829.1| hypothetical protein ELI_03685 [Erythrobacter litoralis HTCC2594]
          Length = 118

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 35/93 (37%), Positives = 56/93 (60%)

Query: 14  IQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIA 73
           IQ +M + +  + ++E EG AGGG+V VR   K  + GV ID SL+  +  +++EDL+ A
Sbjct: 23  IQTQMNEAQAKLDAIEVEGVAGGGLVKVRCTAKGRILGVSIDDSLMKPEEKQMVEDLVAA 82

Query: 74  AHSDAHKKIEDLVATKTQEITEGLPIPPGLKFP 106
           A +DA  K + +   + Q+I  G+ +PPG   P
Sbjct: 83  AFNDARGKADRVSNDEMQKIQSGIGLPPGFNLP 115


>gi|260881248|ref|ZP_05404002.2| putative cytoplasmic protein [Mitsuokella multacida DSM 20544]
 gi|260849400|gb|EEX69407.1| putative cytoplasmic protein [Mitsuokella multacida DSM 20544]
          Length = 111

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 35/103 (33%), Positives = 70/103 (67%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+  M+ + +++Q +M+KM++ +     +  AGGG V + +NG+  +  + ID + + 
Sbjct: 8   MGNMAGMMKKVQKMQNEMKKMQDELKRKTVDVTAGGGAVKIVMNGEKQVQSLTIDPAAVD 67

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGL 103
            ++VE+L+DLI AA ++A KK+++++A++  ++T GL +PPGL
Sbjct: 68  PEDVEMLQDLISAAFNEATKKVDEMMASEMGKLTSGLGLPPGL 110


>gi|110678388|ref|YP_681395.1| hypothetical protein RD1_1046 [Roseobacter denitrificans OCh 114]
 gi|109454504|gb|ABG30709.1| conserved hypothetical protein [Roseobacter denitrificans OCh 114]
          Length = 114

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 36/107 (33%), Positives = 63/107 (58%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           + ++  M+ + +E+Q KM +M+E + ++  EG +G G+V      K  L G+ ID S+  
Sbjct: 8   LGDMAGMMKKAQEMQAKMAQMQEDMQNVIVEGVSGAGLVKATCTAKGELKGLDIDPSIFN 67

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            D+ E++EDLI+AA  DA  K  +    +  ++TEG+ +P  +K PF
Sbjct: 68  SDDKEVVEDLILAAIKDAQTKAAEKAQEEMAKLTEGMGLPADMKLPF 114


>gi|304315582|ref|YP_003850727.1| hypothetical protein Tthe_0051 [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
 gi|302777084|gb|ADL67643.1| conserved hypothetical protein [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
          Length = 111

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 38/98 (38%), Positives = 65/98 (66%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           N+  M+ Q +++Q +M+KM+E + +   E +AGGG V V  NG+  L  +KID +++ +D
Sbjct: 11  NMNNMIKQAQQMQEQMKKMQEELENKTVEESAGGGAVKVVANGRKELISIKIDPAVVDKD 70

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           +VE+LEDL++AA + A +  E ++A +  +IT G  IP
Sbjct: 71  DVEMLEDLVLAAVNQALRSAERMIAEEMGKITGGFNIP 108


>gi|71906446|ref|YP_284033.1| hypothetical protein Daro_0807 [Dechloromonas aromatica RCB]
 gi|123628052|sp|Q47HW8|Y807_DECAR RecName: Full=UPF0133 protein Daro_0807
 gi|71846067|gb|AAZ45563.1| Conserved hypothetical protein 103 [Dechloromonas aromatica RCB]
          Length = 107

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 41/98 (41%), Positives = 58/98 (59%), Gaps = 2/98 (2%)

Query: 10  QFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILED 69
           Q + +Q  M+K +E +  +E EG AG GMV V +   + +  V ID S++  D+ E+LED
Sbjct: 12  QAQAMQENMKKAQEQLAQVEVEGVAGAGMVKVLMTCAHEVRRVNIDPSVM--DDREMLED 69

Query: 70  LIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           LI AA +DA ++ E L   K    T GL +PPG K PF
Sbjct: 70  LIAAALNDAVRRGEALSKDKMSGFTSGLNLPPGFKLPF 107


>gi|213427144|ref|ZP_03359894.1| hypothetical protein SentesTyphi_16945 [Salmonella enterica
          subsp. enterica serovar Typhi str. E02-1180]
          Length = 105

 Score = 71.2 bits (173), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 40/84 (47%), Positives = 58/84 (69%), Gaps = 4/84 (4%)

Query: 1  MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
          + N+MK   Q +++Q KM+KM+E I  LE  G +G G+V V ING +    V+ID SLL 
Sbjct: 7  LGNLMK---QAQQMQEKMQKMQEEIAQLEVTGESGAGLVKVTINGAHNCRRVEIDPSLL- 62

Query: 61 EDNVEILEDLIIAAHSDAHKKIED 84
          ED+ E+LEDL+ AA +DA ++IE+
Sbjct: 63 EDDKEMLEDLVAAAFNDAARRIEE 86


>gi|192358910|ref|YP_001982901.1| hypothetical protein CJA_2440 [Cellvibrio japonicus Ueda107]
 gi|190685075|gb|ACE82753.1| conserved hypothetical protein TIGR00103 [Cellvibrio japonicus
           Ueda107]
          Length = 105

 Score = 70.9 bits (172), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 55/88 (62%), Gaps = 1/88 (1%)

Query: 20  KMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAH 79
           KM+E +   E  G AG G+VSV +NG++ +  V ID SLL ED  E+LEDL+ AA +DA 
Sbjct: 19  KMQEDLAKAEVTGEAGAGLVSVVMNGRHDVKRVSIDDSLLSEDK-EMLEDLLAAAVNDAV 77

Query: 80  KKIEDLVATKTQEITEGLPIPPGLKFPF 107
           +K+E     +  +IT G+ IP   K PF
Sbjct: 78  RKVEQNNREQMAKITSGMGIPADFKMPF 105


>gi|42525062|ref|NP_970442.1| hypothetical protein Bd3732 [Bdellovibrio bacteriovorus HD100]
 gi|39577273|emb|CAE81096.1| conserved hypothetical protein [Bdellovibrio bacteriovorus HD100]
          Length = 107

 Score = 70.9 bits (172), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 65/100 (65%), Gaps = 3/100 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M+ +MK   Q  ++Q KM+K +E +  +E E  +GGG V V++NG +++T + ID  +L 
Sbjct: 8   MAQLMK---QANQMQMKMKKAQEELAKVEYEATSGGGAVKVKVNGDHLITALTIDPEVLK 64

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
             +VE+L+D+I++A ++A K   D  A + ++IT GL IP
Sbjct: 65  AGDVEMLQDMILSATNEAVKTARDTSAKEMEKITGGLNIP 104


>gi|34581072|ref|ZP_00142552.1| hypothetical protein [Rickettsia sibirica 246]
 gi|28262457|gb|EAA25961.1| unknown [Rickettsia sibirica 246]
          Length = 107

 Score = 70.9 bits (172), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 38/107 (35%), Positives = 58/107 (54%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N  + + Q + +Q KM++ +E + +    G AGGG+V V   GK  +  + ID SLL 
Sbjct: 1   MVNFNQFLKQAQSMQKKMQEAQEQMANARYTGKAGGGLVEVIATGKGKVEKISIDESLLK 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            +  E+LEDLI  A +DA +K ++           G+ +PPG K PF
Sbjct: 61  AEEKEMLEDLIKVAFNDAQQKCDEDSQNSLSGALNGMRLPPGFKMPF 107


>gi|309390265|gb|ADO78145.1| Uncharacterized protein family UPF0133 [Halanaerobium praevalens
           DSM 2228]
          Length = 102

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 35/98 (35%), Positives = 66/98 (67%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           N+ KM+ Q +++Q KM+KM++ + S   E  AGGG V V +NGK  +  ++ID  ++  D
Sbjct: 2   NMQKMMKQAQKMQAKMQKMQKEMESKTLEATAGGGAVKVVVNGKQEVVDLQIDPEVVDSD 61

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           +VE+LEDL++AA +   ++++++V  +  ++T G+ +P
Sbjct: 62  DVEMLEDLVLAAVNQGMREMQEMVNDEMGKVTGGMNLP 99


>gi|257091957|ref|YP_003165598.1| hypothetical protein CAP2UW1_0312 [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
 gi|257044481|gb|ACV33669.1| conserved hypothetical protein [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
          Length = 107

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 38/104 (36%), Positives = 62/104 (59%), Gaps = 2/104 (1%)

Query: 4   IMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDN 63
           I  ++ Q +++Q  M+K +E +  LE EG +G GMV V +   + +  V ID S++  D+
Sbjct: 6   IAGLMKQAQQMQENMKKAQEQLAQLEVEGQSGAGMVKVLMTCGHDVRRVAIDPSVM--DD 63

Query: 64  VEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            E+LEDL+ AA +DA ++ E +   +    + GL +PPG K PF
Sbjct: 64  REMLEDLVAAALNDAMRRAEQVSQERMAGFSAGLNLPPGFKMPF 107


>gi|118579239|ref|YP_900489.1| hypothetical protein Ppro_0801 [Pelobacter propionicus DSM 2379]
 gi|118501949|gb|ABK98431.1| conserved hypothetical protein 103 [Pelobacter propionicus DSM
           2379]
          Length = 104

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 64/100 (64%), Gaps = 3/100 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M+NI+K   Q + IQ KM K++E+     AE  +GGG V+V +NGKN +  + I + ++ 
Sbjct: 5   MTNILK---QAQMIQAKMSKLQENAAMKTAEATSGGGAVTVAVNGKNEILSLSIQKQVVD 61

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
            ++VE+L+DLI AA + A KK++D ++ +   IT G  IP
Sbjct: 62  PEDVEMLQDLIRAAVNQALKKVQDELSGEMSRITGGRSIP 101


>gi|124267719|ref|YP_001021723.1| hypothetical protein Mpe_A2533 [Methylibium petroleiphilum PM1]
 gi|166228397|sp|A2SIU9|Y2533_METPP RecName: Full=UPF0133 protein Mpe_A2533
 gi|124260494|gb|ABM95488.1| conserved hypothetical protein [Methylibium petroleiphilum PM1]
          Length = 108

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 66/107 (61%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           ++ +MK   Q + +Q  ++K ++ +  +E EG +G G+V V +  K+ +  + ID SLL 
Sbjct: 6   LAGLMK---QAQAMQDNLKKAQDELALIEVEGQSGAGLVKVLMTCKHDVKRITIDPSLLA 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           +D  ++LEDL+ AA +DA ++       K  ++T G+P+PPG+K PF
Sbjct: 63  DDK-DMLEDLVAAAFNDAVRRAAATSEEKMGKLTAGMPLPPGMKLPF 108


>gi|227328731|ref|ZP_03832755.1| hypothetical protein PcarcW_15883 [Pectobacterium carotovorum
           subsp. carotovorum WPP14]
 gi|261822477|ref|YP_003260583.1| hypothetical protein Pecwa_3234 [Pectobacterium wasabiae WPP163]
 gi|261606490|gb|ACX88976.1| conserved hypothetical protein [Pectobacterium wasabiae WPP163]
          Length = 109

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 53/83 (63%), Gaps = 1/83 (1%)

Query: 25  ITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKKIED 84
           + +LE  G +G G+V + ING +    V+ID SL+ ED+ E+LEDLI AA +DA ++I +
Sbjct: 28  VANLEVTGESGAGLVKITINGAHNCRRVEIDPSLM-EDDKEMLEDLIAAAFNDAARRIAE 86

Query: 85  LVATKTQEITEGLPIPPGLKFPF 107
               K   ++ G+ +PPG K PF
Sbjct: 87  TQKEKMASVSSGMQLPPGFKMPF 109


>gi|51891152|ref|YP_073843.1| hypothetical protein STH14 [Symbiobacterium thermophilum IAM 14863]
 gi|51854841|dbj|BAD38999.1| conserved hypothetical protein [Symbiobacterium thermophilum IAM
           14863]
          Length = 109

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 64/102 (62%), Gaps = 1/102 (0%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           N+ +++ Q +++Q KM + +E I  +  EG AGGG V V + G   +T VK+   ++  D
Sbjct: 7   NMQQIMRQVQKMQKKMAEAQEEIAKMTVEGTAGGGSVRVTVTGDRRVTEVKLAPEVVDPD 66

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQE-ITEGLPIPPGL 103
           ++E+L+DLI+AA SD  KK E+L   + ++ I  GLP  PGL
Sbjct: 67  DIEMLQDLIVAAISDGMKKAEELAEAEMKKVIPGGLPSFPGL 108


>gi|242279901|ref|YP_002992030.1| hypothetical protein Desal_2435 [Desulfovibrio salexigens DSM 2638]
 gi|242122795|gb|ACS80491.1| conserved hypothetical protein [Desulfovibrio salexigens DSM 2638]
          Length = 103

 Score = 70.5 bits (171), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 66/94 (70%)

Query: 7   MVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEI 66
           +V Q + +Q KM  ++E + + E E +AGGGMV+V++NG + +  +KID +++   +VE+
Sbjct: 7   LVRQAQIMQRKMTALQEDLKTREVESSAGGGMVNVKVNGSSEVLEIKIDPTIVESGDVEM 66

Query: 67  LEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           ++DL++AA +DA+KK + ++ ++   IT G+ IP
Sbjct: 67  IQDLVLAAVNDANKKAKAMMESEMSSITGGMNIP 100


>gi|20806578|ref|NP_621749.1| hypothetical protein TTE0040 [Thermoanaerobacter tengcongensis MB4]
 gi|25009579|sp|Q8RDI5|Y040_THETN RecName: Full=UPF0133 protein TTE0040
 gi|20515020|gb|AAM23353.1| conserved hypothetical protein [Thermoanaerobacter tengcongensis
           MB4]
          Length = 111

 Score = 70.5 bits (171), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 36/98 (36%), Positives = 63/98 (64%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           NI  M+ Q +++Q +++KM+E +     EG +GGGMV    NG+  L  + I+  ++ +D
Sbjct: 11  NINNMIKQAQQMQEEIKKMQEELMQKTVEGTSGGGMVKAVANGRKELVSININPEVVDKD 70

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           +VE LEDL++AA + A +  E+++A++  +IT G  IP
Sbjct: 71  DVETLEDLVLAAVNQALRNAEEMIASEMAKITGGFNIP 108


>gi|300024234|ref|YP_003756845.1| hypothetical protein Hden_2728 [Hyphomicrobium denitrificans ATCC
           51888]
 gi|299526055|gb|ADJ24524.1| conserved hypothetical protein [Hyphomicrobium denitrificans ATCC
           51888]
          Length = 106

 Score = 70.5 bits (171), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 40/89 (44%), Positives = 61/89 (68%)

Query: 17  KMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHS 76
           + ++M+E +   E EG +GGG+V + ++GK  +  V+ID SL+  D VEILEDLI+AA +
Sbjct: 17  RFKEMQEELARAEIEGQSGGGLVHLTVDGKGEVKRVRIDPSLMKPDEVEILEDLIVAAAA 76

Query: 77  DAHKKIEDLVATKTQEITEGLPIPPGLKF 105
           DA  K +  + +K  EIT G+P+PPG+K 
Sbjct: 77  DARAKADSAMQSKMAEITGGIPLPPGMKL 105


>gi|15893260|ref|NP_360974.1| hypothetical protein RC1337 [Rickettsia conorii str. Malish 7]
 gi|229587234|ref|YP_002845735.1| hypothetical protein RAF_ORF1224 [Rickettsia africae ESF-5]
 gi|238651110|ref|YP_002916968.1| hypothetical protein RPR_07555 [Rickettsia peacockii str. Rustic]
 gi|21264156|sp|Q92FZ0|Y1337_RICCN RecName: Full=UPF0133 protein RC1337
 gi|259645753|sp|C3PM02|Y1224_RICAE RecName: Full=UPF0133 protein RAF_ORF1224
 gi|259647119|sp|C4K2W9|Y7555_RICPU RecName: Full=UPF0133 protein RPR_07555
 gi|15620480|gb|AAL03875.1| unknown [Rickettsia conorii str. Malish 7]
 gi|228022284|gb|ACP53992.1| Unknown [Rickettsia africae ESF-5]
 gi|238625208|gb|ACR47914.1| hypothetical protein RPR_07555 [Rickettsia peacockii str. Rustic]
          Length = 107

 Score = 70.5 bits (171), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 38/107 (35%), Positives = 58/107 (54%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N  + + Q + +Q KM++ +E + +    G AGGG+V V   GK  +  + ID SLL 
Sbjct: 1   MVNFNQFLKQAQSMQKKMQEAQEQMANARYTGKAGGGLVEVIATGKGEVEKISIDESLLK 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            +  E+LEDLI  A +DA +K ++           G+ +PPG K PF
Sbjct: 61  AEEKEMLEDLIKVAFNDAQQKCDEDSQNSLSGALNGMRLPPGFKMPF 107


>gi|227115285|ref|ZP_03828941.1| hypothetical protein PcarbP_20110 [Pectobacterium carotovorum
           subsp. brasiliensis PBR1692]
 gi|253687472|ref|YP_003016662.1| hypothetical protein PC1_1077 [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|259645712|sp|C6DB84|Y1077_PECCP RecName: Full=UPF0133 protein PC1_1077
 gi|251754050|gb|ACT12126.1| conserved hypothetical protein [Pectobacterium carotovorum subsp.
           carotovorum PC1]
          Length = 109

 Score = 70.5 bits (171), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 53/83 (63%), Gaps = 1/83 (1%)

Query: 25  ITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKKIED 84
           + +LE  G +G G+V + ING +    V+ID SL+ ED+ E+LEDLI AA +DA ++I +
Sbjct: 28  VANLEVTGESGAGLVKITINGAHNCRRVEIDPSLM-EDDKEMLEDLIAAAFNDAARRIAE 86

Query: 85  LVATKTQEITEGLPIPPGLKFPF 107
               K   ++ G+ +PPG K PF
Sbjct: 87  TQKEKMAAVSSGMQLPPGFKMPF 109


>gi|51245281|ref|YP_065165.1| hypothetical protein DP1429 [Desulfotalea psychrophila LSv54]
 gi|81642342|sp|Q6ANB6|Y1429_DESPS RecName: Full=UPF0133 protein DP1429
 gi|50876318|emb|CAG36158.1| conserved hypothetical protein [Desulfotalea psychrophila LSv54]
          Length = 106

 Score = 70.5 bits (171), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 36/103 (34%), Positives = 65/103 (63%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           +I K++ Q K++QGKM  ++E +      G+AGGGMV V++NG+  +  +KI+ +L+  D
Sbjct: 2   DISKLMQQAKDMQGKMAAIQEDLAKKIITGSAGGGMVEVQVNGQGEILAIKIEDALINTD 61

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKF 105
             E+L+DL+ AA +D  ++ +DL   +  ++T G+ +P    F
Sbjct: 62  EKEMLQDLVTAATNDGLRRAKDLSKQEMGQLTGGMNLPDLTNF 104


>gi|121594690|ref|YP_986586.1| hypothetical protein Ajs_2349 [Acidovorax sp. JS42]
 gi|222110705|ref|YP_002552969.1| hypothetical protein Dtpsy_1508 [Acidovorax ebreus TPSY]
 gi|120606770|gb|ABM42510.1| conserved hypothetical protein 103 [Acidovorax sp. JS42]
 gi|221730149|gb|ACM32969.1| conserved hypothetical protein [Acidovorax ebreus TPSY]
          Length = 110

 Score = 70.5 bits (171), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 41/108 (37%), Positives = 69/108 (63%), Gaps = 5/108 (4%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           ++ +MK   Q + +Q  ++K ++ + ++E EG +G G+V V +  K+ +  V ID SLL 
Sbjct: 7   LAGLMK---QAQAMQDNLKKAQDDLANIEVEGESGAGLVKVLMTCKHDVKRVTIDPSLLA 63

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLP-IPPGLKFPF 107
           +D  ++LEDL+ AA + A +K E+  A K  +IT G+P +P G+KFPF
Sbjct: 64  DDK-DMLEDLVAAAFNAAVRKAEETSAEKMAKITAGMPGLPGGMKFPF 110


>gi|50120116|ref|YP_049283.1| hypothetical protein ECA1177 [Pectobacterium atrosepticum SCRI1043]
 gi|81645847|sp|Q6D7Z8|Y1177_ERWCT RecName: Full=UPF0133 protein ECA1177
 gi|49610642|emb|CAG74087.1| conserved hypothetical protein [Pectobacterium atrosepticum
           SCRI1043]
          Length = 109

 Score = 70.5 bits (171), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 53/83 (63%), Gaps = 1/83 (1%)

Query: 25  ITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKKIED 84
           + +LE  G +G G+V + ING +    V+ID SL+ ED+ E+LEDLI AA +DA ++I +
Sbjct: 28  VANLEVTGESGAGLVKITINGAHNCRRVEIDPSLM-EDDKEMLEDLIAAAFNDAARRIAE 86

Query: 85  LVATKTQEITEGLPIPPGLKFPF 107
               K   ++ G+ +PPG K PF
Sbjct: 87  TQKEKMATVSSGMQLPPGFKMPF 109


>gi|188584658|ref|YP_001916203.1| conserved hypothetical protein [Natranaerobius thermophilus
           JW/NM-WN-LF]
 gi|179349345|gb|ACB83615.1| conserved hypothetical protein [Natranaerobius thermophilus
           JW/NM-WN-LF]
          Length = 105

 Score = 70.5 bits (171), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 65/100 (65%)

Query: 4   IMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDN 63
           + KM+ Q +++Q +M+K++E +      G AGGG V   +NG   +  + ID  ++  ++
Sbjct: 5   MQKMMKQVQKMQSEMQKVQEELKDQTRTGTAGGGAVEATVNGHKEVVDISIDPDVIDPED 64

Query: 64  VEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGL 103
            E+LEDLI+AA +D  K ++++V+ + +++T G+ +PPG+
Sbjct: 65  SEMLEDLIMAAVNDGLKNVDEMVSEEMKKVTGGMDLPPGM 104


>gi|296533585|ref|ZP_06896153.1| transcriptional regulator [Roseomonas cervicalis ATCC 49957]
 gi|296266093|gb|EFH12150.1| transcriptional regulator [Roseomonas cervicalis ATCC 49957]
          Length = 113

 Score = 70.5 bits (171), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 40/94 (42%), Positives = 58/94 (61%), Gaps = 6/94 (6%)

Query: 20  KMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAH 79
           +M+  + ++  +G AGGGMV V + GK  L  + ID SL+  +  E+LEDLI+AAH+DA 
Sbjct: 20  EMQAKLDAMLVDGAAGGGMVKVTLTGKGDLKKLAIDPSLVDPEEREVLEDLIVAAHADAK 79

Query: 80  KKIEDLVATKTQEITEGLPIP------PGLKFPF 107
            K+E ++A + Q+ T GL IP       G K PF
Sbjct: 80  AKVEAMMAEEMQKATAGLNIPGMGGGLGGFKLPF 113


>gi|167038708|ref|YP_001661693.1| hypothetical protein Teth514_0034 [Thermoanaerobacter sp. X514]
 gi|256751422|ref|ZP_05492300.1| conserved hypothetical protein [Thermoanaerobacter ethanolicus
           CCSD1]
 gi|300913733|ref|ZP_07131050.1| conserved hypothetical protein [Thermoanaerobacter sp. X561]
 gi|307723251|ref|YP_003903002.1| hypothetical protein Thet_0035 [Thermoanaerobacter sp. X513]
 gi|238687558|sp|B0K100|Y034_THEPX RecName: Full=UPF0133 protein Teth514_0034
 gi|166852948|gb|ABY91357.1| conserved hypothetical protein 103 [Thermoanaerobacter sp. X514]
 gi|256749641|gb|EEU62667.1| conserved hypothetical protein [Thermoanaerobacter ethanolicus
           CCSD1]
 gi|300890418|gb|EFK85563.1| conserved hypothetical protein [Thermoanaerobacter sp. X561]
 gi|307580312|gb|ADN53711.1| Uncharacterized protein family UPF0133 [Thermoanaerobacter sp.
           X513]
          Length = 111

 Score = 70.5 bits (171), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 36/98 (36%), Positives = 64/98 (65%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           NI  M+ Q +++Q +++KM+E +     E   GGGMV    NG+  L  ++I+ +++ +D
Sbjct: 11  NINNMIKQAQQMQEEIKKMQEELMQKTVEATVGGGMVKAVANGRKELVSIEINPAVVDKD 70

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           +VE LEDL++AA + A +  E+++A++  +IT GL IP
Sbjct: 71  DVETLEDLVLAAVNQALRNAEEMIASEMAKITGGLNIP 108


>gi|319763144|ref|YP_004127081.1| uncharacterized protein family upf0133 [Alicycliphilus
           denitrificans BC]
 gi|330825207|ref|YP_004388510.1| hypothetical protein Alide2_2637 [Alicycliphilus denitrificans
           K601]
 gi|317117705|gb|ADV00194.1| Uncharacterized protein family UPF0133 [Alicycliphilus
           denitrificans BC]
 gi|329310579|gb|AEB84994.1| Uncharacterized protein family UPF0133 [Alicycliphilus
           denitrificans K601]
          Length = 110

 Score = 70.5 bits (171), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 42/108 (38%), Positives = 68/108 (62%), Gaps = 5/108 (4%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           ++ +MK   Q + +Q  ++K +E + S+E EG +G G+V V +  K+ +  V ID SLL 
Sbjct: 7   LAGLMK---QAQAMQDNLKKAQEELASIEVEGESGAGLVKVLMTCKHDVKRVTIDPSLLA 63

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLP-IPPGLKFPF 107
           +D  ++LEDL+ AA + A +K E+    K  +IT G+P +P G+KFPF
Sbjct: 64  DDK-DMLEDLVAAAFNAAVRKAEETSQEKMGKITAGMPGLPGGMKFPF 110


>gi|126667421|ref|ZP_01738393.1| hypothetical protein MELB17_14181 [Marinobacter sp. ELB17]
 gi|126628177|gb|EAZ98802.1| hypothetical protein MELB17_14181 [Marinobacter sp. ELB17]
          Length = 107

 Score = 70.1 bits (170), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 38/107 (35%), Positives = 67/107 (62%), Gaps = 1/107 (0%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+ +++ + +++Q  M+K +E I   E  G +G G+V V +NG++ +  V+ID SL+ 
Sbjct: 2   MDNMGELMKKAQKMQENMQKAQEEIAKAEVTGESGAGLVKVVMNGRHDVRKVEIDPSLMS 61

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           E+  +ILEDL+ AA +DA ++++     K   +  G+ +PPG K PF
Sbjct: 62  EEK-DILEDLLAAAVNDAVRRVDANQKDKMSGMMSGMGLPPGFKMPF 107


>gi|261414698|ref|YP_003248381.1| hypothetical protein Fisuc_0287 [Fibrobacter succinogenes subsp.
           succinogenes S85]
 gi|261371154|gb|ACX73899.1| conserved hypothetical protein [Fibrobacter succinogenes subsp.
           succinogenes S85]
 gi|302325704|gb|ADL24905.1| conserved hypothetical protein TIGR00103 [Fibrobacter succinogenes
           subsp. succinogenes S85]
          Length = 102

 Score = 70.1 bits (170), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 40/98 (40%), Positives = 61/98 (62%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           ++ KM+   +++Q KM K +  + +   +  AGGGMV V +NGK +LT VKI+   + +D
Sbjct: 2   DMSKMLKDLQKMQSKMLKAQNDLKAQSFDAEAGGGMVKVAMNGKGVLTMVKINPDAVDKD 61

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           +VE LEDLI+AA + A KK +D       +IT G+ IP
Sbjct: 62  DVEALEDLIMAAVNSAVKKKDDAQQASISDITGGMKIP 99


>gi|310657423|ref|YP_003935144.1| hypothetical protein CLOST_0109 [Clostridium sticklandii DSM 519]
 gi|308824201|emb|CBH20239.1| conserved protein of unknown function [Clostridium sticklandii]
          Length = 115

 Score = 70.1 bits (170), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 68/100 (68%), Gaps = 3/100 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M+N+MK   Q +++Q  MEK++  ++  E E +AGGG V+V+ NGK  +  + I + ++ 
Sbjct: 16  MNNMMK---QVQKMQKDMEKIQAELSEKEVEASAGGGAVTVKANGKKEIVSITIKQEVVD 72

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
            D+VE+LEDL+++A ++A +  E+++++   ++T GL +P
Sbjct: 73  PDDVEMLEDLVLSAVNEALRSAEEMMSSGMSKVTSGLNLP 112


>gi|289577299|ref|YP_003475926.1| hypothetical protein Thit_0035 [Thermoanaerobacter italicus Ab9]
 gi|297543595|ref|YP_003675897.1| hypothetical protein Tmath_0101 [Thermoanaerobacter mathranii
           subsp. mathranii str. A3]
 gi|289527012|gb|ADD01364.1| conserved hypothetical protein [Thermoanaerobacter italicus Ab9]
 gi|296841370|gb|ADH59886.1| conserved hypothetical protein [Thermoanaerobacter mathranii subsp.
           mathranii str. A3]
          Length = 111

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 36/98 (36%), Positives = 64/98 (65%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           NI  M+ Q +++Q +++KM+E +     E  AGGGMV    NG+  L  ++I+  ++ ++
Sbjct: 11  NINNMIKQAQQMQEEIKKMQEQLVQKTVEATAGGGMVKAVANGRKELVSIEINPDVVDKE 70

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           +VE LEDL++AA + A +  E+++A++  +IT GL IP
Sbjct: 71  DVETLEDLVLAAVNQALRNAEEMIASEMAKITGGLNIP 108


>gi|253999385|ref|YP_003051448.1| hypothetical protein Msip34_1676 [Methylovorus sp. SIP3-4]
 gi|313201407|ref|YP_004040065.1| hypothetical protein MPQ_1675 [Methylovorus sp. MP688]
 gi|253986064|gb|ACT50921.1| conserved hypothetical protein [Methylovorus sp. SIP3-4]
 gi|312440723|gb|ADQ84829.1| conserved hypothetical protein [Methylovorus sp. MP688]
          Length = 103

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 67/107 (62%), Gaps = 9/107 (8%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           + N+MK   Q +++Q  M++ +E +  +E EG AG GMV V I  +N +  + ID SL+ 
Sbjct: 6   LGNLMK---QAQQMQENMKRAQEELAQVEVEGQAGSGMVKVTITCRNEVKRLHIDPSLMS 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           +D  E+LEDLI+ A +DA +K E   AT  Q ++ GL +P G+K PF
Sbjct: 63  DDK-EMLEDLIVTALNDAVRKAE---ATSQQRMS-GL-MPAGMKLPF 103


>gi|300780024|ref|ZP_07089880.1| transcriptional regulatory protein [Corynebacterium genitalium ATCC
           33030]
 gi|300534134|gb|EFK55193.1| transcriptional regulatory protein [Corynebacterium genitalium ATCC
           33030]
          Length = 118

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 33/95 (34%), Positives = 59/95 (62%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M ++ +++ Q  E+Q +M++ +E I +   +G AGGG+V++ + G   +T +KID   + 
Sbjct: 9   MPDMQELIRQAAEVQAQMQRAQEEILATNVQGTAGGGLVTITMTGGADITDLKIDPEAVD 68

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITE 95
            ++VE L+DLI+AA+ DAH K   L   K   +T+
Sbjct: 69  PEDVETLQDLILAAYRDAHTKAGQLAQEKLGPLTQ 103


>gi|67459757|ref|YP_247381.1| hypothetical protein RF_1365 [Rickettsia felis URRWXCal2]
 gi|75535853|sp|Q4UJS3|Y1365_RICFE RecName: Full=UPF0133 protein RF_1365
 gi|67005290|gb|AAY62216.1| Conserved hypothetical protein [Rickettsia felis URRWXCal2]
          Length = 107

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 38/107 (35%), Positives = 58/107 (54%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N  + + Q + +Q KM++ +E + +    G AGGG+V V   GK  +  + ID SLL 
Sbjct: 1   MVNFNQFLKQAQSMQKKMQEAQEQMANARYTGKAGGGLVEVIATGKGEVEKITIDESLLK 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            +  E+LEDLI  A +DA +K ++           G+ +PPG K PF
Sbjct: 61  PEEKEMLEDLIKVAFNDAKQKCDEDSQNSLSGALNGMSLPPGFKMPF 107


>gi|326390315|ref|ZP_08211874.1| Uncharacterized protein family UPF0133 [Thermoanaerobacter
           ethanolicus JW 200]
 gi|325993592|gb|EGD52025.1| Uncharacterized protein family UPF0133 [Thermoanaerobacter
           ethanolicus JW 200]
          Length = 111

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 36/98 (36%), Positives = 63/98 (64%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           NI  M+ Q +++Q +++KM+E +     E   GGGMV    NG+  L  ++I+  ++ +D
Sbjct: 11  NINNMIKQAQQMQEEIKKMQEELMQKTVEATVGGGMVKAVANGRKELVSIEINPDVVDKD 70

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           +VE LEDL++AA + A +  E+++A++  +IT GL IP
Sbjct: 71  DVETLEDLVLAAVNQALRNAEEMIASEMAKITGGLNIP 108


>gi|295694720|ref|YP_003587958.1| hypothetical protein Btus_0036 [Bacillus tusciae DSM 2912]
 gi|295410322|gb|ADG04814.1| conserved hypothetical protein [Bacillus tusciae DSM 2912]
          Length = 103

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 63/100 (63%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+ +++ Q K++Q +M K +E++     EG+AGGG V+V  NG   +  V I    + 
Sbjct: 1   MKNMNQLMKQAKKMQEEMMKAQEALGEKTVEGSAGGGAVTVVANGHKQIQSVVIRPEAVD 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
            D+VE+L+DL++ A +DA KK++DLVA +  + T G  +P
Sbjct: 61  PDDVEMLQDLVLTAVNDALKKVDDLVAEELSKYTRGFNMP 100


>gi|119945936|ref|YP_943616.1| hypothetical protein Ping_2276 [Psychromonas ingrahamii 37]
 gi|166227699|sp|A1SX02|Y2276_PSYIN RecName: Full=UPF0133 protein Ping_2276
 gi|119864540|gb|ABM04017.1| conserved hypothetical protein 103 [Psychromonas ingrahamii 37]
          Length = 109

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 66/107 (61%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M ++MK   + +E+Q  M+K +  I + E  G +G G+V + I G + +  V+ID SL+ 
Sbjct: 7   MGDLMK---KAQEMQENMKKAQAEIANTEVTGESGAGLVKITILGNHNVRKVEIDPSLM- 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED+ E+LEDLI AA +DA  +I ++   K   ++ G+ +PPG K PF
Sbjct: 63  EDDKEMLEDLIAAAMNDAVHRIGEVNKNKMSGVSGGMELPPGFKMPF 109


>gi|254282651|ref|ZP_04957619.1| conserved hypothetical protein TIGR00103 [gamma proteobacterium
           NOR51-B]
 gi|219678854|gb|EED35203.1| conserved hypothetical protein TIGR00103 [gamma proteobacterium
           NOR51-B]
          Length = 105

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 38/107 (35%), Positives = 64/107 (59%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           ++++MK   Q +++Q  +   +E++  +E EG AG G+V+VR+ G   +  V +D S+L 
Sbjct: 3   INDLMK---QAQQMQQGLAAAQEAVKQIEVEGQAGAGLVTVRMTGALSVVRVTVDPSVLN 59

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED  E+LEDL+ AA +DA ++ +     K  E   G+ +P G K PF
Sbjct: 60  EDR-EVLEDLLAAAVNDAVQRAQAASQEKMAEAAGGINLPAGFKMPF 105


>gi|313673333|ref|YP_004051444.1| hypothetical protein Calni_1373 [Calditerrivibrio nitroreducens DSM
           19672]
 gi|312940089|gb|ADR19281.1| Uncharacterized protein family UPF0133 [Calditerrivibrio
           nitroreducens DSM 19672]
          Length = 104

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 39/104 (37%), Positives = 65/104 (62%), Gaps = 4/104 (3%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           NI  ++ Q K +Q KME+++  +     E  AGGGMV    NGK  L G+ ID+ ++  +
Sbjct: 2   NIQAIMKQAKIMQKKMEEVQAEVAKETVEATAGGGMVKATFNGKAELIGLTIDKDVVNPE 61

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFP 106
           +VE+L+DLI+AA ++  KK ++L++ +  ++T GL    G+ FP
Sbjct: 62  DVEMLQDLIVAAVNEGIKKAQNLLSERMSKLTGGL----GINFP 101


>gi|157369379|ref|YP_001477368.1| hypothetical protein Spro_1136 [Serratia proteamaculans 568]
 gi|166977710|sp|A8GAV0|Y1136_SERP5 RecName: Full=UPF0133 protein Spro_1136
 gi|157321143|gb|ABV40240.1| conserved hypothetical protein [Serratia proteamaculans 568]
          Length = 109

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 53/83 (63%), Gaps = 1/83 (1%)

Query: 25  ITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKKIED 84
           +  LE  G +G G+V V ING +    V+ID SL+ ED+ ++LEDLI AA +DA ++I++
Sbjct: 28  VAKLEVTGESGAGLVKVTINGAHNCRRVEIDPSLM-EDDKDMLEDLIAAAINDAARRIDE 86

Query: 85  LVATKTQEITEGLPIPPGLKFPF 107
               K   ++ G+ +PPG K PF
Sbjct: 87  TQKEKMASVSNGMQLPPGFKMPF 109


>gi|332529398|ref|ZP_08405359.1| hypothetical protein HGR_05791 [Hylemonella gracilis ATCC 19624]
 gi|332041196|gb|EGI77561.1| hypothetical protein HGR_05791 [Hylemonella gracilis ATCC 19624]
          Length = 110

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 41/108 (37%), Positives = 68/108 (62%), Gaps = 5/108 (4%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           ++ +MK   Q + +Q  ++K ++ I  +E  G +G G+V V + GK+ +  V ID SLL 
Sbjct: 7   LAGLMK---QAQAMQDNLKKAQDEIALMEVTGESGAGLVKVTMTGKHDVKRVVIDPSLLA 63

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLP-IPPGLKFPF 107
           +D  ++LEDL+ AA + A +K+E+    K  ++T G+P +P GLKFPF
Sbjct: 64  DDK-DMLEDLVAAAFNAAVRKVEETSQEKMGKLTSGMPGLPGGLKFPF 110


>gi|306821442|ref|ZP_07455046.1| conserved hypothetical protein [Eubacterium yurii subsp.
           margaretiae ATCC 43715]
 gi|304550517|gb|EFM38504.1| conserved hypothetical protein [Eubacterium yurii subsp.
           margaretiae ATCC 43715]
          Length = 114

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 35/98 (35%), Positives = 65/98 (66%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           N+  M+ Q +++Q  M+KM+E +++ E E  +GGG V+V++NGK  L  +KI   ++ +D
Sbjct: 14  NMNNMLKQVQKMQNDMQKMQEELSNKEFETTSGGGAVTVKVNGKKELLSIKIKEEVVDKD 73

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           +VE+LEDLI++A + A  + +  +++    +T G+ IP
Sbjct: 74  DVEMLEDLILSAINQAMSQADASMSSGLSSVTGGMNIP 111


>gi|308270885|emb|CBX27495.1| UPF0133 protein Dred_0043 [uncultured Desulfobacterium sp.]
          Length = 103

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 66/100 (66%), Gaps = 3/100 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           + N+MK   Q +++Q  M K++E + S   E  +GGGM+ V  NGK  +  ++I++ ++ 
Sbjct: 4   LGNMMK---QAQKLQASMAKLQEELGSKTVEAASGGGMIKVVANGKQQIISIRIEKEVVD 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
            ++VE+L+DLI+AA +DA  K +D+V+ +  ++T G+ IP
Sbjct: 61  PEDVEMLQDLILAAVNDALTKSQDMVSQEMGKLTGGMNIP 100


>gi|239815314|ref|YP_002944224.1| hypothetical protein Vapar_2331 [Variovorax paradoxus S110]
 gi|239801891|gb|ACS18958.1| conserved hypothetical protein [Variovorax paradoxus S110]
          Length = 110

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 68/108 (62%), Gaps = 5/108 (4%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           ++ +MK   Q + +Q  ++K +E + ++E EG +G G+V V +  K+ +  + ID SLL 
Sbjct: 7   LAGLMK---QAQAMQDNLKKAQEELATIEVEGESGAGLVKVVMTCKHDVKRITIDPSLLA 63

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLP-IPPGLKFPF 107
           +D  ++LEDL+ AA + A +K E+    K  ++T G+P +PPG+K PF
Sbjct: 64  DDK-DMLEDLVAAAFNAAVRKAEETSEQKMGKLTAGMPGLPPGMKLPF 110


>gi|260887502|ref|ZP_05898765.1| putative cytoplasmic protein [Selenomonas sputigena ATCC 35185]
 gi|330837882|ref|YP_004412462.1| Uncharacterized protein family UPF0133 [Selenomonas sputigena ATCC
           35185]
 gi|260862789|gb|EEX77289.1| putative cytoplasmic protein [Selenomonas sputigena ATCC 35185]
 gi|329745646|gb|AEB99002.1| Uncharacterized protein family UPF0133 [Selenomonas sputigena ATCC
           35185]
          Length = 111

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 35/103 (33%), Positives = 69/103 (66%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+  M+ + +++Q  M+KM+E +     E +AGGG V + +NG+  +  + ID + + 
Sbjct: 8   MGNMQGMMKKVQKLQNDMKKMQEELKKKTVEVSAGGGAVKIVMNGEKEVQSLHIDPAAVD 67

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGL 103
            ++VE+L+DL+ AA +++ KK++D++A +  ++T GL +PPG+
Sbjct: 68  PEDVEMLQDLLSAAFNESVKKVDDMMAGEMGKLTGGLGLPPGM 110


>gi|157804257|ref|YP_001492806.1| hypothetical protein A1E_05550 [Rickettsia canadensis str. McKiel]
 gi|166227327|sp|A8F088|Y5550_RICCK RecName: Full=UPF0133 protein A1E_05550
 gi|157785520|gb|ABV74021.1| hypothetical protein A1E_05550 [Rickettsia canadensis str. McKiel]
          Length = 107

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 59/107 (55%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N  + + Q + +Q KM++ +E + +    G AGG +V + I G++ +  V ID SLL 
Sbjct: 1   MVNFNQFLKQAQSMQKKMQEAQEQMVNARYTGKAGGRLVEITITGRSEVEKVSIDESLLK 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            +  E+LEDLI  A +DA +K ++           G+ +PPG K PF
Sbjct: 61  AEEKEMLEDLIKVAFNDAKQKCDEDSQNSLSGALNGINLPPGFKMPF 107


>gi|309782345|ref|ZP_07677071.1| conserved hypothetical protein [Ralstonia sp. 5_7_47FAA]
 gi|308918881|gb|EFP64552.1| conserved hypothetical protein [Ralstonia sp. 5_7_47FAA]
          Length = 115

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 43/111 (38%), Positives = 64/111 (57%), Gaps = 6/111 (5%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFE- 61
            I  ++ Q +++Q  M+K +E +  +E EG +G G+V V +  KN +  V ID SLL E 
Sbjct: 5   QIAGLMKQAQQMQENMKKAQEQLALIEVEGVSGAGLVKVVMTCKNDVKRVSIDPSLLAEG 64

Query: 62  DNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLP-----IPPGLKFPF 107
           ++ ++LEDLI AA +DA +K E     K   +T GL      +PPG K PF
Sbjct: 65  EDKDLLEDLIAAAFNDAVRKAEATTQEKMGSLTSGLGGMASMLPPGFKLPF 115


>gi|302390828|ref|YP_003826648.1| hypothetical protein Acear_0031 [Acetohalobium arabaticum DSM 5501]
 gi|302202905|gb|ADL11583.1| conserved hypothetical protein [Acetohalobium arabaticum DSM 5501]
          Length = 102

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 34/98 (34%), Positives = 65/98 (66%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           ++ KM+ Q +++Q +ME ++E +   + E  AGGG+V V  NG+  +  + I+   +  D
Sbjct: 2   DMSKMMKQVQKMQSQMEDVQEELAEKKVEATAGGGVVKVVANGQQEIVDISIEPDAVDPD 61

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           +VE+LEDLI+AA ++A +K++D+ + +  ++T G+ IP
Sbjct: 62  DVEMLEDLILAATNEAMRKVQDMASEEMGKLTGGMNIP 99


>gi|103486289|ref|YP_615850.1| hypothetical protein Sala_0797 [Sphingopyxis alaskensis RB2256]
 gi|98976366|gb|ABF52517.1| conserved hypothetical protein 103 [Sphingopyxis alaskensis RB2256]
          Length = 111

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 32/83 (38%), Positives = 52/83 (62%)

Query: 25  ITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKKIED 84
           + S+E EG +GGG+V ++   K  +  + ID SL+   + ++LEDL+ AA +DA +K + 
Sbjct: 29  LDSVEVEGVSGGGLVKIKATAKGRIKAIHIDDSLIVPADKQMLEDLLAAAFNDAREKADA 88

Query: 85  LVATKTQEITEGLPIPPGLKFPF 107
               +  ++T GLP+PPG K PF
Sbjct: 89  ASNEEMGKMTSGLPLPPGFKLPF 111


>gi|260432377|ref|ZP_05786348.1| conserved hypothetical protein [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260416205|gb|EEX09464.1| conserved hypothetical protein [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 114

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 35/107 (32%), Positives = 62/107 (57%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           + ++ KM+   +E+Q KM +M+E + ++   G +G G+V    + K  L G+ ID S+  
Sbjct: 8   LGDMAKMMKSAQELQTKMAQMQEELNTIMVVGESGAGLVKATASAKGELKGLDIDPSIFN 67

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            D+ E++EDLI+AA  DA  K  +    +  ++TE + +P  +K PF
Sbjct: 68  SDDKEVVEDLILAAIKDAQTKAAERSQEEMAKLTESMGLPADIKLPF 114


>gi|83951301|ref|ZP_00960033.1| hypothetical protein ISM_12100 [Roseovarius nubinhibens ISM]
 gi|83836307|gb|EAP75604.1| hypothetical protein ISM_12100 [Roseovarius nubinhibens ISM]
          Length = 114

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 60/107 (56%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M ++ KM+   +E+Q KM  ++E + S+   G +G G+V      K  L  + ID S+  
Sbjct: 8   MGDMAKMMKAAQEMQQKMANLQEEMHSMTVTGESGAGLVKAVATCKGELKSLDIDPSIFN 67

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            D+ E++EDLI+AA  DA  K  D    +  ++TEG+ +P  +K PF
Sbjct: 68  TDDKEVVEDLILAAIKDAQGKASDKAQEEMGKLTEGMGLPKDMKLPF 114


>gi|187928129|ref|YP_001898616.1| hypothetical protein Rpic_1036 [Ralstonia pickettii 12J]
 gi|241662732|ref|YP_002981092.1| hypothetical protein Rpic12D_1128 [Ralstonia pickettii 12D]
 gi|238691799|sp|B2U9S6|Y1036_RALPJ RecName: Full=UPF0133 protein Rpic_1036
 gi|187725019|gb|ACD26184.1| conserved hypothetical protein [Ralstonia pickettii 12J]
 gi|240864759|gb|ACS62420.1| conserved hypothetical protein [Ralstonia pickettii 12D]
          Length = 115

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 43/111 (38%), Positives = 64/111 (57%), Gaps = 6/111 (5%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFE- 61
            I  ++ Q +++Q  M+K +E +  +E EG +G G+V V +  KN +  V ID SLL E 
Sbjct: 5   QIAGLMKQAQQMQENMKKAQEQLALIEVEGVSGAGLVKVVMTCKNDVKRVSIDPSLLAEG 64

Query: 62  DNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLP-----IPPGLKFPF 107
           ++ ++LEDLI AA +DA +K E     K   +T GL      +PPG K PF
Sbjct: 65  EDKDLLEDLIAAAFNDAVRKAEATTQEKMGSLTSGLGGMAGMLPPGFKLPF 115


>gi|187931731|ref|YP_001891716.1| hypothetical protein FTM_1023 [Francisella tularensis subsp.
           mediasiatica FSC147]
 gi|238691567|sp|B2SGS9|Y1023_FRATM RecName: Full=UPF0133 protein FTM_1023
 gi|187712640|gb|ACD30937.1| conserved hypothetical protein [Francisella tularensis subsp.
           mediasiatica FSC147]
          Length = 112

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 70/110 (63%), Gaps = 7/110 (6%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           ++ K+V Q +++Q +M+K ++   ++E  G +G G+V+V + GK  +  V ID SL+ ED
Sbjct: 4   DMSKLVQQAQKMQEQMKKAQQERENMEVIGESGAGLVTVTMTGKYDVKSVSIDNSLMSED 63

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITE-----GLPIPPGLKFPF 107
             EILEDLI AA + A KK+E+  +T + +I +     G+ +P G+ FPF
Sbjct: 64  K-EILEDLIAAAVNSAVKKVEE-NSTASSDIYKMAKDAGIDLPSGINFPF 111


>gi|120611313|ref|YP_970991.1| hypothetical protein Aave_2645 [Acidovorax citrulli AAC00-1]
 gi|326317365|ref|YP_004235037.1| hypothetical protein Acav_2558 [Acidovorax avenae subsp. avenae
           ATCC 19860]
 gi|120589777|gb|ABM33217.1| conserved hypothetical protein 103 [Acidovorax citrulli AAC00-1]
 gi|323374201|gb|ADX46470.1| UPF0133 protein ybaB [Acidovorax avenae subsp. avenae ATCC 19860]
          Length = 110

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 65/102 (63%), Gaps = 2/102 (1%)

Query: 7   MVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEI 66
           ++ Q + +Q  ++K ++ +  +E EG +G G+V V +  K+ +  V ID SLL +D  ++
Sbjct: 10  LMKQAQAMQDNLKKAQDELALIEVEGESGAGLVKVLMTCKHDVKRVTIDPSLLSDDK-DM 68

Query: 67  LEDLIIAAHSDAHKKIEDLVATKTQEITEGLP-IPPGLKFPF 107
           LEDL+ AA + A +K E+    K  ++T G+P +PPG+KFPF
Sbjct: 69  LEDLVAAAFNAAVRKAEETSQEKMGKLTAGMPGMPPGMKFPF 110


>gi|313888944|ref|ZP_07822604.1| DNA-binding protein, YbaB/EbfC family [Peptoniphilus harei
           ACS-146-V-Sch2b]
 gi|312845117|gb|EFR32518.1| DNA-binding protein, YbaB/EbfC family [Peptoniphilus harei
           ACS-146-V-Sch2b]
          Length = 113

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 63/94 (67%)

Query: 7   MVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEI 66
           M+ Q +++Q +ME+M+E++ + E   +AGGG VS  +NG   L  +K+D+  +  D+VE+
Sbjct: 18  MMKQIEKLQKQMEEMQENLANEEITASAGGGAVSATVNGNKELISIKLDKDAVDPDDVEM 77

Query: 67  LEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           LEDLI+AA ++A +  +  ++++  + T GL IP
Sbjct: 78  LEDLIVAAVNEALRNADSKMSSQMGKFTGGLNIP 111


>gi|258404640|ref|YP_003197382.1| hypothetical protein Dret_0507 [Desulfohalobium retbaense DSM 5692]
 gi|257796867|gb|ACV67804.1| conserved hypothetical protein [Desulfohalobium retbaense DSM 5692]
          Length = 100

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 64/94 (68%)

Query: 7   MVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEI 66
           ++ Q +++Q KM +++E + +   E +AGGGMV+V + G   +TG+ ID S++  ++V++
Sbjct: 4   LIRQAQQMQRKMAQIQEEVGNQTVEASAGGGMVTVTVTGNQEVTGIAIDPSVVDPNDVDM 63

Query: 67  LEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           L+DL+++A ++A KK + L+     E+T G+ IP
Sbjct: 64  LQDLVLSAVNEAMKKAKKLMEDSMSEVTGGMNIP 97


>gi|302390662|ref|YP_003826483.1| hypothetical protein Toce_2147 [Thermosediminibacter oceani DSM
           16646]
 gi|302201290|gb|ADL08860.1| conserved hypothetical protein [Thermosediminibacter oceani DSM
           16646]
          Length = 109

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 62/100 (62%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+ K++ Q +++Q  M K++E +     E  AGGG+V    NG+  L  +KI    + 
Sbjct: 7   MGNMSKLMKQVQKVQEDMAKLQEELKERTVEATAGGGVVKAVANGRKELLEIKIQPEAVD 66

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
            D+VE+LEDLI+AA ++A +K E++V  +  ++T GL IP
Sbjct: 67  PDDVEMLEDLILAAVNEALQKAEEMVTKEMSKLTGGLGIP 106


>gi|149203326|ref|ZP_01880296.1| hypothetical protein RTM1035_01875 [Roseovarius sp. TM1035]
 gi|149143159|gb|EDM31198.1| hypothetical protein RTM1035_01875 [Roseovarius sp. TM1035]
          Length = 150

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 36/107 (33%), Positives = 60/107 (56%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M ++ KM+   +E+Q KM  ++E + ++   G +G G+V    + K  L  + ID S+  
Sbjct: 44  MGDMAKMMKAAQEMQKKMAALQEEMHTIMVTGESGAGLVKATCSAKGELKALDIDPSIFN 103

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            D+ E++EDLI+AA  DA  K       +  +ITEG+ +P  +K PF
Sbjct: 104 SDDKEVVEDLILAAIKDAQAKASARAQEEMGKITEGMGLPKDMKLPF 150


>gi|51474035|ref|YP_067792.1| hypothetical protein RT0857 [Rickettsia typhi str. Wilmington]
 gi|81389904|sp|Q68VP6|Y857_RICTY RecName: Full=UPF0133 protein RT0857
 gi|51460347|gb|AAU04310.1| conserved hypothetical protein [Rickettsia typhi str. Wilmington]
          Length = 107

 Score = 68.6 bits (166), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 58/107 (54%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N  + + Q + +Q KM++ +E + +    G AGG +V + I GK  +  V ID SLL 
Sbjct: 1   MVNFNQFLKQAQSMQKKMQEAQEQMANTRYTGKAGGMLVEIIITGKGEIEKVSIDESLLK 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            +  EILEDLI  A +DA +K ++           G+ +PPG K PF
Sbjct: 61  IEEKEILEDLIKVAFNDAKQKCDEDSQNSLSGALNGMSLPPGFKIPF 107


>gi|313606308|gb|EFR83258.1| hypothetical protein NT04LM_4166 [Listeria monocytogenes FSL
           F2-208]
          Length = 93

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 60/91 (65%)

Query: 10  QFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILED 69
           Q +++Q +M K +  + + E  G AGGGMV+V+  GK ++T V I+  ++  +++E+L+D
Sbjct: 1   QMQKMQKEMAKAQADLEAQEFTGTAGGGMVTVKATGKRVITDVVINEEVVDPEDIEMLQD 60

Query: 70  LIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           L++AA +D  K+IED  +    + T+GL IP
Sbjct: 61  LVLAATNDVLKQIEDTTSQTMGKFTQGLNIP 91


>gi|330722043|gb|EGG99966.1| hypothetical protein imdm_320 [gamma proteobacterium IMCC2047]
          Length = 107

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 55/88 (62%), Gaps = 1/88 (1%)

Query: 20  KMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAH 79
           K +E I S E  G +G GMV V + G++ +  V+ID SLL E+  EILEDL+ AA +DA 
Sbjct: 21  KKQEEIASAEVTGESGAGMVKVIMTGRHDVRSVEIDPSLLSEEK-EILEDLLAAAVNDAV 79

Query: 80  KKIEDLVATKTQEITEGLPIPPGLKFPF 107
           +++E++       +  G+ +PPG K PF
Sbjct: 80  RRVENINKENMASMASGMGMPPGFKMPF 107


>gi|157829167|ref|YP_001495409.1| hypothetical protein A1G_07310 [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165933896|ref|YP_001650685.1| hypothetical protein RrIowa_1562 [Rickettsia rickettsii str. Iowa]
 gi|166228847|sp|A8GU26|Y7310_RICRS RecName: Full=UPF0133 protein A1G_07310
 gi|189038950|sp|B0BVL9|Y1562_RICRO RecName: Full=UPF0133 protein RrIowa_1562
 gi|157801648|gb|ABV76901.1| hypothetical protein A1G_07310 [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165908983|gb|ABY73279.1| hypothetical transcriptional regulatory protein [Rickettsia
           rickettsii str. Iowa]
          Length = 107

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 58/107 (54%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N  + + Q + +Q KM++ +E + +    G AGGG+V V   GK  +  + ID SLL 
Sbjct: 1   MVNFNQFLKQAQSMQKKMQEAQEQMANARYTGKAGGGLVEVIATGKGEVEKISIDESLLK 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            +  E+LEDLI  A ++A +K ++           G+ +PPG K PF
Sbjct: 61  AEEKEMLEDLIKVAFNNAQQKCDEDSQNSLSGALNGMRLPPGFKMPF 107


>gi|260221002|emb|CBA29131.1| UPF0133 protein Lcho_1975 [Curvibacter putative symbiont of Hydra
           magnipapillata]
          Length = 110

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 41/108 (37%), Positives = 68/108 (62%), Gaps = 5/108 (4%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           ++ +MK   Q + +Q  M+K ++ + ++E  G +G G+V V +  K+ +  V ID SLL 
Sbjct: 7   LAGLMK---QAQAMQDNMKKAQDELGNIEVTGESGAGLVKVTMTCKHDVKRVAIDPSLLA 63

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLP-IPPGLKFPF 107
           +D  ++LEDL+ AA + A +K E+  A K  +IT G+P +P G+KFPF
Sbjct: 64  DDK-DMLEDLVAAAFNAAVRKAEETSAEKMGKITAGMPGLPGGMKFPF 110


>gi|328954115|ref|YP_004371449.1| UPF0133 protein ybaB [Desulfobacca acetoxidans DSM 11109]
 gi|328454439|gb|AEB10268.1| UPF0133 protein ybaB [Desulfobacca acetoxidans DSM 11109]
          Length = 103

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 63/100 (63%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+  M+ Q +++Q KM  M+E + +      AGGGMV V  NG+  L  ++ID  ++ 
Sbjct: 1   MKNLGSMMKQAQKLQSKMLAMQEELGNRTVTAQAGGGMVEVVANGRQELISLRIDPEVVN 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
            ++V++L+DL++AA +DA  +  ++VA +  ++T G+ IP
Sbjct: 61  SEDVDLLQDLVLAAVNDALNRSREMVADEMAKLTGGMKIP 100


>gi|84516010|ref|ZP_01003371.1| hypothetical protein SKA53_15211 [Loktanella vestfoldensis SKA53]
 gi|84510452|gb|EAQ06908.1| hypothetical protein SKA53_15211 [Loktanella vestfoldensis SKA53]
          Length = 104

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 59/102 (57%)

Query: 6   KMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVE 65
           KM+ Q +++QGKM +M+E +  +  EG +G G+V      K  L  + ID S+   ++ E
Sbjct: 3   KMMKQAQDMQGKMAQMQEDLDHIMVEGVSGAGLVKATATAKGELKSLDIDPSIFNGEDKE 62

Query: 66  ILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ++EDLI+AA  DA  K  +    +  ++ E + +P G+K PF
Sbjct: 63  VVEDLILAAIKDAQSKAAERSQQEMGKMAEAMGLPAGMKLPF 104


>gi|319793177|ref|YP_004154817.1| hypothetical protein Varpa_2506 [Variovorax paradoxus EPS]
 gi|315595640|gb|ADU36706.1| Uncharacterized protein family UPF0133 [Variovorax paradoxus EPS]
          Length = 110

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 67/108 (62%), Gaps = 5/108 (4%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           ++ +MK   Q + +Q  ++K +E +  +E EG +G G+V V +  K+ +  + ID SLL 
Sbjct: 7   LAGLMK---QAQAMQDNLKKAQEELAHIEVEGESGAGLVKVVMTCKHDVKRITIDPSLLA 63

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLP-IPPGLKFPF 107
           +D  ++LEDL+ AA + A +K E+    K  ++T G+P +PPG+K PF
Sbjct: 64  DDK-DMLEDLVAAAFNAAVRKAEETSEQKMGKLTAGMPGLPPGMKLPF 110


>gi|134301667|ref|YP_001121635.1| hypothetical protein FTW_0607 [Francisella tularensis subsp.
           tularensis WY96-3418]
 gi|206558152|sp|A4IX63|Y607_FRATW RecName: Full=UPF0133 protein FTW_0607
 gi|134049444|gb|ABO46515.1| conserved hypothetical protein [Francisella tularensis subsp.
           tularensis WY96-3418]
          Length = 112

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 71/110 (64%), Gaps = 7/110 (6%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           ++ K++ Q +++Q +M+K ++   ++E  G +G G+V+V + GK  +  V ID SL+ ED
Sbjct: 4   DMSKLMQQAQKMQEQMKKAQQERENMEVIGESGAGLVTVTMTGKYDVKSVSIDNSLMSED 63

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITE-----GLPIPPGLKFPF 107
             EILEDLI AA ++A KK+E+  +T + +I +     G+ +P G+ FPF
Sbjct: 64  K-EILEDLIAAAVNNAVKKVEE-NSTASSDIYKMAKDAGIDLPSGINFPF 111


>gi|241765307|ref|ZP_04763285.1| conserved hypothetical protein [Acidovorax delafieldii 2AN]
 gi|241364988|gb|EER59899.1| conserved hypothetical protein [Acidovorax delafieldii 2AN]
          Length = 110

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 68/108 (62%), Gaps = 5/108 (4%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           ++ +MK   Q + +Q  ++K +E +  +E EG +G G+V V +  K+ +  + ID SLL 
Sbjct: 7   LAGLMK---QAQAMQDNLKKAQEELAFIEVEGESGAGLVKVLMTCKHDVKRITIDPSLLA 63

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLP-IPPGLKFPF 107
           ED  ++LEDL+ AA + A +K E+  + K  ++T G+P +P G+KFPF
Sbjct: 64  EDK-DMLEDLVAAAFNAAVRKAEETSSEKMGKLTAGMPGLPGGMKFPF 110


>gi|221135203|ref|ZP_03561506.1| hypothetical protein GHTCC_09771 [Glaciecola sp. HTCC2999]
          Length = 108

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 68/107 (63%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M NIMK   Q +++Q +MEK +  + ++E  G AG GMV V +   + +  V ID +L+ 
Sbjct: 6   MGNIMK---QAQQMQERMEKSQAELANIEVSGEAGAGMVKVTMTCNHNVKRVHIDDALM- 61

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           +D+ +++EDL+ AA +DA +++ +    K  ++T G+P+PPG K PF
Sbjct: 62  DDDKDMIEDLVAAACNDAVRRVAETTKEKMADVTGGMPLPPGFKMPF 108


>gi|299144509|ref|ZP_07037588.1| transcriptional regulatory protein [Peptoniphilus sp. oral taxon
           386 str. F0131]
 gi|298517597|gb|EFI41337.1| transcriptional regulatory protein [Peptoniphilus sp. oral taxon
           386 str. F0131]
          Length = 112

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 65/100 (65%), Gaps = 3/100 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M+N+MK   Q +++Q +ME+M+E++ + E E +AGGG V  ++NG   L  + +D+ ++ 
Sbjct: 14  MNNMMK---QVQKLQKQMEEMQENLKNQEIEFSAGGGAVVAKVNGSKELVSITLDKEVVD 70

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
            D+VE+L+DLII A + A   +E+   +   +IT GL IP
Sbjct: 71  PDDVEMLQDLIITAVNGAIASVEEKSNSAMNKITGGLNIP 110


>gi|294085057|ref|YP_003551817.1| hypothetical protein SAR116_1490 [Candidatus Puniceispirillum
           marinum IMCC1322]
 gi|292664632|gb|ADE39733.1| conserved hypothetical protein TIGR00103 [Candidatus
           Puniceispirillum marinum IMCC1322]
          Length = 107

 Score = 67.8 bits (164), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 60/107 (56%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+M M+ + +E+Q +M+ +++ + +     +     V+V +NGK  L  VKI    L 
Sbjct: 1   MRNMMGMMKKAQEVQSRMQSLQDDMANARFSASVASDAVTVTVNGKGHLQAVKIAPDALA 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            ++ ++LEDLI+ A + A  +    +  +  +IT GL +PPG+  PF
Sbjct: 61  TNDSDMLEDLILLASNRACDEANKAMKAQMADITGGLDLPPGMNLPF 107


>gi|71083214|ref|YP_265933.1| hypothetical protein SAR11_0508 [Candidatus Pelagibacter ubique
           HTCC1062]
 gi|91762356|ref|ZP_01264321.1| Uncharacterized BCR [Candidatus Pelagibacter ubique HTCC1002]
 gi|71062327|gb|AAZ21330.1| Uncharacterized BCR [Candidatus Pelagibacter ubique HTCC1062]
 gi|91718158|gb|EAS84808.1| Uncharacterized BCR [Candidatus Pelagibacter ubique HTCC1002]
          Length = 105

 Score = 67.8 bits (164), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 35/107 (32%), Positives = 68/107 (63%), Gaps = 2/107 (1%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M++  K++ + KE++ KM++ +E I +++ EG +G   V V +NG+N +  + +   +L 
Sbjct: 1   MTDFTKILDKAKELEAKMKESQEKIKNIQVEGTSGSNSVKVTLNGENEMIKIDLSDEILK 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           E+ + I+EDLI+AAH++A  +++   + +  + T GL I PG K+P 
Sbjct: 61  ENKI-IIEDLIVAAHNNAKSELKSKTSEEISKSTSGLGI-PGFKWPL 105


>gi|15604696|ref|NP_221214.1| hypothetical protein RP866 [Rickettsia prowazekii str. Madrid E]
 gi|12644648|sp|Q9ZCA0|Y866_RICPR RecName: Full=UPF0133 protein RP866
 gi|3861391|emb|CAA15290.1| unknown [Rickettsia prowazekii]
 gi|292572531|gb|ADE30446.1| hypothetical protein rpr22_CDS846 [Rickettsia prowazekii Rp22]
          Length = 107

 Score = 67.8 bits (164), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 58/107 (54%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N  + + Q + +Q KM++ +E + +    G AGG +V + I GK  +  + ID SLL 
Sbjct: 1   MVNFNQFLKQAQSMQKKMQEAQEQMANTRYTGKAGGMLVEIIITGKGEVEKISIDESLLK 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            +  E+LEDLI  A +DA +K ++           G+ +PPG K PF
Sbjct: 61  TEEKEMLEDLIKVAFNDAKQKCDEDSQNSLSGALNGMSLPPGFKIPF 107


>gi|89900251|ref|YP_522722.1| hypothetical protein Rfer_1458 [Rhodoferax ferrireducens T118]
 gi|89344988|gb|ABD69191.1| conserved hypothetical protein 103 [Rhodoferax ferrireducens T118]
          Length = 110

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 63/99 (63%), Gaps = 2/99 (2%)

Query: 10  QFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILED 69
           Q + +Q  M+K ++ + ++E  G +G G+V V +  K+ +  V ID SLL +D  ++LED
Sbjct: 13  QAQAMQDNMKKAQDELGNVEVTGESGAGLVKVLMTCKHDVRRVTIDPSLLADDK-DMLED 71

Query: 70  LIIAAHSDAHKKIEDLVATKTQEITEGLP-IPPGLKFPF 107
           L+ AA + A +K E+  A K  +IT G+P +P G+KFPF
Sbjct: 72  LVAAAFNAAVRKAEETSAEKMGKITAGMPSLPGGMKFPF 110


>gi|27904905|ref|NP_778031.1| hypothetical protein bbp426 [Buchnera aphidicola str. Bp (Baizongia
           pistaciae)]
 gi|31077052|sp|Q89A94|Y426_BUCBP RecName: Full=UPF0133 protein bbp_426
 gi|27904303|gb|AAO27136.1| hypothetical protein YbaB [Buchnera aphidicola str. Bp (Baizongia
           pistaciae)]
          Length = 110

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 35/107 (32%), Positives = 63/107 (58%), Gaps = 3/107 (2%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           ++N+M+     ++IQ +M+K+++ ++ +E  G +G G V V + G +    +++D++ + 
Sbjct: 7   LNNLMQHA---QKIQEQMKKIQQEVSEIEVTGESGAGAVKVTLIGSHYCKKIELDKNTIL 63

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           E + EILEDLI AA +DA +KI DL   K   I+  +     L  PF
Sbjct: 64  EHDKEILEDLITAAFNDAVRKISDLQKQKMSSISSEMKFSNNLNLPF 110


>gi|332970312|gb|EGK09304.1| hypothetical protein HMPREF0476_0968 [Kingella kingae ATCC 23330]
          Length = 111

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 60/99 (60%), Gaps = 4/99 (4%)

Query: 7   MVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFE--DNV 64
           ++ Q +++Q  M+K +  +   E EG AG G+V VR    +++T + I   L+ E  D+ 
Sbjct: 10  LMQQAQKMQDNMKKAQAELAQTEVEGQAGNGLVKVRSTCSHVITSLDISPDLISEAADDK 69

Query: 65  EILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGL 103
           E+LEDLI+AA +DAH+K E   + +  + T+GL  PPG 
Sbjct: 70  EMLEDLILAAIADAHEKAEQTTSARMSQFTQGL--PPGF 106


>gi|264677767|ref|YP_003277673.1| hypothetical protein CtCNB1_1631 [Comamonas testosteroni CNB-2]
 gi|299531588|ref|ZP_07044993.1| hypothetical protein CTS44_12394 [Comamonas testosteroni S44]
 gi|262208279|gb|ACY32377.1| conserved hypothetical protein [Comamonas testosteroni CNB-2]
 gi|298720304|gb|EFI61256.1| hypothetical protein CTS44_12394 [Comamonas testosteroni S44]
          Length = 110

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 63/99 (63%), Gaps = 2/99 (2%)

Query: 10  QFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILED 69
           Q + +Q  ++K +E + ++E EG +G G+V V +  K+ +  + ID SLL ED  ++LED
Sbjct: 13  QAQAMQDNLKKAQEELGNIEVEGESGAGLVKVVMTCKHDVKRITIDPSLLAEDK-DMLED 71

Query: 70  LIIAAHSDAHKKIEDLVATKTQEITEGLP-IPPGLKFPF 107
           L+ AA + A +K E+    K  +IT G+P +P G+KFPF
Sbjct: 72  LVAAAFNAAVRKAEETSNEKMGKITAGMPGLPGGMKFPF 110


>gi|332800256|ref|YP_004461755.1| hypothetical protein TepRe1_2335 [Tepidanaerobacter sp. Re1]
 gi|332697991|gb|AEE92448.1| UPF0133 protein ybaB [Tepidanaerobacter sp. Re1]
          Length = 106

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 65/100 (65%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+ K++ Q +++Q  M K+++ +     E  AGGG+V V  +GK  +  ++I   ++ 
Sbjct: 4   MGNMNKLMKQVQKMQQDMAKLQDELQERTVEATAGGGVVKVVASGKKQIVSIEISPEVVD 63

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
            D+VE+L+DL++AA ++A +K ED+VA +  ++T GL +P
Sbjct: 64  PDDVEMLQDLVMAATNEALQKAEDMVAEEMGKLTGGLNMP 103


>gi|296131619|ref|YP_003638866.1| hypothetical protein TherJR_0069 [Thermincola sp. JR]
 gi|296030197|gb|ADG80965.1| conserved hypothetical protein [Thermincola potens JR]
          Length = 107

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 65/100 (65%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+ KM+ Q +++Q  M KM+E + +   E  AGGG+V V  NGK  +  ++I    + 
Sbjct: 5   MGNMNKMIKQVQKMQQDMAKMQEELANKTVEATAGGGVVKVVANGKQEIKSIEIKPEAVD 64

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
            ++VE+L+DLI+AA ++A ++ +++VA +  ++T G+ IP
Sbjct: 65  PEDVEMLQDLILAAVNEALRQSQEMVANEMGKLTGGIKIP 104


>gi|262277952|ref|ZP_06055745.1| conserved hypothetical protein [alpha proteobacterium HIMB114]
 gi|262225055|gb|EEY75514.1| conserved hypothetical protein [alpha proteobacterium HIMB114]
          Length = 105

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 37/101 (36%), Positives = 64/101 (63%), Gaps = 1/101 (0%)

Query: 6   KMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVE 65
           KM+ Q +E+Q KM + K+ + ++ AEG +GGG + V++NG   +  + I   +L E+   
Sbjct: 5   KMLKQAQEMQQKMMEAKDGLKNVIAEGVSGGGAIKVQMNGHFEVIKIDISDEILKEEK-G 63

Query: 66  ILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFP 106
           ++EDLI+AA ++A K++E     +  ++T G  +PPG KFP
Sbjct: 64  VMEDLIVAATNNAKKEVEGKTQEEMSKLTGGFKMPPGFKFP 104


>gi|313622072|gb|EFR92663.1| hypothetical protein NT06LI_3052 [Listeria innocua FSL J1-023]
          Length = 93

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 60/91 (65%)

Query: 10  QFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILED 69
           Q +++Q +M K +  + + E  G AGGGMV+V+  GK ++T V I+  ++  +++E+L+D
Sbjct: 1   QMQKMQKEMAKAQADLEAQEFTGTAGGGMVTVKATGKRVITDVVINEEVVDPEDIEMLQD 60

Query: 70  LIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           L++AA +D  K+IED  +    + T+GL +P
Sbjct: 61  LVLAATNDVLKQIEDTTSQTMGKFTQGLNLP 91


>gi|114797665|ref|YP_759101.1| hypothetical protein HNE_0371 [Hyphomonas neptunium ATCC 15444]
 gi|123028407|sp|Q0C592|Y371_HYPNA RecName: Full=UPF0133 protein HNE_0371
 gi|114737839|gb|ABI75964.1| conserved hypothetical protein TIGR00103 [Hyphomonas neptunium ATCC
           15444]
          Length = 107

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 38/89 (42%), Positives = 57/89 (64%), Gaps = 2/89 (2%)

Query: 20  KMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAH 79
           ++++ I + EA+G AG G+V V++ GK  L  V ID+SL+  D+ EI+EDLI AAHSDA 
Sbjct: 20  EVQQKIENTEADGVAGAGLVRVKLRGKGELISVTIDKSLM-GDDPEIVEDLIKAAHSDAR 78

Query: 80  KKIEDLVATKTQEITEGL-PIPPGLKFPF 107
           K+++  +    +  T G   + PG K PF
Sbjct: 79  KRLDQAMEDAMKTATAGFGGMLPGFKLPF 107


>gi|315925750|ref|ZP_07921957.1| valyl-tRNA synthetase [Pseudoramibacter alactolyticus ATCC 23263]
 gi|315620859|gb|EFV00833.1| valyl-tRNA synthetase [Pseudoramibacter alactolyticus ATCC 23263]
          Length = 119

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 57/83 (68%), Gaps = 2/83 (2%)

Query: 23  ESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKKI 82
           E +   E EG AGGG V V + G  ++  VKID  ++ ED+VE+LEDLI+AA ++A+ ++
Sbjct: 36  EDLEEQEIEGTAGGGAVKVVMTGAKVVKSVKIDPDVIDEDDVEMLEDLIVAAVNEANSRV 95

Query: 83  EDLVATKTQEITEGLPIP--PGL 103
           ++L  ++  ++TEG+ +P  PGL
Sbjct: 96  DELTGSEMGKLTEGISMPNIPGL 118


>gi|56707921|ref|YP_169817.1| hypothetical protein FTT_0810c [Francisella tularensis subsp.
           tularensis SCHU S4]
 gi|110670392|ref|YP_666949.1| hypothetical protein FTF0810c [Francisella tularensis subsp.
           tularensis FSC198]
 gi|81597620|sp|Q5NGM5|Y810_FRATT RecName: Full=UPF0133 protein FTT_0810c
 gi|123063498|sp|Q14I27|Y810_FRAT1 RecName: Full=UPF0133 protein FTF0810c
 gi|54113507|gb|AAV29387.1| NT02FT0741 [synthetic construct]
 gi|56604413|emb|CAG45443.1| conserved hypothetical UPF0133 protein ybaB [Francisella tularensis
           subsp. tularensis SCHU S4]
 gi|110320725|emb|CAL08826.1| conserved hypothetical UPF0133 protein ybaB [Francisella tularensis
           subsp. tularensis FSC198]
 gi|282159106|gb|ADA78497.1| conserved hypothetical UPF0133 protein ybaB [Francisella tularensis
           subsp. tularensis NE061598]
          Length = 112

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 70/110 (63%), Gaps = 7/110 (6%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           ++ K++ Q +++Q +M+K ++   ++E  G +G G+V+V + GK  +  V ID SL+ ED
Sbjct: 4   DMSKLMQQAQKMQEQMKKAQQERENMEVIGESGAGLVTVTMTGKYDVKSVSIDNSLMSED 63

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITE-----GLPIPPGLKFPF 107
             EILEDLI AA + A KK+E+  +T + +I +     G+ +P G+ FPF
Sbjct: 64  K-EILEDLIAAAVNSAVKKVEE-NSTASSDIYKMAKDAGIDLPSGINFPF 111


>gi|225872171|ref|YP_002753626.1| conserved hypothetical protein TIGR00103 [Acidobacterium capsulatum
           ATCC 51196]
 gi|254803971|sp|C1F0Z2|Y492_ACIC5 RecName: Full=UPF0133 protein ACP_0492
 gi|225794191|gb|ACO34281.1| conserved hypothetical protein TIGR00103 [Acidobacterium capsulatum
           ATCC 51196]
          Length = 108

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 66/105 (62%), Gaps = 8/105 (7%)

Query: 4   IMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFE-- 61
           + +M+ Q KE+Q   E+M+E + +   E ++GGG VSV++NGK  L  + ID + +    
Sbjct: 6   MQQMLSQAKEMQ---EQMQEKLAATVVEASSGGGAVSVKMNGKKELLKLTIDPAAVLSLS 62

Query: 62  ---DNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGL 103
               +VE+LEDLI AA ++A ++ E+++ +  Q +  GL +PPGL
Sbjct: 63  GANPDVEMLEDLITAAINEAGRRAEEILKSSMQGLLGGLNLPPGL 107


>gi|225023624|ref|ZP_03712816.1| hypothetical protein EIKCOROL_00484 [Eikenella corrodens ATCC
           23834]
 gi|224943506|gb|EEG24715.1| hypothetical protein EIKCOROL_00484 [Eikenella corrodens ATCC
           23834]
          Length = 113

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 38/109 (34%), Positives = 65/109 (59%), Gaps = 5/109 (4%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           + N+M+   Q +++Q KM++ +  + ++  EG AGGGMV + ++  + +  V ID SL  
Sbjct: 7   LGNLMQ---QAQKMQEKMKQAQAELANITVEGEAGGGMVKITLSCHHAVKRVHIDDSLAA 63

Query: 61  E--DNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           +   + E+LEDLI AA +DA +K+E        + T+GL +PPG+   F
Sbjct: 64  DAASDKEMLEDLIAAAFNDATRKVEAAAQQHMSQFTQGLGLPPGMDNFF 112


>gi|182677254|ref|YP_001831400.1| hypothetical protein Bind_0255 [Beijerinckia indica subsp. indica
           ATCC 9039]
 gi|238691215|sp|B2ICM2|Y255_BEII9 RecName: Full=UPF0133 protein Bind_0255
 gi|182633137|gb|ACB93911.1| conserved hypothetical protein [Beijerinckia indica subsp. indica
           ATCC 9039]
          Length = 101

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 62/100 (62%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M ++M ++ Q + +Q K++ M+ ++  +  EG+AGGG+V + +  K  +  V ID SLL 
Sbjct: 1   MKDMMGLLKQAQAMQAKVQDMQAALEQITVEGHAGGGLVKITLTVKGQIRSVSIDPSLLK 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
            +  EI+EDL+  A+ +A  + E ++  K +E+T G+ +P
Sbjct: 61  PEEKEIVEDLVALAYENARHQAEQIMEEKMREVTGGMQLP 100


>gi|257066284|ref|YP_003152540.1| hypothetical protein Apre_0791 [Anaerococcus prevotii DSM 20548]
 gi|256798164|gb|ACV28819.1| conserved hypothetical protein [Anaerococcus prevotii DSM 20548]
          Length = 112

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 60/99 (60%)

Query: 2   SNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFE 61
           +N+  M+ Q K++Q +MEK +  I   E   +AGGG+V   +NGK  +  +KID  ++  
Sbjct: 11  ANMNNMMKQVKKMQEQMEKAQSEIEEKEFSSSAGGGVVEATVNGKKEVVNIKIDPDVVDP 70

Query: 62  DNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           ++VE+LEDLI+ A +DA KK  D       ++T G+ IP
Sbjct: 71  EDVEMLEDLIMVAVNDASKKASDYNEETMGKLTGGINIP 109


>gi|291288272|ref|YP_003505088.1| hypothetical protein Dacet_2370 [Denitrovibrio acetiphilus DSM
           12809]
 gi|290885432|gb|ADD69132.1| conserved hypothetical protein [Denitrovibrio acetiphilus DSM
           12809]
          Length = 104

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 70/102 (68%), Gaps = 1/102 (0%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           NI +M+ Q +++Q KME+++E  +    E  +GGGMV+V+++GK  +  +KI++ ++  +
Sbjct: 2   NIQQMMKQAQKMQKKMEEVQEEASKEIVEATSGGGMVTVQVSGKQEIVSIKIEKDVVDPE 61

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP-PGL 103
           +V++L+DL++AA ++  KK +++V  K   +T G+ +  PGL
Sbjct: 62  DVDMLQDLVLAAVNEGLKKSQEVVQEKMSAVTGGMGLNIPGL 103


>gi|210623909|ref|ZP_03294118.1| hypothetical protein CLOHIR_02069 [Clostridium hiranonis DSM 13275]
 gi|210153273|gb|EEA84279.1| hypothetical protein CLOHIR_02069 [Clostridium hiranonis DSM 13275]
          Length = 117

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 34/95 (35%), Positives = 62/95 (65%)

Query: 6   KMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVE 65
           KM+ Q +++Q  M K ++ +   E E + GGG V+V++NGK  L  + I   ++  D+VE
Sbjct: 20  KMLKQAQKMQEDMAKAQKELEEKEVEASVGGGAVTVKVNGKKELVSISIKEEVVDPDDVE 79

Query: 66  ILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           +LEDL+++A ++A + I++L A +  ++T G+ IP
Sbjct: 80  MLEDLVLSAVNEALRNIDNLQANQMNKLTGGMNIP 114


>gi|126731113|ref|ZP_01746921.1| hypothetical protein SSE37_21780 [Sagittula stellata E-37]
 gi|126708415|gb|EBA07473.1| hypothetical protein SSE37_21780 [Sagittula stellata E-37]
          Length = 104

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 59/102 (57%)

Query: 6   KMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVE 65
           KM+   KE+QGK+ ++++ + ++   G +G G+V      K  LTG++ID S+      E
Sbjct: 3   KMMQTAKEMQGKVAQLQDDLKTMTVTGESGAGLVKATATAKGELTGLEIDPSIFVASEKE 62

Query: 66  ILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           + EDLI+AA  DA  + +     + +++TE + +P  +K PF
Sbjct: 63  VAEDLILAAIKDAQARAQVRAEQEMRKLTEEMGLPADMKLPF 104


>gi|325274402|ref|ZP_08140490.1| hypothetical protein G1E_14462 [Pseudomonas sp. TJI-51]
 gi|324100463|gb|EGB98221.1| hypothetical protein G1E_14462 [Pseudomonas sp. TJI-51]
          Length = 95

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 38/85 (44%), Positives = 60/85 (70%), Gaps = 5/85 (5%)

Query: 1  MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
          M+ +MK   Q +++Q KM+KM+E + + E  G +GGG+VSV + G++ +  V ID+SL+ 
Sbjct: 6  MAGLMK---QAQQMQEKMQKMQEELANAEVTGQSGGGLVSVVMTGRHDVKRVSIDQSLMS 62

Query: 61 --EDNVEILEDLIIAAHSDAHKKIE 83
            ED+ E+LEDLI AA +DA +K+E
Sbjct: 63 TDEDDKEVLEDLIAAALNDAVRKVE 87


>gi|78043175|ref|YP_361463.1| hypothetical protein CHY_2674 [Carboxydothermus hydrogenoformans
           Z-2901]
 gi|77995290|gb|ABB14189.1| conserved hypothetical protein TIGR00103 [Carboxydothermus
           hydrogenoformans Z-2901]
          Length = 109

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 39/104 (37%), Positives = 64/104 (61%), Gaps = 1/104 (0%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+ KM+ Q +++Q  M K++E +     E  +GGGMV   +NGK  L  + I+   + 
Sbjct: 5   MGNMQKMLKQVQKMQQDMAKLQEGLNEKTVEATSGGGMVKAVVNGKQELVSLTINPQAVD 64

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP-PGL 103
            ++VE+L D+I AA ++A +K +D+VA +  +IT GL +  PGL
Sbjct: 65  PEDVEMLADMITAAVNEALRKSKDMVAEEMNKITGGLNLNLPGL 108


>gi|218779845|ref|YP_002431163.1| hypothetical protein Dalk_1999 [Desulfatibacillum alkenivorans
           AK-01]
 gi|218761229|gb|ACL03695.1| conserved hypothetical protein [Desulfatibacillum alkenivorans
           AK-01]
          Length = 104

 Score = 67.4 bits (163), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 66/100 (66%), Gaps = 3/100 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M NIMK   Q +++Q +M K++E +     E +AGGGMV V +NGK  +  ++I++ ++ 
Sbjct: 5   MGNIMK---QAQKLQNQMAKLQEELGDKTVEASAGGGMVKVVVNGKQQVLSIEIEKEVVD 61

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
            ++VE+L+D+++AA ++   K +D+V  +  ++T G+ IP
Sbjct: 62  PEDVEMLQDMVLAAVNEGLNKSQDMVQGEMGKLTGGMNIP 101


>gi|121607505|ref|YP_995312.1| hypothetical protein Veis_0510 [Verminephrobacter eiseniae EF01-2]
 gi|121552145|gb|ABM56294.1| conserved hypothetical protein 103 [Verminephrobacter eiseniae
           EF01-2]
          Length = 110

 Score = 67.4 bits (163), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 68/108 (62%), Gaps = 5/108 (4%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           ++ +MK   Q + +Q  ++K ++ +  +E EG +G G+V V +  K+ +  ++ID SLL 
Sbjct: 7   LAGLMK---QAQAMQDNLKKAQDELALIEVEGESGAGLVKVLMTCKHDVKRIRIDPSLLA 63

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLP-IPPGLKFPF 107
           ED  ++LEDL+ AA + A +K E+    K  ++T G+P +P G+KFPF
Sbjct: 64  EDK-DMLEDLVAAAFNAAVRKAEETSEQKMGKLTAGMPGLPGGMKFPF 110


>gi|283850683|ref|ZP_06367970.1| conserved hypothetical protein [Desulfovibrio sp. FW1012B]
 gi|283573926|gb|EFC21899.1| conserved hypothetical protein [Desulfovibrio sp. FW1012B]
          Length = 103

 Score = 67.4 bits (163), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 66/100 (66%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M  + ++V Q + +Q KM K++E +     EG+AGGGMV+  ++G N L  + ID++++ 
Sbjct: 1   MKGMNELVRQAQIMQKKMAKLQEELEVKTVEGSAGGGMVTAVVSGSNELKSIVIDKTVVD 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
            ++VE+L+DLI+AA +D  KK + ++  +  ++T G+ +P
Sbjct: 61  PNDVEMLQDLILAAVNDGLKKAKAMMEAEMGQVTGGIKVP 100


>gi|24217031|ref|NP_714512.1| hypothetical protein LA_4332 [Leptospira interrogans serovar Lai
           str. 56601]
 gi|45659290|ref|YP_003376.1| hypothetical protein LIC13475 [Leptospira interrogans serovar
           Copenhageni str. Fiocruz L1-130]
 gi|30316310|sp|Q8EY85|Y4332_LEPIN RecName: Full=UPF0133 protein LA_4332
 gi|61217582|sp|Q72LS6|Y3475_LEPIC RecName: Full=UPF0133 protein LIC_13475
 gi|24198440|gb|AAN51530.1|AE011586_5 conserved hypothetical protein [Leptospira interrogans serovar Lai
           str. 56601]
 gi|45602536|gb|AAS72013.1| conserved hypothetical protein [Leptospira interrogans serovar
           Copenhageni str. Fiocruz L1-130]
          Length = 115

 Score = 67.0 bits (162), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 62/100 (62%), Gaps = 3/100 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
            S I+  +G F+E   KME++K+ I S+   G+AG GMV+V  +G+  +T V I++ L  
Sbjct: 8   FSEILSNMGSFRE---KMEEVKKRIASIRVVGDAGAGMVTVTASGEGQITNVFINKQLFD 64

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
            D+ ++LEDL++AA +DA KK ++  A + Q  + GL   
Sbjct: 65  ADDNKMLEDLVMAATNDALKKAKEATAYEFQSASGGLDFS 104


>gi|157965022|ref|YP_001499846.1| hypothetical protein RMA_1369 [Rickettsia massiliae MTU5]
 gi|157844798|gb|ABV85299.1| hypothetical protein RMA_1369 [Rickettsia massiliae MTU5]
          Length = 108

 Score = 67.0 bits (162), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 57/107 (53%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N  + + Q + +Q KM++ +E + +    G AGG +V V   GK  +  + ID SLL 
Sbjct: 2   MVNFNQFLKQAQSMQKKMQEAQEQMANARYTGKAGGRLVEVIATGKGEVEKISIDESLLK 61

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            +  E+LEDLI  A +DA +K ++           G+ +PPG K PF
Sbjct: 62  AEEKEMLEDLIKVAFNDAKQKCDEDSQNSLSGALNGMSLPPGFKMPF 108


>gi|85703837|ref|ZP_01034940.1| hypothetical protein ROS217_12601 [Roseovarius sp. 217]
 gi|85671157|gb|EAQ26015.1| hypothetical protein ROS217_12601 [Roseovarius sp. 217]
          Length = 128

 Score = 67.0 bits (162), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 35/107 (32%), Positives = 59/107 (55%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M ++ KM+   +E+Q KM  +++ + ++   G +G G+V      K  L  + ID S+  
Sbjct: 22  MGDMAKMMKAAQEMQKKMAALQDEMHTIMVTGESGAGLVKATCTAKGELKALDIDPSIFN 81

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            D+ E++EDLI+AA  DA  K       +  +ITEG+ +P  +K PF
Sbjct: 82  SDDKEVVEDLILAAIKDAQAKASARAQEEMGKITEGMGLPKDMKLPF 128


>gi|294101973|ref|YP_003553831.1| hypothetical protein Amico_0982 [Aminobacterium colombiense DSM
          12261]
 gi|293616953|gb|ADE57107.1| conserved hypothetical protein [Aminobacterium colombiense DSM
          12261]
          Length = 102

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 60/92 (65%)

Query: 6  KMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVE 65
          K++ Q +++Q +M KM+E +     EGNAGGGMV V  NG+  +  VKI++ ++  +++E
Sbjct: 5  KLMKQAQKMQAQMMKMQEELAHERVEGNAGGGMVKVIANGQGDIVSVKIEKEVVDPEDIE 64

Query: 66 ILEDLIIAAHSDAHKKIEDLVATKTQEITEGL 97
          +LEDL++AA SDA K   +L  +K  + +  L
Sbjct: 65 MLEDLVLAAVSDALKNSRELANSKMGQFSGAL 96


>gi|118497786|ref|YP_898836.1| hypothetical protein FTN_1196 [Francisella tularensis subsp.
           novicida U112]
 gi|194323758|ref|ZP_03057534.1| conserved hypothetical protein [Francisella tularensis subsp.
           novicida FTE]
 gi|208779849|ref|ZP_03247193.1| conserved hypothetical protein [Francisella novicida FTG]
 gi|254373143|ref|ZP_04988632.1| conserved hypothetical protein [Francisella tularensis subsp.
           novicida GA99-3549]
 gi|206558134|sp|A0Q767|Y1196_FRATN RecName: Full=UPF0133 protein FTN_1196
 gi|118423692|gb|ABK90082.1| conserved protein of unknown function [Francisella novicida U112]
 gi|151570870|gb|EDN36524.1| conserved hypothetical protein [Francisella novicida GA99-3549]
 gi|194322122|gb|EDX19604.1| conserved hypothetical protein [Francisella tularensis subsp.
           novicida FTE]
 gi|208744304|gb|EDZ90604.1| conserved hypothetical protein [Francisella novicida FTG]
 gi|332678502|gb|AEE87631.1| Transcriptional regulatory protein [Francisella cf. novicida Fx1]
          Length = 112

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 70/110 (63%), Gaps = 7/110 (6%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           ++ K++ Q +++Q +M+K ++   ++E  G +G G+V+V + GK  +  V ID SL+ ED
Sbjct: 4   DMSKLMQQAQKMQEQMKKAQQERENMEVIGESGAGLVTVTMTGKYDVKSVSIDNSLMSED 63

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITE-----GLPIPPGLKFPF 107
             EILEDLI AA + A KK+E+  +T + +I +     G+ +P G+ FPF
Sbjct: 64  K-EILEDLIAAAVNSAVKKVEE-NSTASSDIHKMAKDAGIDLPSGINFPF 111


>gi|322804301|emb|CBZ01851.1| hypothetical protein co-occurring with RecR [Clostridium botulinum
           H04402 065]
          Length = 114

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 37/103 (35%), Positives = 65/103 (63%), Gaps = 3/103 (2%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M+N+MK   Q +++Q  MEKM+  +   E     GGG V+   NGK  +  +KI   ++ 
Sbjct: 14  MNNLMK---QAQKLQQDMEKMQGEMEKKEFSATVGGGAVTAVANGKKQIVDIKIKPEVVD 70

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGL 103
           ED++E+LEDLI++A ++A KK E+  +++ + +T G+ +P G+
Sbjct: 71  EDDIEMLEDLILSACNEALKKAEEDTSSEMKRLTGGMNLPGGM 113


>gi|167465484|ref|ZP_02330573.1| hypothetical protein Plarl_23472 [Paenibacillus larvae subsp.
           larvae BRL-230010]
 gi|322382240|ref|ZP_08056153.1| hypothetical protein PL1_3203 [Paenibacillus larvae subsp. larvae
           B-3650]
 gi|321153821|gb|EFX46189.1| hypothetical protein PL1_3203 [Paenibacillus larvae subsp. larvae
           B-3650]
          Length = 103

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 63/100 (63%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+ +M+ Q K++Q +M K++E + +   EG AGGG+V+V  NG   +T + I    + 
Sbjct: 1   MQNMNQMMKQVKKMQQQMVKVQEELANKTVEGTAGGGVVTVTANGHKKITNIVIQPEAVD 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
            ++VE+L+DL++AA +DA  K ++L A    + T G+ +P
Sbjct: 61  PEDVEMLQDLVLAAVNDALSKADELAAKDMGKFTGGMNLP 100


>gi|99080006|ref|YP_612160.1| hypothetical protein TM1040_0165 [Ruegeria sp. TM1040]
 gi|99036286|gb|ABF62898.1| conserved hypothetical protein 103 [Ruegeria sp. TM1040]
          Length = 114

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 36/107 (33%), Positives = 62/107 (57%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           + ++  M+ + +E+Q KM +M+E + ++   G AG G+V    + K  L  + ID S+  
Sbjct: 8   LGDMAGMMKKAQEMQSKMGEMQEELHNIMVVGEAGAGLVKATASAKGDLKSLDIDPSIFN 67

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            D+ E++EDLI+AA  DA  K  +    +  ++TEGL +P  +K PF
Sbjct: 68  GDDKEVVEDLILAAVKDAQTKAAERAQDEMTKLTEGLGLPKDMKLPF 114


>gi|325111244|ref|YP_004272312.1| hypothetical protein Plabr_4719 [Planctomyces brasiliensis DSM
           5305]
 gi|324971512|gb|ADY62290.1| UPF0133 protein ybaB [Planctomyces brasiliensis DSM 5305]
          Length = 116

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 65/100 (65%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           +SN+  M+ Q +EIQGKM +M+ES+ S+  EG AG GMV V +NG+  +   +I+ S+L 
Sbjct: 5   LSNLASMMKQAQEIQGKMGEMQESLKSVHVEGEAGAGMVKVVVNGQQQVVSCQIEPSVLE 64

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
             + E+LE+L ++A + A  K  +  ++K  E+TEG+  P
Sbjct: 65  SGDREMLEELFVSATNQALDKSREAASSKMSELTEGMNFP 104


>gi|218289069|ref|ZP_03493306.1| conserved hypothetical protein [Alicyclobacillus acidocaldarius
           LAA1]
 gi|218240894|gb|EED08072.1| conserved hypothetical protein [Alicyclobacillus acidocaldarius
           LAA1]
          Length = 103

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 61/100 (61%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+ +++ Q K++Q ++ K + S+     EG AGGG V VR+NG   +  V+ID+S++ 
Sbjct: 1   MKNMNQLMRQAKKMQEEILKAQASLAEKMVEGTAGGGAVKVRMNGHKDVVAVEIDKSVVS 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
            D+V++L+DLI+ A  DA +K   L      + T GL +P
Sbjct: 61  PDDVDMLQDLILVAIQDASQKANHLAEEVMGKYTRGLNLP 100


>gi|153873914|ref|ZP_02002330.1| conserved hypothetical protein [Beggiatoa sp. PS]
 gi|152069621|gb|EDN67669.1| conserved hypothetical protein [Beggiatoa sp. PS]
          Length = 107

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 67/107 (62%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           ++N+MK   Q ++I+   E  ++ + ++E  G +GGGMV + + G++ +  V+ID +L+ 
Sbjct: 5   LANLMK---QAQKIKTDFEDAQKELANIEIIGESGGGMVRIFMTGRHDVQRVEIDNTLMT 61

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED  E+LEDL+ A+ +DA +K+E +   K   +  G  +P G+K PF
Sbjct: 62  EDK-EMLEDLVAASVNDAVRKVEKISQEKLSGLAGGFGLPEGIKLPF 107


>gi|124516358|gb|EAY57866.1| conserved protein of unknown function [Leptospirillum rubarum]
          Length = 104

 Score = 67.0 bits (162), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 66/107 (61%), Gaps = 7/107 (6%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M + MK   + +E+Q KM K++E   S   EG+AGG MV+V +NG+  +  ++I+ ++L 
Sbjct: 2   MPDFMK---KAQELQEKMAKIQEDAGSRTVEGSAGGKMVTVTVNGRMEVVSLRIEPAILK 58

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGL-KFP 106
            ++   +EDLI+AA +D  KK  D++A   Q + E   +PPGL  FP
Sbjct: 59  NEDPAFIEDLIVAALNDGLKKARDMMA---QSLLEASGLPPGLGGFP 102


>gi|332184289|gb|AEE26543.1| hypothetical protein FN3523_1240 [Francisella cf. novicida 3523]
          Length = 112

 Score = 67.0 bits (162), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 69/110 (62%), Gaps = 7/110 (6%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           ++ K++ Q + +Q +M+K ++   ++E  G +G G+V+V + GK  +  V ID SL+ ED
Sbjct: 4   DMSKLMQQAQRMQEQMKKAQQERENMEVLGESGAGLVTVTMTGKYDVKSVSIDSSLMSED 63

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITE-----GLPIPPGLKFPF 107
             EILEDLI AA + A KK+E+  +T + +I +     G+ +P G+ FPF
Sbjct: 64  K-EILEDLIAAAVNSAVKKVEE-NSTASTDIHKMAKDAGIDLPSGINFPF 111


>gi|262200017|ref|YP_003271226.1| hypothetical protein Hoch_6869 [Haliangium ochraceum DSM 14365]
 gi|262083364|gb|ACY19333.1| conserved hypothetical protein [Haliangium ochraceum DSM 14365]
          Length = 111

 Score = 67.0 bits (162), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 66/100 (66%), Gaps = 3/100 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           + N+M +    +++QG + K+++ ++ +E E ++GGGMV+ R+NG+  +  + ID++++ 
Sbjct: 9   LGNLMNLA---QKLQGDVNKLQDELSRMECEASSGGGMVTARVNGEYQVVSIAIDKNVVD 65

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
            ++V +L+DL++AA + A  K+ D    +  ++T G+ +P
Sbjct: 66  PEDVGMLQDLVVAAVNQAMTKMRDTAQQEMAKLTGGINVP 105


>gi|145628812|ref|ZP_01784612.1| hypothetical protein CGSHi22121_07340 [Haemophilus influenzae
          22.1-21]
 gi|144979282|gb|EDJ88968.1| hypothetical protein CGSHi22121_07340 [Haemophilus influenzae
          22.1-21]
          Length = 104

 Score = 67.0 bits (162), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 36/84 (42%), Positives = 55/84 (65%), Gaps = 1/84 (1%)

Query: 10 QFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILED 69
          Q +++Q KM+KM+E I  LE  G +G G+V + ING +    + ID SL+ ED+ E+LED
Sbjct: 13 QAQQMQEKMQKMQEEIAQLEVTGESGAGLVKITINGAHNCRRIDIDPSLM-EDDKEMLED 71

Query: 70 LIIAAHSDAHKKIEDLVATKTQEI 93
          LI AA +DA ++ E+L   K  ++
Sbjct: 72 LIAAAFNDAVRRAEELQKEKWHQL 95


>gi|110639060|ref|YP_679269.1| hypothetical protein CHU_2675 [Cytophaga hutchinsonii ATCC 33406]
 gi|110281741|gb|ABG59927.1| conserved hypothetical protein [Cytophaga hutchinsonii ATCC 33406]
          Length = 112

 Score = 67.0 bits (162), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 38/106 (35%), Positives = 66/106 (62%), Gaps = 1/106 (0%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M ++M M+G+ KE+Q +M+++K+ +  + A+G +G G+V+   NG   +  + ID SLL 
Sbjct: 1   MFDMMGMMGKVKEMQARMKEVKDGLVHITADGESGAGLVTATANGAKQVVRINIDPSLLK 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEG-LPIPPGLKF 105
           E +  IL+DLI+AA + A +  E+    + ++ TEG LP  PG+  
Sbjct: 61  ETDQIILQDLIVAAVNKALQNAEEKAQAEFKKKTEGLLPNIPGMDL 106


>gi|89256704|ref|YP_514066.1| hypothetical protein FTL_1411 [Francisella tularensis subsp.
           holarctica LVS]
 gi|115315112|ref|YP_763835.1| hypothetical protein FTH_1374 [Francisella tularensis subsp.
           holarctica OSU18]
 gi|156502865|ref|YP_001428930.1| hypothetical protein FTA_1499 [Francisella tularensis subsp.
           holarctica FTNF002-00]
 gi|167010457|ref|ZP_02275388.1| hypothetical protein Ftulh_07017 [Francisella tularensis subsp.
           holarctica FSC200]
 gi|254368011|ref|ZP_04984031.1| hypothetical protein FTHG_01323 [Francisella tularensis subsp.
           holarctica 257]
 gi|254369563|ref|ZP_04985574.1| conserved hypothetical protein [Francisella tularensis subsp.
           holarctica FSC022]
 gi|290954136|ref|ZP_06558757.1| hypothetical protein FtulhU_07732 [Francisella tularensis subsp.
           holarctica URFT1]
 gi|295312454|ref|ZP_06803226.1| hypothetical protein FtulhU_07724 [Francisella tularensis subsp.
           holarctica URFT1]
 gi|122324886|sp|Q0BL36|Y1374_FRATO RecName: Full=UPF0133 protein FTH_1374
 gi|122500483|sp|Q2A2I6|Y1411_FRATH RecName: Full=UPF0133 protein FTL_1411
 gi|189043395|sp|A7NDC1|Y1499_FRATF RecName: Full=UPF0133 protein FTA_1499
 gi|89144535|emb|CAJ79850.1| conserved hypothetical UPF0133 protein ybaB [Francisella tularensis
           subsp. holarctica LVS]
 gi|115130011|gb|ABI83198.1| conserved hypothetical protein [Francisella tularensis subsp.
           holarctica OSU18]
 gi|134253821|gb|EBA52915.1| hypothetical protein FTHG_01323 [Francisella tularensis subsp.
           holarctica 257]
 gi|156253468|gb|ABU61974.1| conserved hypothetical protein [Francisella tularensis subsp.
           holarctica FTNF002-00]
 gi|157122517|gb|EDO66652.1| conserved hypothetical protein [Francisella tularensis subsp.
           holarctica FSC022]
          Length = 112

 Score = 66.6 bits (161), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 69/110 (62%), Gaps = 7/110 (6%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           ++ K++ Q +++Q +M+K ++   ++E  G +G G+V+V + GK  +  V ID SL+ ED
Sbjct: 4   DMSKLMQQAQKMQEQMKKAQQERENMEVIGESGAGLVTVTMTGKYDVKSVSIDNSLMSED 63

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITE-----GLPIPPGLKFPF 107
             EILEDLI AA + A KK+E+  +T +  I +     G+ +P G+ FPF
Sbjct: 64  K-EILEDLIAAAVNSAVKKVEE-NSTASSNIYKMAKDAGIDLPSGINFPF 111


>gi|206603200|gb|EDZ39680.1| Protein of unknown function [Leptospirillum sp. Group II '5-way
           CG']
          Length = 104

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 66/107 (61%), Gaps = 7/107 (6%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M + MK   + +E+Q KM K++E   S   EG+AGG MV+V +NG+  +  ++I+ ++L 
Sbjct: 2   MPDFMK---KAQELQEKMAKIQEDAGSRTVEGSAGGKMVTVTVNGRMEVVSLRIEPAVLK 58

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGL-KFP 106
            ++   +EDLI+AA +D  KK  D++A   Q + E   +PPGL  FP
Sbjct: 59  NEDPAFIEDLIVAALNDGLKKARDMMA---QSLLEASGLPPGLGGFP 102


>gi|224368756|ref|YP_002602917.1| hypothetical protein HRM2_16460 [Desulfobacterium autotrophicum
           HRM2]
 gi|223691472|gb|ACN14755.1| hypothetical protein HRM2_16460 [Desulfobacterium autotrophicum
           HRM2]
          Length = 100

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 61/94 (64%)

Query: 7   MVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEI 66
           M+ Q +++Q KM KM+E + +   E  AGGGMV V  NG   +  + ++R ++  +++E+
Sbjct: 4   MMKQAQKLQKKMLKMQEELATKTVEATAGGGMVKVIANGSQKIEAITLEREVVDPEDIEM 63

Query: 67  LEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           L+DLI+AA +DA  K +++V+    ++T G+ +P
Sbjct: 64  LQDLILAATNDALNKSQEMVSAHMGKLTGGMNLP 97


>gi|300853306|ref|YP_003778290.1| hypothetical protein CLJU_c00860 [Clostridium ljungdahlii DSM
           13528]
 gi|300433421|gb|ADK13188.1| conserved hypothetical protein [Clostridium ljungdahlii DSM 13528]
          Length = 114

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 61/94 (64%)

Query: 7   MVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEI 66
           ++ Q +++Q +ME M+  + + E    AGGG V+V +NGK  +  +KI   ++  ++VE+
Sbjct: 18  LMKQAQKLQKQMETMQSELQNKEFSATAGGGAVTVSVNGKKEIVDIKIKPEVVDPEDVEM 77

Query: 67  LEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           L+DLI+AA ++A K  E   A++ Q++T GL IP
Sbjct: 78  LQDLILAACNEALKNAEKETASEMQKVTGGLNIP 111


>gi|282882855|ref|ZP_06291460.1| conserved hypothetical protein [Peptoniphilus lacrimalis 315-B]
 gi|281297266|gb|EFA89757.1| conserved hypothetical protein [Peptoniphilus lacrimalis 315-B]
          Length = 113

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 65/100 (65%), Gaps = 3/100 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M+N+MK   Q +++Q +M  M+E++ + E    +GGG V+  +NG   +  +K+D+  + 
Sbjct: 15  MNNMMK---QIEKLQKEMADMQENLKNEEISATSGGGAVTATVNGNKEVISIKLDKEAVD 71

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
            ++VE+LEDLI+AA ++A +  E+ V +K  ++T GL IP
Sbjct: 72  PEDVEMLEDLIVAAVNEALRNAENKVNSKMSKLTGGLNIP 111


>gi|262171933|ref|ZP_06039611.1| DUF149 domain-containing protein [Vibrio mimicus MB-451]
 gi|261893009|gb|EEY38995.1| DUF149 domain-containing protein [Vibrio mimicus MB-451]
          Length = 111

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 36/84 (42%), Positives = 58/84 (69%), Gaps = 4/84 (4%)

Query: 1  MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
          M N+MK   Q +++Q +M+K++E I ++E  G +G G+V V + G + +  V ID SL+ 
Sbjct: 7  MGNLMK---QAQQMQERMQKLQEEIANMEVTGESGAGLVKVTVTGSHSVRRVNIDESLM- 62

Query: 61 EDNVEILEDLIIAAHSDAHKKIED 84
          ED+ E+LEDLI AA +DA ++IE+
Sbjct: 63 EDDKEMLEDLIAAAFNDAARRIEE 86


>gi|300814082|ref|ZP_07094365.1| DNA-binding protein, YbaB/EbfC family [Peptoniphilus sp. oral taxon
           836 str. F0141]
 gi|300511739|gb|EFK38956.1| DNA-binding protein, YbaB/EbfC family [Peptoniphilus sp. oral taxon
           836 str. F0141]
          Length = 113

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 65/100 (65%), Gaps = 3/100 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M+N+MK   Q +++Q +M  M+E++ + E    +GGG V+  +NG   +  +K+D+  + 
Sbjct: 15  MNNMMK---QIEKLQKEMADMQENLKNEEISATSGGGAVTATVNGNKEVISIKLDKEAVD 71

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
            ++VE+LEDLI+AA ++A +  E+ V +K  ++T GL IP
Sbjct: 72  PEDVEMLEDLIVAAVNEALRNAENKVNSKMSKLTGGLNIP 111


>gi|288574939|ref|ZP_06393296.1| conserved hypothetical protein [Dethiosulfovibrio peptidovorans
          DSM 11002]
 gi|288570680|gb|EFC92237.1| conserved hypothetical protein [Dethiosulfovibrio peptidovorans
          DSM 11002]
          Length = 105

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 62/94 (65%), Gaps = 3/94 (3%)

Query: 1  MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
          M+NIMK   Q +++Q +ME+++ S+     EGN+GGGMV+   NG   +  +KI   ++ 
Sbjct: 3  MNNIMK---QAQKMQAQMERVQASLADDRVEGNSGGGMVTATANGHGEILSLKIAPEVVN 59

Query: 61 EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEIT 94
           +++E+LEDL++AA +DA +K ++L   K  +IT
Sbjct: 60 PEDIEMLEDLVLAAVNDAARKGQELAQKKMGQIT 93


>gi|311746114|ref|ZP_07719899.1| hypothetical protein ALPR1_06800 [Algoriphagus sp. PR1]
 gi|126576334|gb|EAZ80612.1| hypothetical protein ALPR1_06800 [Algoriphagus sp. PR1]
          Length = 111

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 37/106 (34%), Positives = 65/106 (61%), Gaps = 1/106 (0%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M +IM M+G+ KE Q K+++ +  +  L AEG +G G+V V +NG+  +  + +D SLL 
Sbjct: 1   MFDIMGMMGKVKEAQAKIKEAQAKLVHLTAEGESGAGLVKVTVNGERKVLKIDLDESLLT 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEG-LPIPPGLKF 105
            ++ E+L DL++AA + A + IE  +    ++ T+G +P  PG+  
Sbjct: 61  PNDKEMLTDLVVAATNIAMEAIEVKIKAAMKDATDGVIPNIPGMDL 106


>gi|221067923|ref|ZP_03544028.1| conserved hypothetical protein [Comamonas testosteroni KF-1]
 gi|220712946|gb|EED68314.1| conserved hypothetical protein [Comamonas testosteroni KF-1]
          Length = 110

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 63/99 (63%), Gaps = 2/99 (2%)

Query: 10  QFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILED 69
           Q + +Q  ++K ++ + ++E EG +G G+V V +  K+ +  + ID SLL ED  ++LED
Sbjct: 13  QAQAMQDNLKKAQDELGNIEVEGESGAGLVKVVMTCKHDVKRITIDPSLLAEDK-DMLED 71

Query: 70  LIIAAHSDAHKKIEDLVATKTQEITEGLP-IPPGLKFPF 107
           L+ AA + A +K E+    K  +IT G+P +P G+KFPF
Sbjct: 72  LVAAAFNAAVRKAEETSNEKMGKITAGMPGLPGGMKFPF 110


>gi|303245251|ref|ZP_07331535.1| conserved hypothetical protein [Desulfovibrio fructosovorans JJ]
 gi|302493100|gb|EFL52962.1| conserved hypothetical protein [Desulfovibrio fructosovorans JJ]
          Length = 103

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 66/100 (66%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M  + ++V Q + +Q KM K++E +     EG+AGGGMV+  ++G N L  + ID++++ 
Sbjct: 1   MKGMNELVRQAQVMQKKMAKLQEELQERTIEGSAGGGMVTAVVSGANELKSIAIDKTVVD 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
            ++VE+L+DL++AA +D  KK + ++  +  ++T G+ +P
Sbjct: 61  PNDVEMLQDLVLAAVNDGLKKAKAMMEEEMGQLTGGIKMP 100


>gi|84685227|ref|ZP_01013126.1| hypothetical protein 1099457000257_RB2654_10179 [Maritimibacter
           alkaliphilus HTCC2654]
 gi|84666959|gb|EAQ13430.1| hypothetical protein RB2654_10179 [Rhodobacterales bacterium
           HTCC2654]
          Length = 119

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 62/107 (57%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           + ++ KM+   +E+Q KM +M+E + ++   G +G G+V      K  L G+ ID S+  
Sbjct: 8   LGDMTKMMKAAQEMQTKMGEMQERLDTITVVGESGAGLVKATSTAKGELVGLDIDPSIFD 67

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            +  E++EDLI+AA  DA  K  +  + + Q+ITE L +P G+  PF
Sbjct: 68  PNEKEVVEDLILAAIKDAQVKASERSSQEMQKITEELGLPAGMGNPF 114


>gi|255994277|ref|ZP_05427412.1| putative cytoplasmic protein [Eubacterium saphenum ATCC 49989]
 gi|255993945|gb|EEU04034.1| putative cytoplasmic protein [Eubacterium saphenum ATCC 49989]
          Length = 118

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 67/100 (67%), Gaps = 3/100 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M+  M+ +G  +E   KM + +++I ++E E +AGGG V V++NGK  +  + ID+ ++ 
Sbjct: 19  MAEQMQKLGAMQE---KMNEAQKNIDAMELETSAGGGAVKVKVNGKKEVVSLNIDKDIVD 75

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
            ++VE+LEDL++AA ++  ++IE+  +   ++IT G+ IP
Sbjct: 76  PEDVEMLEDLVMAAVNEGIRQIEEASSKAMEDITSGIEIP 115


>gi|312128835|ref|YP_003996175.1| uncharacterized protein family upf0133 [Leadbetterella byssophila
           DSM 17132]
 gi|311905381|gb|ADQ15822.1| Uncharacterized protein family UPF0133 [Leadbetterella byssophila
           DSM 17132]
          Length = 109

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 34/98 (34%), Positives = 63/98 (64%), Gaps = 1/98 (1%)

Query: 7   MVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEI 66
           M+ + +++Q KM++ +E +  + AEG +GGGMV  ++NGK  L  V ++  LL  ++ +I
Sbjct: 4   MMNKMRDMQNKMQEAQEKLGEITAEGESGGGMVKAKVNGKKELLSVVLEPELLKPEDAKI 63

Query: 67  LEDLIIAAHSDAHKKIEDLVATKTQEITEG-LPIPPGL 103
            +DLI+AA ++A + +E+    +  ++T+G LP  PG 
Sbjct: 64  TQDLIVAAVNNALRNVEEEAKAEMAKVTDGLLPKIPGF 101


>gi|290968134|ref|ZP_06559679.1| DNA-binding protein, YbaB/EbfC family [Megasphaera genomosp. type_1
           str. 28L]
 gi|290781809|gb|EFD94392.1| DNA-binding protein, YbaB/EbfC family [Megasphaera genomosp. type_1
           str. 28L]
          Length = 105

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 31/98 (31%), Positives = 66/98 (67%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           N+  M+ + +++Q +ME+++  + +   E   GGG +++ ING  ++  V ID  ++  +
Sbjct: 5   NMQGMMKKVEKMQKEMERLQNELKNRTVEAGVGGGALTITINGAKIVQSVHIDPKIVDPE 64

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           + E+LEDLI+AA ++A+KK++++++ +  +IT G+ IP
Sbjct: 65  DTEMLEDLIVAAVNEANKKVDEMMSEEMSKITNGMRIP 102


>gi|84500404|ref|ZP_00998653.1| hypothetical protein OB2597_10616 [Oceanicola batsensis HTCC2597]
 gi|84391357|gb|EAQ03689.1| hypothetical protein OB2597_10616 [Oceanicola batsensis HTCC2597]
          Length = 121

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 36/107 (33%), Positives = 60/107 (56%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M ++ KM+   +E+Q K+  ++E +  +  EG +G G+V      K  L  + ID S+  
Sbjct: 15  MGDMAKMLKSAQELQTKVVALQEEMNHMTVEGRSGAGLVKAVATYKGELKSLDIDPSIFN 74

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            D  E++EDLI+AA  DA +K ++    +  ++TEGL +P   K PF
Sbjct: 75  PDEKEVVEDLILAAIKDAQQKAQEKHQEEMGKLTEGLGLPADFKMPF 121


>gi|253577376|ref|ZP_04854693.1| conserved hypothetical protein [Paenibacillus sp. oral taxon 786
           str. D14]
 gi|251843276|gb|EES71307.1| conserved hypothetical protein [Paenibacillus sp. oral taxon 786
           str. D14]
          Length = 103

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 63/100 (63%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M+N+ +M+ Q K++Q +M K +E + +   EG+AGGG+V+V++NG   +  + I    + 
Sbjct: 1   MNNMNQMMKQVKKMQEQMLKAQEELANKTVEGSAGGGVVTVQVNGHKKVLNLTIKPEAVD 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
            D+VE+L+DL++ A +DA  K E+L      + T G+ IP
Sbjct: 61  PDDVEMLQDLVLTAVNDALTKAEELANQDMGKFTGGIKIP 100


>gi|158520558|ref|YP_001528428.1| hypothetical protein Dole_0541 [Desulfococcus oleovorans Hxd3]
 gi|158509384|gb|ABW66351.1| conserved hypothetical protein [Desulfococcus oleovorans Hxd3]
          Length = 103

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 64/100 (64%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+  M+ Q +++Q +M K++E +     E  AGGGMV    NG+  +T + I++ ++ 
Sbjct: 1   MKNMGGMLKQAQKLQAQMVKLQEELAEKTVEATAGGGMVKATANGRQQITALVIEKEVVD 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
             +VE+L+DL++AA +DA  K ++++ ++  ++T GL IP
Sbjct: 61  PADVEMLQDLVLAAINDALTKSQEMMNSEMGKLTGGLNIP 100


>gi|145638648|ref|ZP_01794257.1| hypothetical protein CGSHiII_08036 [Haemophilus influenzae
          PittII]
 gi|145272243|gb|EDK12151.1| hypothetical protein CGSHiII_08036 [Haemophilus influenzae
          PittII]
          Length = 132

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 53/81 (65%), Gaps = 1/81 (1%)

Query: 10 QFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILED 69
          Q +++Q KM+KM+E I  LE  G +G G+V + ING +    + ID SL+ ED+ E+LED
Sbjct: 13 QAQQMQEKMQKMQEEIAQLEVTGESGAGLVKITINGAHNCRRIDIDPSLM-EDDKEMLED 71

Query: 70 LIIAAHSDAHKKIEDLVATKT 90
          LI AA +DA ++ E+L   K 
Sbjct: 72 LIAAAFNDAVRRAEELQKRKN 92


>gi|254520804|ref|ZP_05132860.1| transcriptional regulatory protein [Clostridium sp. 7_2_43FAA]
 gi|226914553|gb|EEH99754.1| transcriptional regulatory protein [Clostridium sp. 7_2_43FAA]
          Length = 114

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 65/100 (65%), Gaps = 3/100 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M+N+MK   Q +++Q  ME+M++ + + E E + GGG V V+ NGK  +  + I   ++ 
Sbjct: 15  MNNLMK---QAQKLQKDMEQMQKDLETKEFEASVGGGAVVVKANGKKEVVSINIKPEVVD 71

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
            D+VE+LEDL+++A ++A +K E+  A K  ++T G+ IP
Sbjct: 72  ADDVEMLEDLVLSAVNEALRKAEEESANKMGKLTGGMNIP 111


>gi|148378039|ref|YP_001252580.1| hypothetical protein CBO0032 [Clostridium botulinum A str. ATCC
           3502]
 gi|153934028|ref|YP_001382438.1| hypothetical protein CLB_0043 [Clostridium botulinum A str. ATCC
           19397]
 gi|153934643|ref|YP_001385991.1| hypothetical protein CLC_0052 [Clostridium botulinum A str. Hall]
 gi|153941296|ref|YP_001389394.1| hypothetical protein CLI_0048 [Clostridium botulinum F str.
           Langeland]
 gi|168181144|ref|ZP_02615808.1| conserved hypothetical protein TIGR00103 [Clostridium botulinum
           NCTC 2916]
 gi|168184982|ref|ZP_02619646.1| DNA-binding protein, YbaB/EbfC family [Clostridium botulinum Bf]
 gi|170757507|ref|YP_001779655.1| hypothetical protein CLD_0785 [Clostridium botulinum B1 str. Okra]
 gi|170759151|ref|YP_001785358.1| hypothetical protein CLK_3166 [Clostridium botulinum A3 str. Loch
           Maree]
 gi|226947245|ref|YP_002802336.1| hypothetical protein TIGR00103 [Clostridium botulinum A2 str.
           Kyoto]
 gi|237793343|ref|YP_002860895.1| conserved hypothetical protein TIGR00103 [Clostridium botulinum Ba4
           str. 657]
 gi|166227774|sp|A5HXS7|Y032_CLOBH RecName: Full=UPF0133 protein CBO0032/CLC_0052
 gi|166227781|sp|A7FQ66|Y043_CLOB1 RecName: Full=UPF0133 protein CLB_0043
 gi|166227782|sp|A7G9D4|Y048_CLOBL RecName: Full=UPF0133 protein CLI_0048
 gi|229890250|sp|B1IDW7|Y785_CLOBK RecName: Full=UPF0133 protein CLD_0785
 gi|238688731|sp|B1KRT6|Y3166_CLOBM RecName: Full=UPF0133 protein CLK_3166
 gi|254799464|sp|C1FPJ5|Y038_CLOBJ RecName: Full=UPF0133 protein CLM_0038
 gi|259491979|sp|C3KXS9|Y037_CLOB6 RecName: Full=UPF0133 protein CLJ_B0037
 gi|148287523|emb|CAL81585.1| conserved hypothetical protein [Clostridium botulinum A str. ATCC
           3502]
 gi|152930072|gb|ABS35572.1| conserved hypothetical protein TIGR00103 [Clostridium botulinum A
           str. ATCC 19397]
 gi|152930557|gb|ABS36056.1| conserved hypothetical protein TIGR00103 [Clostridium botulinum A
           str. Hall]
 gi|152937192|gb|ABS42690.1| conserved hypothetical protein TIGR00103 [Clostridium botulinum F
           str. Langeland]
 gi|169122719|gb|ACA46555.1| conserved hypothetical protein TIGR00103 [Clostridium botulinum B1
           str. Okra]
 gi|169406140|gb|ACA54551.1| conserved hypothetical protein TIGR00103 [Clostridium botulinum A3
           str. Loch Maree]
 gi|182668032|gb|EDT80011.1| conserved hypothetical protein TIGR00103 [Clostridium botulinum
           NCTC 2916]
 gi|182671962|gb|EDT83923.1| DNA-binding protein, YbaB/EbfC family [Clostridium botulinum Bf]
 gi|226841068|gb|ACO83734.1| conserved hypothetical protein TIGR00103 [Clostridium botulinum A2
           str. Kyoto]
 gi|229263287|gb|ACQ54320.1| conserved hypothetical protein TIGR00103 [Clostridium botulinum Ba4
           str. 657]
          Length = 113

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 64/100 (64%), Gaps = 3/100 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M+N+MK   Q +++Q  MEKM+  +   E     GGG V+   NGK  +  +KI+  ++ 
Sbjct: 14  MNNLMK---QAQKLQQDMEKMQGEMEKKEFSATVGGGAVTAVANGKKQIVDIKIEPEVVD 70

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           ED++E+LEDLI++A ++A KK E+  +++ + +T G+ +P
Sbjct: 71  EDDIEMLEDLIMSACNEALKKAEEDTSSEVKRLTGGMNLP 110


>gi|239948373|ref|ZP_04700126.1| conserved hypothetical protein [Rickettsia endosymbiont of Ixodes
           scapularis]
 gi|239922649|gb|EER22673.1| conserved hypothetical protein [Rickettsia endosymbiont of Ixodes
           scapularis]
          Length = 107

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 36/107 (33%), Positives = 57/107 (53%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N  + + Q + +Q KM++ +E + +    G AGGG+V V   GK  +  + ID SLL 
Sbjct: 1   MVNFNQFLKQAQSMQKKMQEAQEQMANARYTGKAGGGLVEVIATGKGEVEKISIDESLLK 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            +  E+LEDLI  A ++  +K ++           G+ +PPG K PF
Sbjct: 61  AEEKEMLEDLIKVAFNNIKQKCDEDSQNSLSGALNGMSLPPGFKMPF 107


>gi|294678279|ref|YP_003578894.1| hypothetical protein RCAP_rcc02758 [Rhodobacter capsulatus SB 1003]
 gi|294477099|gb|ADE86487.1| protein of unknown function DUF149 [Rhodobacter capsulatus SB 1003]
          Length = 114

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 60/106 (56%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           + ++ KM+   KE+Q +M  ++E +  +   G AGGG+V  R+  K  LTG+ ID ++L 
Sbjct: 8   LGDMAKMMKAAKEMQERMLTLQEELGRMIVIGEAGGGLVKARVTAKGELTGLDIDPTILV 67

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFP 106
               E++EDLI+AA  DA  + +D    + +++   L +P  +  P
Sbjct: 68  ASEKEVVEDLIVAAVKDAQARAQDKAGEEQRKLMTELGLPADMGLP 113


>gi|254496163|ref|ZP_05109060.1| conserved hypothetical protein [Legionella drancourtii LLAP12]
 gi|254354619|gb|EET13257.1| conserved hypothetical protein [Legionella drancourtii LLAP12]
          Length = 111

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 53/79 (67%), Gaps = 1/79 (1%)

Query: 25  ITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKKIED 84
           ++ L   G AGGGMVS+++NG++  T VKI  +++ ED VE+LEDLI AA +DA +KIE 
Sbjct: 28  LSQLVVTGEAGGGMVSIKMNGRHDATEVKIKPTMMEED-VEMLEDLIAAAINDAVRKIEK 86

Query: 85  LVATKTQEITEGLPIPPGL 103
               K  ++T GL IP  L
Sbjct: 87  ASKEKISQLTAGLNIPTDL 105


>gi|167626337|ref|YP_001676837.1| hypothetical protein Fphi_0115 [Francisella philomiragia subsp.
           philomiragia ATCC 25017]
 gi|241668770|ref|ZP_04756348.1| hypothetical protein FphipA2_08380 [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
 gi|254877301|ref|ZP_05250011.1| conserved hypothetical protein [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
 gi|189038633|sp|B0TY94|Y120_FRAP2 RecName: Full=UPF0133 protein Fphi_0115
 gi|167596338|gb|ABZ86336.1| conserved hypothetical protein [Francisella philomiragia subsp.
           philomiragia ATCC 25017]
 gi|254843322|gb|EET21736.1| conserved hypothetical protein [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
          Length = 111

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 69/110 (62%), Gaps = 8/110 (7%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           ++ K++ Q +++Q +M+K ++   ++E  G +G G+VSV + GK  +  V ID SL+ ED
Sbjct: 4   DMSKLMQQAQKMQEQMKKAQQERENMEVIGESGAGLVSVTMTGKYDVKKVTIDDSLMSED 63

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITE-----GLPIPPGLKFPF 107
             E+LEDLI AA + A KK+ED  ++ + +I +     G+ +P G  FPF
Sbjct: 64  K-EMLEDLIAAAVNSAVKKVED--SSSSADIGKMAKEAGIDLPNGFNFPF 110


>gi|312897408|ref|ZP_07756832.1| conserved hypothetical protein TIGR00103 [Megasphaera
           micronuciformis F0359]
 gi|310621469|gb|EFQ05005.1| conserved hypothetical protein TIGR00103 [Megasphaera
           micronuciformis F0359]
          Length = 106

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 33/98 (33%), Positives = 65/98 (66%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           N+  M+ + +++Q  M+KM++ +     E   GGG +++ +NG+  +  V ID S++  +
Sbjct: 6   NMQGMMKKVQKMQKDMKKMQDELKVRTVEATVGGGTLTIVMNGEKTVESVTIDPSVIDPE 65

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           + E+LEDLI+AA ++A KK++D++A +  +IT G+ +P
Sbjct: 66  DKEMLEDLIVAAVNEAGKKVDDMMAQEMSKITGGMNLP 103


>gi|259415495|ref|ZP_05739416.1| conserved hypothetical protein [Silicibacter sp. TrichCH4B]
 gi|259348725|gb|EEW60487.1| conserved hypothetical protein [Silicibacter sp. TrichCH4B]
          Length = 114

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 35/107 (32%), Positives = 62/107 (57%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           + ++  M+ + +E+Q KM +M+E + ++   G AG G+V    + K  L  + ID S+  
Sbjct: 8   LGDMAGMMKKAQEMQSKMGEMQEELHNIMVVGEAGAGLVKATASAKGDLKSLDIDPSIFN 67

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            D+ E++EDLI+AA  DA  K  +    +  ++T+GL +P  +K PF
Sbjct: 68  GDDKEVVEDLILAAVKDAQTKAAERAQEEMTKLTDGLGLPKDMKLPF 114


>gi|307244877|ref|ZP_07526975.1| hypothetical protein appser1_900 [Actinobacillus pleuropneumoniae
          serovar 1 str. 4074]
 gi|306854199|gb|EFM86406.1| hypothetical protein appser1_900 [Actinobacillus pleuropneumoniae
          serovar 1 str. 4074]
          Length = 94

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 55/82 (67%), Gaps = 1/82 (1%)

Query: 10 QFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILED 69
          Q +++Q +M+KM+E I  LE  G +G G+V V ING +    ++ID SL+ ED+ E++ED
Sbjct: 13 QAQQMQERMQKMQEEIAQLEVTGESGAGLVKVTINGAHNCRRIEIDPSLM-EDDKEMVED 71

Query: 70 LIIAAHSDAHKKIEDLVATKTQ 91
          L+ AA +DA ++ E++   K Q
Sbjct: 72 LVAAAFNDAVRRAEEMQKEKWQ 93


>gi|160900334|ref|YP_001565916.1| hypothetical protein Daci_4902 [Delftia acidovorans SPH-1]
 gi|160365918|gb|ABX37531.1| conserved hypothetical protein [Delftia acidovorans SPH-1]
          Length = 110

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 68/108 (62%), Gaps = 5/108 (4%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           ++ +MK   Q + +Q  ++K ++ + ++E EG +G G+V V +  K+ +  + ID SLL 
Sbjct: 7   LAGLMK---QAQAMQDNLKKAQDELGNIEVEGESGAGLVKVVMTCKHDVKRITIDPSLLA 63

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLP-IPPGLKFPF 107
           ED  ++LEDL+ AA + A +K E+    K  ++T G+P +P G+KFPF
Sbjct: 64  EDK-DMLEDLVAAAFNAAVRKAEETSNEKMGKLTAGMPGLPGGMKFPF 110


>gi|91788140|ref|YP_549092.1| hypothetical protein Bpro_2269 [Polaromonas sp. JS666]
 gi|91697365|gb|ABE44194.1| conserved hypothetical protein 103 [Polaromonas sp. JS666]
          Length = 110

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 68/108 (62%), Gaps = 5/108 (4%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           ++ +MK   Q + +Q  ++K +E +  +E   +AG G+V V +  K+ +  ++ID SLL 
Sbjct: 7   LAGLMK---QAQAMQDNLKKAQEELAFVEVTADAGAGLVKVTMTCKHDVKRIEIDPSLLA 63

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLP-IPPGLKFPF 107
           +D  ++LEDL+ AA + A +K E++   K  ++T G+P +P G+KFPF
Sbjct: 64  DDK-DMLEDLVAAAFNAAVRKAEEVSQEKMGKLTAGMPGLPGGMKFPF 110


>gi|315497913|ref|YP_004086717.1| protein family upf0133 [Asticcacaulis excentricus CB 48]
 gi|315415925|gb|ADU12566.1| Uncharacterized protein family UPF0133 [Asticcacaulis excentricus
          CB 48]
          Length = 105

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 51/78 (65%)

Query: 7  MVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEI 66
          ++ Q + +Q K  + +E +  +   G AG G+VSV + G  +LT + ID SL+  D VE+
Sbjct: 6  LMKQAQAVQQKFTEAQEKMNQVVVTGQAGAGLVSVDLRGVGVLTRLHIDPSLINPDEVEV 65

Query: 67 LEDLIIAAHSDAHKKIED 84
          L DLI+AAH+DA KK+++
Sbjct: 66 LADLIVAAHADARKKLDE 83


>gi|328946985|ref|YP_004364322.1| hypothetical protein Tresu_0055 [Treponema succinifaciens DSM 2489]
 gi|328447309|gb|AEB13025.1| UPF0133 protein ybaB [Treponema succinifaciens DSM 2489]
          Length = 103

 Score = 65.5 bits (158), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 36/98 (36%), Positives = 57/98 (58%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           N   MV     +Q +++  +E +  LEAEG++GG MV V +NGK  L  +K+D   +   
Sbjct: 2   NPFDMVKNLAGMQSQLKAAQEKLAELEAEGSSGGNMVQVTVNGKFELVDIKLDPICVDNR 61

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           +V +L+DLI AAH  A +KI+D +  +   +  G+ IP
Sbjct: 62  DVPMLQDLIKAAHHAALEKIQDEIKNQLGPMVAGMNIP 99


>gi|206891121|ref|YP_002248895.1| hypothetical protein THEYE_A1069 [Thermodesulfovibrio yellowstonii
           DSM 11347]
 gi|238058405|sp|B5YKY0|Y1069_THEYD RecName: Full=UPF0133 protein THEYE_A1069
 gi|206743059|gb|ACI22116.1| conserved hypothetical protein [Thermodesulfovibrio yellowstonii
           DSM 11347]
          Length = 114

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 63/100 (63%), Gaps = 2/100 (2%)

Query: 10  QFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILED 69
           Q ++IQ +++K +E +  +  E  +GGGMV+V+ NG   +  +KIDR ++  D++E+LED
Sbjct: 12  QAQKIQEEIQKKQEEVKKMTVEATSGGGMVTVQANGAGEIVSIKIDREVVNPDDIEMLED 71

Query: 70  LIIAAHSDAHKKIEDLVATKTQEITEGLPIP--PGLKFPF 107
           L++AA ++A K+  +L  ++  +++    +P  P L   F
Sbjct: 72  LVLAAVNEAIKRAHELAQSEMAKVSMPFNLPGMPDLSSLF 111


>gi|238926314|ref|ZP_04658074.1| conserved hypothetical protein [Selenomonas flueggei ATCC 43531]
 gi|304437632|ref|ZP_07397586.1| conserved hypothetical protein [Selenomonas sp. oral taxon 149 str.
           67H29BP]
 gi|238885718|gb|EEQ49356.1| conserved hypothetical protein [Selenomonas flueggei ATCC 43531]
 gi|304369375|gb|EFM23046.1| conserved hypothetical protein [Selenomonas sp. oral taxon 149 str.
           67H29BP]
          Length = 108

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 33/101 (32%), Positives = 67/101 (66%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           N+  M+ + +++Q  M+KM++ +     E ++GGG V V ++G+  +  + I  + +  +
Sbjct: 7   NMAGMMKKVQKMQADMKKMQDELRKKTVEVSSGGGAVKVVMDGEKQVQSLIIAPAAVDPE 66

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGL 103
           ++E+L+DLI AA ++A KK++D++A +  ++T GL +PPGL
Sbjct: 67  DIEMLQDLISAAFNEATKKVDDMMAQEMGKLTSGLGLPPGL 107


>gi|239907166|ref|YP_002953907.1| hypothetical protein DMR_25300 [Desulfovibrio magneticus RS-1]
 gi|239797032|dbj|BAH76021.1| hypothetical protein [Desulfovibrio magneticus RS-1]
          Length = 103

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 63/100 (63%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M  + ++V Q + +Q KM K++E +     EG AGGGMV   ++G N L  + ID++ + 
Sbjct: 1   MKGMNELVRQAQVMQKKMAKLQEDLQERTVEGTAGGGMVVAVVSGSNELKSLAIDKTAVD 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
            ++VE+L+DL+++A +D  KK + ++  +  +IT G+ +P
Sbjct: 61  PNDVEMLQDLVLSAVNDGIKKAKAMMEAEMGQITGGIKVP 100


>gi|317153155|ref|YP_004121203.1| hypothetical protein Daes_1443 [Desulfovibrio aespoeensis Aspo-2]
 gi|316943406|gb|ADU62457.1| Uncharacterized protein family UPF0133 [Desulfovibrio aespoeensis
           Aspo-2]
          Length = 103

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 65/100 (65%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+ +M+ Q + +Q KM + ++ + ++  E ++GGGMV+VR+ G   +  V I+ S++ 
Sbjct: 1   MRNMNEMIRQAQVMQRKMSQKQDELKAMIVEASSGGGMVTVRVTGGQEVVAVVIEPSVVE 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
             +VE+L+DL++ A ++A KK ++L+  +   +T GL IP
Sbjct: 61  SGDVEMLQDLVLTAANEALKKSKELMEKELSSVTGGLNIP 100


>gi|167946556|ref|ZP_02533630.1| hypothetical protein Epers_08393 [Endoriftia persephone
           'Hot96_1+Hot96_2']
          Length = 118

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 61/100 (61%), Gaps = 4/100 (4%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           N+MK   Q +++Q +M++ +E +   E  G +GGG+V V INGK+ +  V ID SLL +D
Sbjct: 7   NLMK---QAQKMQAEMQQAQERLAQEEVAGESGGGLVKVIINGKHEVRRVTIDESLLSDD 63

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPG 102
             E+LEDL+ AA +DA +++   +     ++T G+    G
Sbjct: 64  K-EMLEDLVAAAFNDASQRVSQKMQESMADLTSGMGTATG 102


>gi|237801079|ref|ZP_04589540.1| hypothetical protein POR16_19790 [Pseudomonas syringae pv. oryzae
          str. 1_6]
 gi|331023936|gb|EGI03993.1| hypothetical protein POR16_19790 [Pseudomonas syringae pv. oryzae
          str. 1_6]
          Length = 95

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 60/94 (63%), Gaps = 4/94 (4%)

Query: 1  MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
          M+ +MK   Q +++Q KM KM+E + + E  G +G G+VSV + G++ +  + +D SL+ 
Sbjct: 6  MAGLMK---QAQQMQEKMAKMQEELANAEVTGQSGAGLVSVVMTGRHDVKRINLDDSLMQ 62

Query: 61 EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEIT 94
          ED  E+LEDLI AA +DA +KIE     KT  +T
Sbjct: 63 EDK-EVLEDLIAAAVNDAVRKIEQASQDKTASMT 95


>gi|77458033|ref|YP_347538.1| hypothetical protein Pfl01_1806 [Pseudomonas fluorescens Pf0-1]
 gi|123605285|sp|Q3KFA7|Y1806_PSEPF RecName: Full=UPF0133 protein Pfl01_1806
 gi|77382036|gb|ABA73549.1| conserved hypothetical protein [Pseudomonas fluorescens Pf0-1]
          Length = 112

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 68/110 (61%), Gaps = 6/110 (5%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSL-- 58
           M+ +MK   Q +++Q KM KM+E + + E  G AGG +V+V + G++ +  V ID S+  
Sbjct: 6   MAGLMK---QAQQMQEKMAKMQEELANAEVTGKAGGDLVTVVMTGRHDVKKVSIDPSVLP 62

Query: 59  -LFEDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            L ED+ E++EDL+ AA + A ++IE     K   +T G+ +P G+K PF
Sbjct: 63  GLDEDDREVVEDLVAAAVNAAVRQIEANSQAKMGSMTAGMNLPAGMKLPF 112


>gi|126697583|ref|YP_001086480.1| hypothetical protein CD0017 [Clostridium difficile 630]
 gi|254973667|ref|ZP_05270139.1| hypothetical protein CdifQC_00035 [Clostridium difficile QCD-66c26]
 gi|255091058|ref|ZP_05320536.1| hypothetical protein CdifC_00037 [Clostridium difficile CIP 107932]
 gi|255099174|ref|ZP_05328151.1| hypothetical protein CdifQCD-6_00035 [Clostridium difficile
           QCD-63q42]
 gi|255304954|ref|ZP_05349128.1| hypothetical protein CdifA_00035 [Clostridium difficile ATCC 43255]
 gi|255312712|ref|ZP_05354295.1| hypothetical protein CdifQCD-7_00035 [Clostridium difficile
           QCD-76w55]
 gi|255515472|ref|ZP_05383148.1| hypothetical protein CdifQCD-_00035 [Clostridium difficile
           QCD-97b34]
 gi|255648564|ref|ZP_05395466.1| hypothetical protein CdifQCD_00035 [Clostridium difficile
           QCD-37x79]
 gi|255654099|ref|ZP_05399508.1| hypothetical protein CdifQCD-2_00035 [Clostridium difficile
           QCD-23m63]
 gi|260681786|ref|YP_003213071.1| hypothetical protein CD196_0017 [Clostridium difficile CD196]
 gi|260685383|ref|YP_003216516.1| hypothetical protein CDR20291_0006 [Clostridium difficile R20291]
 gi|306518693|ref|ZP_07405040.1| hypothetical protein CdifQ_00035 [Clostridium difficile QCD-32g58]
 gi|123067141|sp|Q18CA3|Y017_CLOD6 RecName: Full=UPF0133 protein CD0017
 gi|115249020|emb|CAJ66831.1| DNA binding protein [Clostridium difficile]
 gi|260207949|emb|CBA60071.1| conserved hypothetical protein [Clostridium difficile CD196]
 gi|260211399|emb|CBE01473.1| conserved hypothetical protein [Clostridium difficile R20291]
          Length = 116

 Score = 65.1 bits (157), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 63/94 (67%)

Query: 7   MVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEI 66
           ++ Q +++Q  M+K ++ + S E E + GGG V+V++NGK  +  + I   ++  D++E+
Sbjct: 20  LLKQAQKMQENMQKAQQELESKEVEASVGGGAVTVKVNGKKEVIDITIKPEVVDPDDIEM 79

Query: 67  LEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           L+DL+++A + A + I+D+ A++  ++T G+ IP
Sbjct: 80  LQDLVLSAVNQALRNIDDIQASQMSKVTGGMNIP 113


>gi|164686925|ref|ZP_02210953.1| hypothetical protein CLOBAR_00525 [Clostridium bartlettii DSM
           16795]
 gi|164604028|gb|EDQ97493.1| hypothetical protein CLOBAR_00525 [Clostridium bartlettii DSM
           16795]
          Length = 114

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 31/98 (31%), Positives = 68/98 (69%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           N+ +++ Q +++Q  M+KM++ + + E E + GGG V+V++NGK  +  V +   ++  D
Sbjct: 14  NMNQILKQAQKMQDNMQKMQQELEAKEFEVSVGGGAVTVKVNGKKEVLDVTMKPEVVDPD 73

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           ++E+L+DL+I+A ++A +K++D  +++  ++T G+ IP
Sbjct: 74  DIEMLQDLVISAVNEALRKVDDAQSSQMSKMTGGMNIP 111


>gi|269838175|ref|YP_003320403.1| hypothetical protein Sthe_2155 [Sphaerobacter thermophilus DSM
           20745]
 gi|269787438|gb|ACZ39581.1| conserved hypothetical protein [Sphaerobacter thermophilus DSM
           20745]
          Length = 102

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 59/100 (59%), Gaps = 4/100 (4%)

Query: 5   MKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNV 64
           MKM    +++Q ++ KM++ +     EG+AGGG V V +NG   +  V ID   +  D++
Sbjct: 5   MKM---LQQMQNRLLKMQQELEEATVEGSAGGGAVRVVVNGTRSVKSVSIDPEAVDPDDI 61

Query: 65  EILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP-PGL 103
           EILED+++ A +DA  K E L A K   IT GL +  PG+
Sbjct: 62  EILEDMVLTAINDAMAKAEQLAAEKMGAITGGLNLNIPGI 101


>gi|187932720|ref|YP_001887620.1| hypothetical protein CLL_A3446 [Clostridium botulinum B str. Eklund
           17B]
 gi|188589889|ref|YP_001922590.1| hypothetical protein CLH_3225 [Clostridium botulinum E3 str. Alaska
           E43]
 gi|251781208|ref|ZP_04824124.1| conserved hypothetical protein [Clostridium botulinum E1 str. 'BoNT
           E Beluga']
 gi|238689651|sp|B2V0W1|Y3225_CLOBA RecName: Full=UPF0133 protein CLH_3225
 gi|238691665|sp|B2TR54|Y3446_CLOBB RecName: Full=UPF0133 protein CLL_A3446
 gi|187720873|gb|ACD22094.1| conserved hypothetical protein [Clostridium botulinum B str. Eklund
           17B]
 gi|188500170|gb|ACD53306.1| conserved hypothetical protein [Clostridium botulinum E3 str.
           Alaska E43]
 gi|243081655|gb|EES47716.1| conserved hypothetical protein [Clostridium botulinum E1 str. 'BoNT
           E Beluga']
          Length = 113

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 36/98 (36%), Positives = 64/98 (65%), Gaps = 3/98 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M+N+MK   Q +++Q +ME M++ + + E E + GGG VSV + GK  +  + I   ++ 
Sbjct: 15  MNNLMK---QAQKLQKQMEDMQKDLETKEFETSVGGGAVSVTVTGKKEVKSINIKPEVVD 71

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLP 98
            D+VE+LEDL++ A ++A +K E+  A+K  ++T G+P
Sbjct: 72  PDDVEMLEDLVLTAVNEALRKAEEETASKMGKLTGGMP 109


>gi|154484287|ref|ZP_02026735.1| hypothetical protein EUBVEN_01999 [Eubacterium ventriosum ATCC
           27560]
 gi|149734764|gb|EDM50681.1| hypothetical protein EUBVEN_01999 [Eubacterium ventriosum ATCC
           27560]
          Length = 112

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 64/97 (65%), Gaps = 3/97 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M+NIMK   Q +++Q +ME+ +  + S E    +GGG V V I+G   +T +K+D  ++ 
Sbjct: 15  MNNIMK---QAQKMQKQMEQAQAELESSEYTATSGGGAVEVTISGTKEITKIKLDPEVVD 71

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGL 97
            D++E+LEDL++AA ++A +K++++   K  +IT GL
Sbjct: 72  PDDIEMLEDLVMAAVNEAIRKMDEMSTQKMSKITGGL 108


>gi|296452476|ref|ZP_06894175.1| conserved hypothetical protein [Clostridium difficile NAP08]
 gi|296878244|ref|ZP_06902254.1| conserved hypothetical protein [Clostridium difficile NAP07]
 gi|296258682|gb|EFH05578.1| conserved hypothetical protein [Clostridium difficile NAP08]
 gi|296430752|gb|EFH16589.1| conserved hypothetical protein [Clostridium difficile NAP07]
          Length = 126

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 63/94 (67%)

Query: 7   MVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEI 66
           ++ Q +++Q  M+K ++ + S E E + GGG V+V++NGK  +  + I   ++  D++E+
Sbjct: 30  LLKQAQKMQENMQKAQQELESKEVEASVGGGAVTVKVNGKKEVIDITIKPEVVDPDDIEM 89

Query: 67  LEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           L+DL+++A + A + I+D+ A++  ++T G+ IP
Sbjct: 90  LQDLVLSAVNQALRNIDDIQASQMSKVTGGMNIP 123


>gi|224457003|ref|ZP_03665476.1| hypothetical protein FtultM_04506 [Francisella tularensis subsp.
           tularensis MA00-2987]
 gi|254370412|ref|ZP_04986417.1| conserved hypothetical protein [Francisella tularensis subsp.
           tularensis FSC033]
 gi|254874730|ref|ZP_05247440.1| conserved hypothetical protein [Francisella tularensis subsp.
           tularensis MA00-2987]
 gi|151568655|gb|EDN34309.1| conserved hypothetical protein [Francisella tularensis subsp.
           tularensis FSC033]
 gi|254840729|gb|EET19165.1| conserved hypothetical protein [Francisella tularensis subsp.
           tularensis MA00-2987]
          Length = 112

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 69/110 (62%), Gaps = 7/110 (6%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           ++ K++ Q +++Q +M+K ++   ++E  G +G G+V+V + GK  +  V ID  L+ ED
Sbjct: 4   DMSKLMQQAQKMQEQMKKAQQERENMEVIGESGAGLVTVTMTGKYDVKSVSIDNLLMSED 63

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITE-----GLPIPPGLKFPF 107
             EILEDLI AA + A KK+E+  +T + +I +     G+ +P G+ FPF
Sbjct: 64  K-EILEDLIAAAVNSAVKKVEE-NSTASSDIYKMAKDAGIDLPSGINFPF 111


>gi|52842954|ref|YP_096753.1| hypothetical protein lpg2755 [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|81376660|sp|Q5ZRX1|Y2755_LEGPH RecName: Full=UPF0133 protein lpg2755
 gi|52630065|gb|AAU28806.1| hypothetical protein lpg2755 [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
          Length = 112

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 36/79 (45%), Positives = 54/79 (68%), Gaps = 1/79 (1%)

Query: 25  ITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKKIED 84
           ++ L   G +GGGMV++++NG++ +T VKI  +L+ ED +E+LEDLI AA +DA +KIE 
Sbjct: 28  LSQLVVSGESGGGMVTIKMNGRHDVTEVKIKPTLMDED-IEMLEDLIAAAVNDAVRKIEK 86

Query: 85  LVATKTQEITEGLPIPPGL 103
               K  ++T GL IP  L
Sbjct: 87  ASKEKISQLTAGLNIPTDL 105


>gi|325265619|ref|ZP_08132309.1| hypothetical protein HMPREF9098_0036 [Kingella denitrificans ATCC
           33394]
 gi|324982889|gb|EGC18511.1| hypothetical protein HMPREF9098_0036 [Kingella denitrificans ATCC
           33394]
          Length = 111

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 36/96 (37%), Positives = 58/96 (60%), Gaps = 4/96 (4%)

Query: 10  QFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFE--DNVEIL 67
           Q +++Q  M+K +  +   E EG AG G+V V+    +++T + I   L+ E  D+ E+L
Sbjct: 13  QAQKMQDNMKKAQAELAQTEVEGQAGNGLVKVKATCGHVVTRLDISPDLIAEAADDKEML 72

Query: 68  EDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGL 103
           EDLI+AA +DAH+K E   + +  + T+GL  PPG 
Sbjct: 73  EDLILAAIADAHEKAEQTTSARMAQFTQGL--PPGF 106


>gi|189502455|ref|YP_001958172.1| hypothetical protein Aasi_1100 [Candidatus Amoebophilus asiaticus
          5a2]
 gi|189497896|gb|ACE06443.1| hypothetical protein Aasi_1100 [Candidatus Amoebophilus asiaticus
          5a2]
          Length = 107

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 32/97 (32%), Positives = 60/97 (61%)

Query: 1  MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
          M+N M+M GQ KE+Q K++++++ +  L+A G +G G+V   +NG   +  ++ID S++ 
Sbjct: 1  MTNFMQMFGQVKEMQAKIQEVQQKVAHLQATGESGAGLVKATVNGNKKILKIEIDPSIIQ 60

Query: 61 EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGL 97
           +   +L+DLI+AA + A + +E+      Q  T G+
Sbjct: 61 AEEQAMLQDLIVAAVNMAIQSVENKTKEMVQSHTAGM 97


>gi|150392456|ref|YP_001322505.1| hypothetical protein Amet_4780 [Alkaliphilus metalliredigens QYMF]
 gi|167012978|sp|A6TXC8|Y4780_ALKMQ RecName: Full=UPF0133 protein Amet_4780
 gi|149952318|gb|ABR50846.1| conserved hypothetical protein 103 [Alkaliphilus metalliredigens
           QYMF]
          Length = 114

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 68/100 (68%), Gaps = 3/100 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M+N+MK   Q +++Q  MEK + ++   E E +AGGG ++V+++GK  +  ++I   ++ 
Sbjct: 15  MNNMMK---QVQKMQKDMEKTQAALEEKEVEASAGGGAITVKVSGKKEVISIEIKPEVVD 71

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
            ++VE+L+DLI+AA ++A +  E++V+ +  ++T G+ IP
Sbjct: 72  PEDVEMLQDLIMAAVNEAMRGAEEMVSKEMGKVTGGMNIP 111


>gi|304407305|ref|ZP_07388958.1| conserved hypothetical protein [Paenibacillus curdlanolyticus YK9]
 gi|304343746|gb|EFM09587.1| conserved hypothetical protein [Paenibacillus curdlanolyticus YK9]
          Length = 103

 Score = 64.7 bits (156), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 63/100 (63%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M+N+  M+ Q K++Q +M K +E + +   EG+AGGG+V+V++NG   +  + I   ++ 
Sbjct: 1   MTNMQHMMKQVKKMQEQMLKAQEELGTKTIEGSAGGGVVNVKVNGHKQVLSITIKPEVVD 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
            +++E+L+DL+I A +DA  K E++      + T G+ IP
Sbjct: 61  PEDIEMLQDLVITAVNDALAKAEEMANEDMGKYTGGMKIP 100


>gi|222053485|ref|YP_002535847.1| hypothetical protein Geob_0377 [Geobacter sp. FRC-32]
 gi|221562774|gb|ACM18746.1| conserved hypothetical protein [Geobacter sp. FRC-32]
          Length = 104

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 63/100 (63%), Gaps = 3/100 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           +++IMK   Q + +Q KM K++E  +    E  AGGG V+  +NGKN L  + I +  + 
Sbjct: 5   LASIMK---QAQMMQQKMGKLQEEASQKTVEATAGGGAVTAVVNGKNQLLALTIKKEAVD 61

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
            ++VE+L+DL++AA ++A  K++  +A +  +IT G+ IP
Sbjct: 62  PEDVEMLQDLVVAAVNEALTKVQSEMAEQMSKITGGINIP 101


>gi|229825856|ref|ZP_04451925.1| hypothetical protein GCWU000182_01220 [Abiotrophia defectiva ATCC
           49176]
 gi|229789876|gb|EEP25990.1| hypothetical protein GCWU000182_01220 [Abiotrophia defectiva ATCC
           49176]
          Length = 118

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 67/105 (63%), Gaps = 4/105 (3%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           NIMK   Q + +Q +ME+ ++ + + E EG+AGGG+V+V++NGK  + GVK+   ++  +
Sbjct: 18  NIMK---QAQRMQRQMEEKQKEMETREFEGSAGGGVVTVKLNGKREVLGVKLAEEVVDPE 74

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ++E LEDL+ AA  +A +K+E+      +++T G     G  FPF
Sbjct: 75  DIETLEDLVAAALGEALRKVEEASNASMEQLT-GGLGGLGGGFPF 118


>gi|54295585|ref|YP_128000.1| hypothetical protein lpl2672 [Legionella pneumophila str. Lens]
 gi|54298739|ref|YP_125108.1| hypothetical protein lpp2803 [Legionella pneumophila str. Paris]
 gi|148361068|ref|YP_001252275.1| hypothetical protein LPC_3038 [Legionella pneumophila str. Corby]
 gi|296108399|ref|YP_003620100.1| hypothetical protein lpa_04014 [Legionella pneumophila 2300/99
           Alcoy]
 gi|81367671|sp|Q5WT53|Y2672_LEGPL RecName: Full=UPF0133 protein lpl2672
 gi|81369712|sp|Q5X1E0|Y2803_LEGPA RecName: Full=UPF0133 protein lpp2803
 gi|166229360|sp|A5IHS9|Y3038_LEGPC RecName: Full=UPF0133 protein LPC_3038
 gi|53752524|emb|CAH13956.1| hypothetical protein lpp2803 [Legionella pneumophila str. Paris]
 gi|53755417|emb|CAH16913.1| hypothetical protein lpl2672 [Legionella pneumophila str. Lens]
 gi|148282841|gb|ABQ56929.1| conserved hypothetical protein [Legionella pneumophila str. Corby]
 gi|295650301|gb|ADG26148.1| hypothetical protein lpa_04014 [Legionella pneumophila 2300/99
           Alcoy]
          Length = 112

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 36/79 (45%), Positives = 54/79 (68%), Gaps = 1/79 (1%)

Query: 25  ITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKKIED 84
           ++ L   G +GGGMV++++NG++ +T VKI  +L+ ED +E+LEDLI AA +DA +KIE 
Sbjct: 28  LSQLVVSGESGGGMVTIKMNGRHDVTEVKIKPTLMDED-IEMLEDLIAAAVNDAVRKIEK 86

Query: 85  LVATKTQEITEGLPIPPGL 103
               K  ++T GL IP  L
Sbjct: 87  ASKEKISQLTAGLNIPTDL 105


>gi|146296605|ref|YP_001180376.1| hypothetical protein Csac_1593 [Caldicellulosiruptor
           saccharolyticus DSM 8903]
 gi|166231421|sp|A4XJV0|Y1593_CALS8 RecName: Full=UPF0133 protein Csac_1593
 gi|145410181|gb|ABP67185.1| conserved hypothetical protein 103 [Caldicellulosiruptor
           saccharolyticus DSM 8903]
          Length = 113

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 33/92 (35%), Positives = 59/92 (64%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           NI ++  Q K+IQ ++EK++E +   E E  AGGG V V INGK  +  ++I   ++  D
Sbjct: 14  NINQLQKQAKKIQEEIEKLQEELNQREIEATAGGGAVKVVINGKKEIKSIEISPEVVDPD 73

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEIT 94
           ++E L+DLI+A  ++A +K+E ++  + Q++ 
Sbjct: 74  DIETLQDLIVACVNEAIRKVEKMIEEEMQKVA 105


>gi|87307572|ref|ZP_01089716.1| hypothetical protein DSM3645_28662 [Blastopirellula marina DSM
           3645]
 gi|87289742|gb|EAQ81632.1| hypothetical protein DSM3645_28662 [Blastopirellula marina DSM
           3645]
          Length = 120

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 58/100 (58%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           +  ++ MV Q +E+ GKM+ ++E + +    G+AGGGMV V + G   +  ++ID  L+ 
Sbjct: 7   LGGMVNMVRQAQEMGGKMQGLQEELRTKRVTGSAGGGMVEVEMTGTGEMLSLRIDPDLVA 66

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
               EI+EDL+ AA + A  K + L A   Q +T G+ +P
Sbjct: 67  RGEREIIEDLVPAAVNQASAKAKQLHAEMMQSLTSGMNVP 106


>gi|119505875|ref|ZP_01627940.1| hypothetical protein MGP2080_12372 [marine gamma proteobacterium
           HTCC2080]
 gi|119458303|gb|EAW39413.1| hypothetical protein MGP2080_12372 [marine gamma proteobacterium
           HTCC2080]
          Length = 105

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 62/105 (59%), Gaps = 4/105 (3%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           N+MK   Q +++Q    K +ES+ ++E  G AG G+V VR+ G   ++GV++D SL+ E 
Sbjct: 5   NLMK---QAQQMQEGFAKAQESVKAVEVTGEAGAGLVKVRMRGDMAVSGVEVDPSLMQEP 61

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
             EILEDL+ AA +DA ++ +         +T G+ +P G K P 
Sbjct: 62  R-EILEDLLAAAVNDAVRRAQAAAQECMASVTAGINLPDGFKMPI 105


>gi|147676387|ref|YP_001210602.1| hypothetical protein PTH_0052 [Pelotomaculum thermopropionicum SI]
 gi|189038356|sp|A5D6B2|Y052_PELTS RecName: Full=UPF0133 protein PTH_0052
 gi|146272484|dbj|BAF58233.1| Uncharacterized protein conserved in bacteria [Pelotomaculum
           thermopropionicum SI]
          Length = 105

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 34/98 (34%), Positives = 62/98 (63%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           N+ KM+ Q +++Q  M +++E + +   E  AGGG V V  NG+N +  ++I    L  +
Sbjct: 5   NMSKMMKQVQKMQQDMLRLQEELGNRTVESTAGGGAVKVVANGRNEIVSIEIKPEALDPE 64

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           +VE+L+D+I+AA ++A KK +D+++ +   +T  L IP
Sbjct: 65  DVEMLQDMILAAVNEALKKAQDMISQEMGRLTGNLKIP 102


>gi|86140175|ref|ZP_01058737.1| hypothetical protein MED193_11872 [Roseobacter sp. MED193]
 gi|85823112|gb|EAQ43325.1| hypothetical protein MED193_11872 [Roseobacter sp. MED193]
          Length = 114

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 62/111 (55%), Gaps = 8/111 (7%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           + ++ KM+   +E+Q KM +M+E + ++   G AG G+V    + K  L  + ID S+  
Sbjct: 8   LGDMAKMMKSAQELQTKMAEMQEELHNVMVVGEAGAGLVKATASAKGELKELDIDPSIFS 67

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQE----ITEGLPIPPGLKFPF 107
            D+ E++EDLI+AA  DA  K     A K QE    +TE + +P  +K PF
Sbjct: 68  GDDKEVVEDLILAAIKDAQSK----AAVKAQEEMANLTESMGLPKDIKLPF 114


>gi|15893422|ref|NP_346771.1| hypothetical protein CA_C0126 [Clostridium acetobutylicum ATCC 824]
 gi|21264118|sp|Q97MR5|Y126_CLOAB RecName: Full=UPF0133 protein CA_C0126
 gi|15022953|gb|AAK78111.1|AE007525_5 Uncharacterized conserved protein, YbaB family [Clostridium
           acetobutylicum ATCC 824]
 gi|325507534|gb|ADZ19170.1| Conserved hypothetical protein [Clostridium acetobutylicum EA 2018]
          Length = 112

 Score = 64.3 bits (155), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 35/98 (35%), Positives = 63/98 (64%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           N+  ++ Q ++ Q +ME M++ I + E     GGG VS  ++GK  +T +KI   ++  D
Sbjct: 13  NMNNLIKQAQKFQKQMEDMQKEIENKEFTATVGGGAVSATVSGKKEITEIKIKPEVVDPD 72

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           +VE+L+DLI++A ++A KK E+  + + +++T GL IP
Sbjct: 73  DVEMLQDLILSACNEALKKAEEETSGEMKKLTGGLNIP 110


>gi|254993825|ref|ZP_05276015.1| hypothetical protein LmonocytoFSL_13210 [Listeria monocytogenes FSL
           J2-064]
 gi|255017777|ref|ZP_05289903.1| hypothetical protein LmonF_08630 [Listeria monocytogenes FSL
           F2-515]
          Length = 85

 Score = 64.3 bits (155), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 32/83 (38%), Positives = 54/83 (65%)

Query: 18  MEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSD 77
           M K +  + + E  G AGGGMV+V+  GK ++T V I+  ++  +++E+L+DL++AA +D
Sbjct: 1   MAKAQADLEAQEFTGTAGGGMVTVKATGKRVITDVVINEEVVDPEDIEMLQDLVLAATND 60

Query: 78  AHKKIEDLVATKTQEITEGLPIP 100
             K+IED  +    + T+GL IP
Sbjct: 61  VLKQIEDTTSQTMGKFTQGLNIP 83


>gi|18309028|ref|NP_560962.1| hypothetical protein CPE0046 [Clostridium perfringens str. 13]
 gi|110800382|ref|YP_694519.1| hypothetical protein CPF_0053 [Clostridium perfringens ATCC 13124]
 gi|110801488|ref|YP_697398.1| hypothetical protein CPR_0056 [Clostridium perfringens SM101]
 gi|168206162|ref|ZP_02632167.1| conserved hypothetical protein TIGR00103 [Clostridium perfringens E
           str. JGS1987]
 gi|168210523|ref|ZP_02636148.1| conserved hypothetical protein TIGR00103 [Clostridium perfringens B
           str. ATCC 3626]
 gi|168213991|ref|ZP_02639616.1| conserved hypothetical protein TIGR00103 [Clostridium perfringens
           CPE str. F4969]
 gi|168217758|ref|ZP_02643383.1| conserved hypothetical protein TIGR00103 [Clostridium perfringens
           NCTC 8239]
 gi|182625422|ref|ZP_02953195.1| conserved hypothetical protein [Clostridium perfringens D str.
           JGS1721]
 gi|21264109|sp|Q8XPB9|Y046_CLOPE RecName: Full=UPF0133 protein CPE0046
 gi|123050137|sp|Q0TV21|Y053_CLOP1 RecName: Full=UPF0133 protein CPF_0053
 gi|123342106|sp|Q0SWS7|Y056_CLOPS RecName: Full=UPF0133 protein CPR_0056
 gi|18143703|dbj|BAB79752.1| hypothetical protein [Clostridium perfringens str. 13]
 gi|110675029|gb|ABG84016.1| conserved hypothetical protein TIGR00103 [Clostridium perfringens
           ATCC 13124]
 gi|110681989|gb|ABG85359.1| conserved hypothetical protein TIGR00103 [Clostridium perfringens
           SM101]
 gi|170662307|gb|EDT14990.1| conserved hypothetical protein TIGR00103 [Clostridium perfringens E
           str. JGS1987]
 gi|170711427|gb|EDT23609.1| conserved hypothetical protein TIGR00103 [Clostridium perfringens B
           str. ATCC 3626]
 gi|170714529|gb|EDT26711.1| conserved hypothetical protein TIGR00103 [Clostridium perfringens
           CPE str. F4969]
 gi|177909419|gb|EDT71871.1| conserved hypothetical protein [Clostridium perfringens D str.
           JGS1721]
 gi|182380189|gb|EDT77668.1| conserved hypothetical protein TIGR00103 [Clostridium perfringens
           NCTC 8239]
          Length = 112

 Score = 64.3 bits (155), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 62/100 (62%), Gaps = 3/100 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M+N+MK   Q + +Q +M+ M+E I + E EG+AGGG V  ++NGK  L  + I   ++ 
Sbjct: 13  MNNLMK---QAQMLQKQMQSMQEEIEASEFEGSAGGGAVVAKVNGKKELIALNIKPEVVD 69

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
            D+VE+LEDL+ +A   A +K  +  + K  ++T G+ +P
Sbjct: 70  PDDVEMLEDLVFSAVKQALEKASEETSEKMGKLTGGMGMP 109


>gi|254374596|ref|ZP_04990077.1| conserved hypothetical protein [Francisella novicida GA99-3548]
 gi|151572315|gb|EDN37969.1| conserved hypothetical protein [Francisella novicida GA99-3548]
          Length = 112

 Score = 64.3 bits (155), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 70/110 (63%), Gaps = 7/110 (6%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           ++ K++ Q +++Q +M+K ++   ++E  G +G G+V+V + GK  +  V ID SL+ E 
Sbjct: 4   DMSKLMQQAQKMQEQMKKAQQERENMEVIGESGAGLVTVTMTGKYDVKSVSIDNSLMSE- 62

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITE-----GLPIPPGLKFPF 107
           + EILEDLI AA + A KK+E+  +T + +I +     G+ +P G+ FPF
Sbjct: 63  HKEILEDLIAAAVNSAVKKVEE-NSTASSDIHKMAKDAGIDLPSGINFPF 111


>gi|302381706|ref|YP_003817529.1| hypothetical protein Bresu_0591 [Brevundimonas subvibrioides ATCC
          15264]
 gi|302192334|gb|ADK99905.1| conserved hypothetical protein [Brevundimonas subvibrioides ATCC
          15264]
          Length = 109

 Score = 63.9 bits (154), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 29/83 (34%), Positives = 54/83 (65%)

Query: 1  MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
          M ++  ++ Q + +Q K+++ +  +    AEG +GGG+V++ + G   +T V+ID SL+ 
Sbjct: 1  MKDLNALMQQAQAMQEKLQQAQAKMAETTAEGTSGGGLVTITLKGAGEITAVRIDDSLMA 60

Query: 61 EDNVEILEDLIIAAHSDAHKKIE 83
              EIL DLI+AAH+DA ++++
Sbjct: 61 PGEGEILSDLIVAAHADAKRRLD 83


>gi|308171912|ref|YP_003918617.1| DNA binding protein [Bacillus amyloliquefaciens DSM 7]
 gi|307604776|emb|CBI41147.1| DNA binding protein [Bacillus amyloliquefaciens DSM 7]
 gi|328551721|gb|AEB22213.1| hypothetical protein BAMTA208_00105 [Bacillus amyloliquefaciens
           TA208]
          Length = 107

 Score = 63.9 bits (154), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 54/83 (65%)

Query: 18  MEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSD 77
           M K +E +     EG AGGGMV+V++NG+  +  V I   ++  +++E+L+DL++AA +D
Sbjct: 22  MAKAQEELAEKVLEGTAGGGMVTVKVNGQKEVVDVAIKEEVVDPEDIEMLQDLVLAATND 81

Query: 78  AHKKIEDLVATKTQEITEGLPIP 100
           A KK++D+      + T+G+ IP
Sbjct: 82  ALKKVDDMTNETMGQFTKGMNIP 104


>gi|328909981|gb|AEB61577.1| DNA binding protein [Bacillus amyloliquefaciens LL3]
          Length = 100

 Score = 63.9 bits (154), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 54/83 (65%)

Query: 18  MEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSD 77
           M K +E +     EG AGGGMV+V++NG+  +  V I   ++  +++E+L+DL++AA +D
Sbjct: 15  MAKAQEELAEKVLEGTAGGGMVTVKVNGQKEVVDVAIKEEVVDPEDIEMLQDLVLAATND 74

Query: 78  AHKKIEDLVATKTQEITEGLPIP 100
           A KK++D+      + T+G+ IP
Sbjct: 75  ALKKVDDMTNETMGQFTKGMNIP 97


>gi|313892550|ref|ZP_07826137.1| DNA-binding protein, YbaB/EbfC family [Dialister microaerophilus
           UPII 345-E]
 gi|329121191|ref|ZP_08249819.1| transcriptional regulatory protein [Dialister micraerophilus DSM
           19965]
 gi|313118947|gb|EFR42152.1| DNA-binding protein, YbaB/EbfC family [Dialister microaerophilus
           UPII 345-E]
 gi|327470273|gb|EGF15734.1| transcriptional regulatory protein [Dialister micraerophilus DSM
           19965]
          Length = 108

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 65/102 (63%)

Query: 2   SNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFE 61
           + +  M+ + K++Q +M+KM++ +     + + GGG VS+ ++G  ++T +KI +  +  
Sbjct: 6   AQMQNMLKKAKKMQEEMQKMQDELRQKTVDVSVGGGAVSLSMSGDKLITSLKISKDAINP 65

Query: 62  DNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGL 103
           D+ E+LEDLI  A ++A KK ++++A    ++T GL +P G+
Sbjct: 66  DDSEMLEDLITTAVNEASKKADEMIAQGMSKVTGGLGLPGGM 107


>gi|225850088|ref|YP_002730322.1| hypothetical protein PERMA_0533 [Persephonella marina EX-H1]
 gi|254806471|sp|C0QUF7|Y533_PERMH RecName: Full=UPF0133 protein PERMA_0533
 gi|225645234|gb|ACO03420.1| conserved hypothetical protein [Persephonella marina EX-H1]
          Length = 110

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 41/108 (37%), Positives = 65/108 (60%), Gaps = 2/108 (1%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           + N+ +M+   K +Q  +EK KE +   E     GGGMV V +NG   +  V ID++LL 
Sbjct: 4   LGNLGEMMKMMKSMQENIEKAKEELRKEEIVVEVGGGMVKVILNGLGEIKDVLIDKTLLT 63

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP-PGLKFPF 107
           EDN EIL+DL++AA ++A+++ ++++  K  +   GLP   PGL   F
Sbjct: 64  EDNHEILQDLLVAAFNEANRRTKEVMGEKMTQAA-GLPSNIPGLGNLF 110


>gi|261404008|ref|YP_003240249.1| hypothetical protein GYMC10_0133 [Paenibacillus sp. Y412MC10]
 gi|329930214|ref|ZP_08283827.1| DNA-binding protein, YbaB/EbfC family [Paenibacillus sp. HGF5]
 gi|261280471|gb|ACX62442.1| conserved hypothetical protein [Paenibacillus sp. Y412MC10]
 gi|328935236|gb|EGG31717.1| DNA-binding protein, YbaB/EbfC family [Paenibacillus sp. HGF5]
          Length = 103

 Score = 63.9 bits (154), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 60/100 (60%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M+N+ +M+ Q K++Q +M K +E + +   EG +GGG+V+V  NG   +  + I    + 
Sbjct: 1   MNNMNQMMKQVKKMQEQMLKAQEELATKTVEGTSGGGVVTVEANGHKQILSINIKPEAVD 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
            D+VE+L+DL++ A +DA  K E++      + T G+ IP
Sbjct: 61  PDDVEMLQDLVLTAVNDALAKAEEIANADMGKFTGGMKIP 100


>gi|270158084|ref|ZP_06186741.1| conserved hypothetical protein [Legionella longbeachae D-4968]
 gi|289163650|ref|YP_003453788.1| hypothetical protein LLO_0306 [Legionella longbeachae NSW150]
 gi|269990109|gb|EEZ96363.1| conserved hypothetical protein [Legionella longbeachae D-4968]
 gi|288856823|emb|CBJ10634.1| putative hypothetical protein [Legionella longbeachae NSW150]
          Length = 114

 Score = 63.5 bits (153), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 37/79 (46%), Positives = 52/79 (65%), Gaps = 1/79 (1%)

Query: 25  ITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKKIED 84
           ++ L   G AGGGMV +++NG++  T VKI  S++ ED VE+LEDL+ AA +DA +KIE 
Sbjct: 28  LSQLVVTGEAGGGMVVIKMNGRHDATEVKIKPSMMEED-VEMLEDLVAAAINDAVRKIEK 86

Query: 85  LVATKTQEITEGLPIPPGL 103
               K  ++T GL IP  L
Sbjct: 87  ASKEKISQLTAGLNIPTDL 105


>gi|254468009|ref|ZP_05081415.1| conserved hypothetical protein TIGR00103 [beta proteobacterium
           KB13]
 gi|207086819|gb|EDZ64102.1| conserved hypothetical protein TIGR00103 [beta proteobacterium
           KB13]
          Length = 102

 Score = 63.5 bits (153), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 65/107 (60%), Gaps = 10/107 (9%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+MK   Q + +Q  ++K +  + ++E EG+A  G V + ++ KN +  V ID SLL 
Sbjct: 6   MGNLMK---QAQMMQANLQKAQNELGNIEVEGSASNGQVKITMSCKNEVKKVLIDESLLT 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           +   E+LEDLI+ A  D   KIE   +T +Q+++ GL +PPG+  PF
Sbjct: 63  DK--ELLEDLILVALKDVQAKIE---STTSQKMS-GL-VPPGMNLPF 102


>gi|302343841|ref|YP_003808370.1| hypothetical protein Deba_2414 [Desulfarculus baarsii DSM 2075]
 gi|301640454|gb|ADK85776.1| conserved hypothetical protein [Desulfarculus baarsii DSM 2075]
          Length = 106

 Score = 63.5 bits (153), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 63/100 (63%), Gaps = 3/100 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N++K   Q +++Q KM KM+E +   +    AGGGMV   +NG+  L  +++D+ ++ 
Sbjct: 7   MGNLVK---QAQKMQQKMLKMQEELAERQVSAQAGGGMVEATVNGRGELMALRLDQEVVD 63

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
             +V++L DL+IA+  +A ++ ++++  +  ++T G+ IP
Sbjct: 64  PQDVDMLCDLVIASVREAQRRAQEMMQEEMGKLTGGMSIP 103


>gi|299820910|ref|ZP_07052799.1| transcriptional regulatory protein [Listeria grayi DSM 20601]
 gi|299817931|gb|EFI85166.1| transcriptional regulatory protein [Listeria grayi DSM 20601]
          Length = 105

 Score = 63.5 bits (153), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 49/72 (68%)

Query: 29  EAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKKIEDLVAT 88
           E  G AGGGMV+VR+ GK ++  V I   ++  +++E+L+DL++AA +DA K++ED+ A 
Sbjct: 32  EFTGTAGGGMVTVRVTGKRVVQDVTIKEEVVDPEDIEMLQDLVLAATNDALKQVEDMTAK 91

Query: 89  KTQEITEGLPIP 100
                T+G+ +P
Sbjct: 92  TMGRFTQGINLP 103


>gi|296118023|ref|ZP_06836605.1| putative cytoplasmic protein [Corynebacterium ammoniagenes DSM
           20306]
 gi|295968909|gb|EFG82152.1| putative cytoplasmic protein [Corynebacterium ammoniagenes DSM
           20306]
          Length = 137

 Score = 63.5 bits (153), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 56/91 (61%)

Query: 7   MVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEI 66
           ++ Q   +Q +++K +E I + + EG AG G+V+V + G   L  +KID+S++  ++VE 
Sbjct: 37  ILAQAARVQAELQKAQEEILATKVEGTAGNGLVTVTMTGGAELVDLKIDKSVVDPEDVET 96

Query: 67  LEDLIIAAHSDAHKKIEDLVATKTQEITEGL 97
           L+DL+  A  DAH+K   L   K   +++G+
Sbjct: 97  LQDLVFGAFKDAHEKAGQLAQDKIGPLSQGM 127


>gi|56698392|ref|YP_168765.1| hypothetical protein SPO3570 [Ruegeria pomeroyi DSS-3]
 gi|56680129|gb|AAV96795.1| conserved hypothetical protein TIGR00103 [Ruegeria pomeroyi DSS-3]
          Length = 114

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 36/107 (33%), Positives = 60/107 (56%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           + ++ KM+   +E+Q KM +M+E + S+   G +G G+V      K  L G+ ID S+  
Sbjct: 8   LGDMAKMMKSAQELQTKMAQMQEDLNSVLVTGESGAGLVKATATAKGELKGLDIDPSIFN 67

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            D+ E++EDLI+AA  DA  K  +    +   +TE + +P  +K PF
Sbjct: 68  GDDKEVVEDLILAAIKDAQAKAAEKAQEEMAALTEAMGLPKDIKLPF 114


>gi|154684539|ref|YP_001419700.1| hypothetical protein RBAM_000260 [Bacillus amyloliquefaciens FZB42]
 gi|154350390|gb|ABS72469.1| YaaK [Bacillus amyloliquefaciens FZB42]
          Length = 109

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 54/83 (65%)

Query: 18  MEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSD 77
           M K +E +     EG AGGGMV+V++NG+  +  + I   ++  +++E+L+DL++AA +D
Sbjct: 24  MAKAQEELAEKVLEGTAGGGMVTVKVNGQKEVVDIAIKEEVVDPEDIEMLQDLVLAATND 83

Query: 78  AHKKIEDLVATKTQEITEGLPIP 100
           A KK++D+      + T+G+ IP
Sbjct: 84  ALKKVDDMTNETMGQFTKGMNIP 106


>gi|262278999|ref|ZP_06056784.1| recombinational DNA repair protein [Acinetobacter calcoaceticus
           RUH2202]
 gi|262259350|gb|EEY78083.1| recombinational DNA repair protein [Acinetobacter calcoaceticus
           RUH2202]
          Length = 109

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 39/109 (35%), Positives = 63/109 (57%), Gaps = 5/109 (4%)

Query: 3   NIMKMVGQFKEIQGKME----KMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSL 58
           NI  ++ Q + +Q  ME    K KE +   E +  AGGG+V V +NG+ ++  ++I   L
Sbjct: 2   NINMLMQQAQRMQKDMETNIKKAKEELAQTEVQAEAGGGLVKVTMNGRYLVKRIEISPEL 61

Query: 59  LFEDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           L +D  +++EDLI AA +DA ++ E +   K Q+   G+ +PPGL   F
Sbjct: 62  L-QDEPDMIEDLIAAAVNDAVRQAEVISEEKMQKANSGMGLPPGLAGMF 109


>gi|302384619|ref|YP_003820441.1| hypothetical protein Closa_0175 [Clostridium saccharolyticum WM1]
 gi|302195247|gb|ADL02818.1| conserved hypothetical protein [Clostridium saccharolyticum WM1]
          Length = 117

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 64/94 (68%), Gaps = 3/94 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M+N+MK   Q +++Q +ME+  +S+   E    AGGG VSV ++GK  +T VK+ + ++ 
Sbjct: 15  MNNLMK---QAQKMQRQMEETTKSLEEKEYTAAAGGGAVSVTVSGKKEVTSVKLSQEVVD 71

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEIT 94
            D++E+LEDLI+AA ++A +++E+  ++   ++T
Sbjct: 72  PDDIEMLEDLIMAATNEAFRQMEEDSSSAMAKLT 105


>gi|292669039|ref|ZP_06602465.1| transcriptional regulatory protein [Selenomonas noxia ATCC 43541]
 gi|292649294|gb|EFF67266.1| transcriptional regulatory protein [Selenomonas noxia ATCC 43541]
          Length = 108

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 33/101 (32%), Positives = 67/101 (66%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           N+  M+ + +++Q +M+KM++ +     E +AGGG V + ++G+  +  + I    +  +
Sbjct: 7   NMAGMMKKVQKMQSEMKKMQDELKRKTIEVSAGGGAVKIVMDGEKQVQNLVIAPDAVDPE 66

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGL 103
           +VE+L+DLI AA ++A KK+++++A +  ++T GL +PPGL
Sbjct: 67  DVEMLQDLISAAFNEATKKVDEMMAQEMGKLTSGLGLPPGL 107


>gi|320354017|ref|YP_004195356.1| hypothetical protein Despr_1917 [Desulfobulbus propionicus DSM
           2032]
 gi|320122519|gb|ADW18065.1| Uncharacterized protein family UPF0133 [Desulfobulbus propionicus
           DSM 2032]
          Length = 102

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 60/100 (60%), Gaps = 3/100 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           MS +MK   QF+E   ++  ++  +   +  G+AG GMV+  +NGK  L  + I+++L+ 
Sbjct: 3   MSELMKQAQQFQE---RLATVQNELGGKQVTGSAGAGMVTATVNGKGELLEIVIEQALVQ 59

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
            DN ++L+DLI+AA +D   K ++L   +   +T GL IP
Sbjct: 60  PDNTQMLQDLIVAAVNDGLNKAKELGKAEMGRLTGGLNIP 99


>gi|257062979|ref|YP_003142651.1| conserved hypothetical protein TIGR00103 [Slackia
           heliotrinireducens DSM 20476]
 gi|256790632|gb|ACV21302.1| conserved hypothetical protein TIGR00103 [Slackia
           heliotrinireducens DSM 20476]
          Length = 102

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 59/95 (62%)

Query: 6   KMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVE 65
           +M+ Q +++Q ++ K ++ I  + AE  AGGGMV+V   G N +  +KID + +  ++VE
Sbjct: 5   QMMRQAQKMQAELAKAQDEIKDMTAEATAGGGMVTVVATGNNEIQSIKIDPAAVDPEDVE 64

Query: 66  ILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           +LED+++AA ++A + +      +   +T G+ IP
Sbjct: 65  MLEDMVLAAANEALRAVAAKGTARLNSVTGGMNIP 99


>gi|212637867|ref|YP_002314387.1| hypothetical protein Aflv_0018 [Anoxybacillus flavithermus WK1]
 gi|212559347|gb|ACJ32402.1| Uncharacterized conserved protein [Anoxybacillus flavithermus WK1]
          Length = 110

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/83 (38%), Positives = 53/83 (63%)

Query: 18  MEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSD 77
           MEK +  +     EG AGGGMV+V  NG   +  V+I   ++  +++++L+DL++AA +D
Sbjct: 25  MEKAQAELAEKTVEGTAGGGMVTVVANGHKQILEVRIKEEVVDPEDIDMLQDLVLAATND 84

Query: 78  AHKKIEDLVATKTQEITEGLPIP 100
           A KK+++L A    + T+GL IP
Sbjct: 85  ALKKVDELTAETMGQFTKGLNIP 107


>gi|315644460|ref|ZP_07897593.1| hypothetical protein PVOR_02796 [Paenibacillus vortex V453]
 gi|315280210|gb|EFU43503.1| hypothetical protein PVOR_02796 [Paenibacillus vortex V453]
          Length = 103

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 61/100 (61%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M+N+ +M+ Q K++Q +M K +E + +   EG +GGG+V+V ++G   +  + I    + 
Sbjct: 1   MNNMNQMMKQVKKMQEQMLKAQEELATKTVEGTSGGGVVTVEVSGHKQILSINIKPEAVD 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
            D+VE+L+DL++ A +DA  K E++      + T G+ IP
Sbjct: 61  PDDVEMLQDLVLTAVNDALAKAEEIANADMGKFTGGMKIP 100


>gi|291520250|emb|CBK75471.1| conserved hypothetical protein TIGR00103 [Butyrivibrio fibrisolvens
           16/4]
          Length = 112

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 61/97 (62%), Gaps = 3/97 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           MS +MK   Q + +Q +ME+ +  +   E  G AGGG+V V ++GK  +T +KI+   + 
Sbjct: 17  MSQLMK---QAQRMQRQMEEAQAQLEETEMTGTAGGGVVEVTVSGKKEITKIKINPEAVD 73

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGL 97
            D+VE+LEDL++AA ++A +K++++ A    +   GL
Sbjct: 74  PDDVEMLEDLVMAAANEALRKVDEVSAASMSKFAGGL 110


>gi|254465970|ref|ZP_05079381.1| conserved hypothetical protein TIGR00103 [Rhodobacterales bacterium
           Y4I]
 gi|206686878|gb|EDZ47360.1| conserved hypothetical protein TIGR00103 [Rhodobacterales bacterium
           Y4I]
          Length = 114

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 36/107 (33%), Positives = 62/107 (57%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           + ++ KM+   +E+Q KM +M+E + ++   G AG G+V    + K  L G+ ID S+  
Sbjct: 8   LGDMAKMMKSAQELQTKMAQMQEDLHNVMVTGEAGAGLVKATASAKGDLKGLDIDPSIFN 67

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            D+ E++EDLI+AA  DA  K  +    +  ++TE + +P  +K PF
Sbjct: 68  GDDKEVVEDLILAAIKDAQAKAAEKAQEEMTKLTESMGLPKDIKLPF 114


>gi|254453162|ref|ZP_05066599.1| conserved hypothetical protein TIGR00103 [Octadecabacter
           antarcticus 238]
 gi|198267568|gb|EDY91838.1| conserved hypothetical protein TIGR00103 [Octadecabacter
           antarcticus 238]
          Length = 114

 Score = 62.8 bits (151), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 61/107 (57%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           + ++  M+ + +E+Q +M +++E +  +   G +G G+V    + K  L  + ID S+  
Sbjct: 8   LGDMAGMMKKAQEMQKQMGQLQEDLHDIVVVGISGAGLVKATASAKGELKALDIDPSIFN 67

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            D+ E++EDLI+AA  DA  K  D    +  ++T+GL +P  +K PF
Sbjct: 68  GDDKEVVEDLILAAIKDAQSKASDKAQEEMAKLTDGLGLPADMKLPF 114


>gi|260893959|ref|YP_003240056.1| hypothetical protein Adeg_2129 [Ammonifex degensii KC4]
 gi|260866100|gb|ACX53206.1| conserved hypothetical protein [Ammonifex degensii KC4]
          Length = 102

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 32/95 (33%), Positives = 60/95 (63%)

Query: 6   KMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVE 65
           KM+ Q +++Q ++ K++E + +   E  AGGGMV   +NG+  L  ++I    +  + VE
Sbjct: 5   KMMRQVQKLQSELAKLQEELGNRTTEATAGGGMVKAVVNGRQELVSLEIKPEAVDPEEVE 64

Query: 66  ILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           +L+D+I+AA ++A ++  ++VA +   +T GL IP
Sbjct: 65  LLQDMILAAVNEALRQAREMVAQEMGRLTGGLGIP 99


>gi|139438751|ref|ZP_01772235.1| Hypothetical protein COLAER_01238 [Collinsella aerofaciens ATCC
           25986]
 gi|133775831|gb|EBA39651.1| Hypothetical protein COLAER_01238 [Collinsella aerofaciens ATCC
           25986]
          Length = 106

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 35/103 (33%), Positives = 65/103 (63%), Gaps = 1/103 (0%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           N+ +M+ Q +++Q ++   +E++ S   + +AGGGMV V +NG+  L  + ID   L  +
Sbjct: 5   NMQQMMKQARKMQEQLAAAQENLKSQTVDASAGGGMVKVTVNGEMELVNLTIDPDALDPE 64

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKF 105
           +V++L+D+I+AA ++A + + +L   +   IT GL I PG+ F
Sbjct: 65  DVDMLQDMIMAAVNEAVRGVNELANKQMGAITGGLNI-PGMPF 106


>gi|297170605|gb|ADI21631.1| uncharacterized protein conserved in bacteria [uncultured
           myxobacterium HF0130_06F04]
          Length = 109

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 36/107 (33%), Positives = 60/107 (56%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           +S IMKM GQ +E   +ME +++    L   G +GGGMV V +NG+  +  VKID +++ 
Sbjct: 3   LSEIMKMAGQMRE---QMETVQQEAGKLRVHGESGGGMVKVEMNGRYEIVSVKIDPAIVV 59

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP-PGLKFP 106
            D V  +EDL+ AA + A  ++ + +  +  ++   L +   G  FP
Sbjct: 60  PDQVNFVEDLVRAAINQASGRVAEGLKDQAGDMASKLGLDLSGFGFP 106


>gi|125974630|ref|YP_001038540.1| hypothetical protein Cthe_2143 [Clostridium thermocellum ATCC
           27405]
 gi|256004180|ref|ZP_05429164.1| conserved hypothetical protein [Clostridium thermocellum DSM 2360]
 gi|281419178|ref|ZP_06250195.1| conserved hypothetical protein [Clostridium thermocellum JW20]
 gi|166227670|sp|A3DHB8|Y2143_CLOTH RecName: Full=UPF0133 protein Cthe_2143
 gi|125714855|gb|ABN53347.1| conserved hypothetical protein [Clostridium thermocellum ATCC
           27405]
 gi|255991928|gb|EEU02026.1| conserved hypothetical protein [Clostridium thermocellum DSM 2360]
 gi|281407327|gb|EFB37588.1| conserved hypothetical protein [Clostridium thermocellum JW20]
 gi|316941748|gb|ADU75782.1| Uncharacterized protein family UPF0133 [Clostridium thermocellum
           DSM 1313]
          Length = 113

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 36/101 (35%), Positives = 63/101 (62%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           NI  +V Q +++Q  ME+++E +     E +AGGG V+V   G+  +  + I   ++  D
Sbjct: 12  NINNLVKQAQKMQRDMERVQEELKEKTVEASAGGGAVTVVATGRKDIKEITIKPEVVDPD 71

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGL 103
           +VE+L+DLI+AA ++A +K +++V  +  +IT GL   PGL
Sbjct: 72  DVEMLQDLILAAVNEALRKADEMVTAEISKITGGLGGIPGL 112


>gi|315650374|ref|ZP_07903445.1| transcriptional regulatory protein [Eubacterium saburreum DSM
          3986]
 gi|315487301|gb|EFU77612.1| transcriptional regulatory protein [Eubacterium saburreum DSM
          3986]
          Length = 114

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 58/82 (70%)

Query: 3  NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
          NI +++ Q +++Q +ME+   +  S E   +AGGG VS+ ++GK  +T V ID+ ++  D
Sbjct: 15 NINQLMKQAQKMQKQMEEQSAAFESKEFCASAGGGAVSITVSGKKEVTKVSIDKEVVDPD 74

Query: 63 NVEILEDLIIAAHSDAHKKIED 84
          +VE+LEDLI+AA ++A +K+E+
Sbjct: 75 DVEMLEDLIMAAANEALRKMEE 96


>gi|326790140|ref|YP_004307961.1| hypothetical protein Clole_1031 [Clostridium lentocellum DSM 5427]
 gi|326540904|gb|ADZ82763.1| Uncharacterized protein family UPF0133 [Clostridium lentocellum DSM
           5427]
          Length = 110

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/98 (33%), Positives = 63/98 (64%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+ +++ Q +++Q +ME+ + ++ + E    AGGGMV V I GK  +  +KI+  ++ 
Sbjct: 8   MPNMQQLMKQAQKMQKQMEEAQAALETKELTATAGGGMVEVVITGKKEIKSIKINPDVVD 67

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLP 98
            D+VE LEDL++ A ++A ++ ++L   +  ++T GLP
Sbjct: 68  PDDVETLEDLVLVAVNEAVRQADELSQKEMGKLTGGLP 105


>gi|325479386|gb|EGC82482.1| DNA-binding protein, YbaB/EbfC family [Anaerococcus prevotii
           ACS-065-V-Col13]
          Length = 112

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 60/100 (60%), Gaps = 3/100 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M+N+MK   Q K++Q +MEK +  I   E   +AGGG+V   +NGK  +  VKI+  ++ 
Sbjct: 13  MNNMMK---QVKKMQEQMEKAQSEIEEKEFSSSAGGGVVEATVNGKKEVLSVKINPDVVD 69

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
            ++VE+LEDLI+ A +DA  K  D       ++T G+ IP
Sbjct: 70  PEDVEMLEDLIMVAINDAMTKASDYNEETMGKLTGGINIP 109


>gi|238917930|ref|YP_002931447.1| hypothetical protein EUBELI_02017 [Eubacterium eligens ATCC 27750]
 gi|259646564|sp|C4Z4W1|Y2017_EUBE2 RecName: Full=UPF0133 protein EUBELI_02017
 gi|238873290|gb|ACR73000.1| hypothetical protein EUBELI_02017 [Eubacterium eligens ATCC 27750]
          Length = 116

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 59/94 (62%), Gaps = 3/94 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M+N+MK   Q + +Q +ME+ +  + + E    AGGG+V V + GK  ++ VKID   + 
Sbjct: 15  MNNLMK---QAQRMQRQMEEQQAELENKEFSATAGGGVVEVTVTGKREVSKVKIDPEAVD 71

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEIT 94
            D+VE+LEDLI+AA ++A +K E+    +  +IT
Sbjct: 72  PDDVEMLEDLIVAATNEALRKCEEESQAQMAKIT 105


>gi|152973872|ref|YP_001373389.1| hypothetical protein Bcer98_0019 [Bacillus cereus subsp. cytotoxis
           NVH 391-98]
 gi|189030196|sp|A7GJT6|Y019_BACCN RecName: Full=UPF0133 protein Bcer98_0019
 gi|152022624|gb|ABS20394.1| conserved hypothetical protein 103 [Bacillus cytotoxicus NVH
           391-98]
          Length = 109

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 53/84 (63%)

Query: 20  KMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAH 79
           K +E +   + EG AGGGMV+V  NG   +  VK+   ++  +++E+L+DL++AA +DA 
Sbjct: 25  KAQEELGEKQVEGTAGGGMVTVIANGHKQILDVKMKEEVVDPEDIEMLQDLVLAATNDAL 84

Query: 80  KKIEDLVATKTQEITEGLPIPPGL 103
           KK E+L      + T+GL +P GL
Sbjct: 85  KKAEELSNATMGQFTKGLNLPGGL 108


>gi|39995206|ref|NP_951157.1| hypothetical protein GSU0095 [Geobacter sulfurreducens PCA]
 gi|39981968|gb|AAR33430.1| conserved hypothetical protein TIGR00103 [Geobacter sulfurreducens
           PCA]
 gi|307634650|gb|ADI82934.2| protein of unknown function DUF149 [Geobacter sulfurreducens KN400]
          Length = 104

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 61/100 (61%), Gaps = 3/100 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           ++ IMK   Q + +Q KM K++E   +  AE  AGGG V+  ++GKN +  + I    + 
Sbjct: 5   LAGIMK---QAQMMQQKMAKLQEEAANRTAEATAGGGAVTAVVSGKNQIVSLAIKPEAVD 61

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
            ++VE+L+DL++ A ++A KK++   A +  ++T GL IP
Sbjct: 62  PEDVEMLQDLVVTAVNEALKKVQSQFAEEMSKVTGGLNIP 101


>gi|266621802|ref|ZP_06114737.1| putative cytoplasmic protein [Clostridium hathewayi DSM 13479]
 gi|288866491|gb|EFC98789.1| putative cytoplasmic protein [Clostridium hathewayi DSM 13479]
          Length = 117

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 57/84 (67%), Gaps = 3/84 (3%)

Query: 1  MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
          M+N+MK   Q + +Q +ME+  + + + E    AGGG VSV ++GK  +T VK+   ++ 
Sbjct: 15 MNNLMK---QAQRMQRQMEETTKELEAKEYTATAGGGAVSVTVSGKKEVTAVKLSEEVVD 71

Query: 61 EDNVEILEDLIIAAHSDAHKKIED 84
           D++E+LEDLI+AA ++A +++E+
Sbjct: 72 PDDIEMLEDLIVAATNEAFRQMEE 95


>gi|146329367|ref|YP_001209843.1| hypothetical protein DNO_0954 [Dichelobacter nodosus VCS1703A]
 gi|146232837|gb|ABQ13815.1| conserved hypothetical protein [Dichelobacter nodosus VCS1703A]
          Length = 108

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 36/106 (33%), Positives = 59/106 (55%), Gaps = 1/106 (0%)

Query: 2   SNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFE 61
           S +  M+ + +E+Q  M+KM+  + +    G +G G V + +NG      V I +    +
Sbjct: 4   SGLGSMMKKAQEVQENMQKMQADLVNKTVTGQSGAGAVEIVLNGHYGCERVHISKEAQ-Q 62

Query: 62  DNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ++ EILE LI AA +DA +K+++L   +   IT GL +P G K PF
Sbjct: 63  ESPEILEALIAAAFNDAVQKVQELTQREMSAITAGLNLPNGFKLPF 108


>gi|221632487|ref|YP_002521708.1| hypothetical protein trd_0461 [Thermomicrobium roseum DSM 5159]
 gi|221156154|gb|ACM05281.1| conserved hypothetical protein TIGR00103 [Thermomicrobium roseum
          DSM 5159]
          Length = 101

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 52/79 (65%)

Query: 11 FKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDL 70
           K++Q ++ KM+  +  L  EG+AGGG V V ++G   +  V ID +L+   ++E+LEDL
Sbjct: 8  LKQVQEQLAKMQAELAELVVEGSAGGGAVRVELDGLRHVRRVSIDPTLVEAGDIEMLEDL 67

Query: 71 IIAAHSDAHKKIEDLVATK 89
          + AA +DA +++E+ V TK
Sbjct: 68 VAAAVNDALRRVEEAVTTK 86


>gi|16804740|ref|NP_466225.1| hypothetical protein lmo2703 [Listeria monocytogenes EGD-e]
 gi|46908882|ref|YP_015271.1| hypothetical protein LMOf2365_2683 [Listeria monocytogenes serotype
           4b str. F2365]
 gi|47092323|ref|ZP_00230114.1| conserved hypothetical protein TIGR00103 [Listeria monocytogenes
           str. 4b H7858]
 gi|47095510|ref|ZP_00233119.1| conserved hypothetical protein TIGR00103 [Listeria monocytogenes
           str. 1/2a F6854]
 gi|217966099|ref|YP_002351777.1| hypothetical protein LMHCC_2831 [Listeria monocytogenes HCC23]
 gi|224499378|ref|ZP_03667727.1| hypothetical protein LmonF1_06647 [Listeria monocytogenes Finland
           1988]
 gi|224502887|ref|ZP_03671194.1| hypothetical protein LmonFR_10259 [Listeria monocytogenes FSL
           R2-561]
 gi|226225255|ref|YP_002759362.1| hypothetical protein Lm4b_02677 [Listeria monocytogenes Clip81459]
 gi|254824932|ref|ZP_05229933.1| conserved hypothetical protein [Listeria monocytogenes FSL J1-194]
 gi|254827268|ref|ZP_05231955.1| conserved hypothetical protein [Listeria monocytogenes FSL N3-165]
 gi|254830861|ref|ZP_05235516.1| hypothetical protein Lmon1_05854 [Listeria monocytogenes 10403S]
 gi|254851992|ref|ZP_05241340.1| conserved hypothetical protein [Listeria monocytogenes FSL R2-503]
 gi|254899840|ref|ZP_05259764.1| hypothetical protein LmonJ_08501 [Listeria monocytogenes J0161]
 gi|254912954|ref|ZP_05262966.1| conserved hypothetical protein [Listeria monocytogenes J2818]
 gi|254931025|ref|ZP_05264384.1| conserved hypothetical protein [Listeria monocytogenes HPB2262]
 gi|254937335|ref|ZP_05269032.1| conserved hypothetical protein [Listeria monocytogenes F6900]
 gi|255025785|ref|ZP_05297771.1| hypothetical protein LmonocytFSL_04590 [Listeria monocytogenes FSL
           J2-003]
 gi|255028848|ref|ZP_05300799.1| hypothetical protein LmonL_06061 [Listeria monocytogenes LO28]
 gi|255520362|ref|ZP_05387599.1| hypothetical protein LmonocFSL_03882 [Listeria monocytogenes FSL
           J1-175]
 gi|284800411|ref|YP_003412276.1| hypothetical protein LM5578_0157 [Listeria monocytogenes 08-5578]
 gi|284993597|ref|YP_003415365.1| hypothetical protein LM5923_0157 [Listeria monocytogenes 08-5923]
 gi|290891885|ref|ZP_06554882.1| conserved hypothetical protein [Listeria monocytogenes FSL J2-071]
 gi|300763537|ref|ZP_07073535.1| conserved hypothetical protein [Listeria monocytogenes FSL N1-017]
 gi|21264174|sp|Q8Y3X6|Y2703_LISMO RecName: Full=UPF0133 protein lmo2703
 gi|67462050|sp|Q71W68|Y2683_LISMF RecName: Full=UPF0133 protein LMOf2365_2683
 gi|254801561|sp|B8DAT8|Y2831_LISMH RecName: Full=UPF0133 protein LMHCC_2831
 gi|259646886|sp|C1KZQ8|Y2677_LISMC RecName: Full=UPF0133 protein Lm4b_02677
 gi|16412203|emb|CAD00916.1| lmo2703 [Listeria monocytogenes EGD-e]
 gi|46882155|gb|AAT05448.1| conserved hypothetical protein TIGR00103 [Listeria monocytogenes
           serotype 4b str. F2365]
 gi|47016120|gb|EAL07044.1| conserved hypothetical protein TIGR00103 [Listeria monocytogenes
           str. 1/2a F6854]
 gi|47019302|gb|EAL10044.1| conserved hypothetical protein TIGR00103 [Listeria monocytogenes
           str. 4b H7858]
 gi|217335369|gb|ACK41163.1| conserved hypothetical protein [Listeria monocytogenes HCC23]
 gi|225877717|emb|CAS06431.1| Hypothetical protein of unknown function [Listeria monocytogenes
           serotype 4b str. CLIP 80459]
 gi|258599650|gb|EEW12975.1| conserved hypothetical protein [Listeria monocytogenes FSL N3-165]
 gi|258605290|gb|EEW17898.1| conserved hypothetical protein [Listeria monocytogenes FSL R2-503]
 gi|258609941|gb|EEW22549.1| conserved hypothetical protein [Listeria monocytogenes F6900]
 gi|284055973|gb|ADB66914.1| hypothetical protein LM5578_0157 [Listeria monocytogenes 08-5578]
 gi|284059064|gb|ADB70003.1| hypothetical protein LM5923_0157 [Listeria monocytogenes 08-5923]
 gi|290558479|gb|EFD91996.1| conserved hypothetical protein [Listeria monocytogenes FSL J2-071]
 gi|293582571|gb|EFF94603.1| conserved hypothetical protein [Listeria monocytogenes HPB2262]
 gi|293590955|gb|EFF99289.1| conserved hypothetical protein [Listeria monocytogenes J2818]
 gi|293594172|gb|EFG01933.1| conserved hypothetical protein [Listeria monocytogenes FSL J1-194]
 gi|300515814|gb|EFK42863.1| conserved hypothetical protein [Listeria monocytogenes FSL N1-017]
 gi|307572291|emb|CAR85470.1| conserved hypothetical protein [Listeria monocytogenes L99]
 gi|328468183|gb|EGF39189.1| hypothetical protein LM1816_02582 [Listeria monocytogenes 1816]
 gi|328469563|gb|EGF40504.1| hypothetical protein LM220_08570 [Listeria monocytogenes 220]
 gi|332313134|gb|EGJ26229.1| hypothetical protein LMOSA_6710 [Listeria monocytogenes str. Scott
           A]
          Length = 105

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 53/81 (65%)

Query: 20  KMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAH 79
           K +  + + E  G AGGGMV+V+  GK ++T V I+  ++  +++E+L+DL++AA +D  
Sbjct: 23  KAQADLEAQEFTGTAGGGMVTVKATGKRVITDVVINEEVVDPEDIEMLQDLVLAATNDVL 82

Query: 80  KKIEDLVATKTQEITEGLPIP 100
           K+IED  +    + T+GL IP
Sbjct: 83  KQIEDTTSQTMGKFTQGLNIP 103


>gi|225575492|ref|ZP_03784102.1| hypothetical protein RUMHYD_03582 [Blautia hydrogenotrophica DSM
           10507]
 gi|225037289|gb|EEG47535.1| hypothetical protein RUMHYD_03582 [Blautia hydrogenotrophica DSM
           10507]
          Length = 115

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 37/101 (36%), Positives = 66/101 (65%), Gaps = 3/101 (2%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M+N+MK   Q +++Q +ME+ ++++   E    AGGG V V ++GK  +T VK+   ++ 
Sbjct: 17  MNNLMK---QAQKMQKQMEESQKALEEKEYTAAAGGGAVEVTVSGKKEVTKVKLSEEVVD 73

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPP 101
            D++E+LEDLIIAA ++A +K+E+  ++   ++T GL   P
Sbjct: 74  PDDIEMLEDLIIAATNEALRKMEEDSSSVMSKLTGGLGNLP 114


>gi|158321873|ref|YP_001514380.1| hypothetical protein Clos_2855 [Alkaliphilus oremlandii OhILAs]
 gi|166988532|sp|A8MKQ2|Y2855_ALKOO RecName: Full=UPF0133 protein Clos_2855
 gi|158142072|gb|ABW20384.1| conserved hypothetical protein [Alkaliphilus oremlandii OhILAs]
          Length = 114

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 66/100 (66%), Gaps = 3/100 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M+N+MK   Q +++Q +ME+ +  +     E +AGGG VS++I GK  + G+ I   ++ 
Sbjct: 15  MNNMMK---QVQKMQKQMEETQAQLEQKVLETSAGGGAVSIKITGKKEIVGISIKPEVVD 71

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
            D+VE+LEDLI+AA ++A +  +D+++++  +IT  + +P
Sbjct: 72  PDDVEMLEDLIMAAMNEAIRAADDMMSSEMGKITGKMNMP 111


>gi|323697997|ref|ZP_08109909.1| uncharacterized protein family UPF0133 [Desulfovibrio sp. ND132]
 gi|323457929|gb|EGB13794.1| uncharacterized protein family UPF0133 [Desulfovibrio desulfuricans
           ND132]
          Length = 103

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 67/100 (67%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M  + +M+ Q + +Q KM + ++++ + E E ++GGGMV+V++ G   +T V+I+ S++ 
Sbjct: 1   MKGMNEMLRQAQIMQRKMTEAQDALKTKEVEASSGGGMVTVKVTGAQEVTEVRIEPSVME 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
             +VE+L+DL++ A ++A KK ++++    + +T G+ IP
Sbjct: 61  SGDVEMLQDLVMTAANEALKKSKEMMEEAMKGVTGGISIP 100


>gi|119476224|ref|ZP_01616575.1| hypothetical protein GP2143_07234 [marine gamma proteobacterium
           HTCC2143]
 gi|119450088|gb|EAW31323.1| hypothetical protein GP2143_07234 [marine gamma proteobacterium
           HTCC2143]
          Length = 104

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 38/104 (36%), Positives = 62/104 (59%), Gaps = 2/104 (1%)

Query: 4   IMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDN 63
           I +++ Q +E+Q KM+K +E + S E EG +G G+V + + G++ +  V ID SL+ ED 
Sbjct: 3   INELMKQAQEMQEKMQKAQEELASKEVEGESGAGLVKIVMTGRHDVRRVSIDSSLMAEDK 62

Query: 64  VEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            E+LEDL+ AA +DA +K+E         +  G+ +    K PF
Sbjct: 63  -EVLEDLLAAAVNDAVRKVESGNRDALSGLAGGMDM-SNFKMPF 104


>gi|331003027|ref|ZP_08326539.1| hypothetical protein HMPREF0491_01401 [Lachnospiraceae oral taxon
          107 str. F0167]
 gi|330413071|gb|EGG92446.1| hypothetical protein HMPREF0491_01401 [Lachnospiraceae oral taxon
          107 str. F0167]
          Length = 114

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 58/82 (70%)

Query: 3  NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
          NI +++ Q +++Q +ME+   +  S E   +AGGG VS+ ++GK  +T V ID+ ++  +
Sbjct: 15 NINQLMKQAQKMQKQMEEQSAAFESKEFSASAGGGAVSITVSGKKEITKVSIDKEVVDPE 74

Query: 63 NVEILEDLIIAAHSDAHKKIED 84
          +VE+LEDLI+AA ++A +K+E+
Sbjct: 75 DVEMLEDLIMAATNEALRKMEE 96


>gi|228989233|ref|ZP_04149227.1| hypothetical protein bpmyx0001_130 [Bacillus pseudomycoides DSM
           12442]
 gi|228770508|gb|EEM19078.1| hypothetical protein bpmyx0001_130 [Bacillus pseudomycoides DSM
           12442]
          Length = 108

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 54/84 (64%)

Query: 20  KMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAH 79
           K +E +     EG AGGGMV+V +NG   +  VKI   ++  +++E+L+DL++AA +DA 
Sbjct: 24  KAQEELGERTVEGTAGGGMVTVIVNGHKQILEVKIKEEVVDPEDIEMLQDLVLAATNDAL 83

Query: 80  KKIEDLVATKTQEITEGLPIPPGL 103
           K+ E+L  +   + T+GL +P G+
Sbjct: 84  KQAEELSNSTMGQFTKGLNLPGGM 107


>gi|291523176|emb|CBK81469.1| conserved hypothetical protein TIGR00103 [Coprococcus catus GD/7]
          Length = 114

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 62/94 (65%), Gaps = 3/94 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M+N+MK   Q + +Q +ME+ ++ +   E E  AGGG V V+++GK  +  V ID  ++ 
Sbjct: 15  MNNLMK---QAQRMQRQMEEAQKELEEKEVEAAAGGGAVKVKVSGKKEIVAVTIDPEVVD 71

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEIT 94
            ++VE+LEDLI+AA ++A +K++++  +   +IT
Sbjct: 72  PEDVEMLEDLIMAAANEALRKMDEVSQSSMAKIT 105


>gi|120554532|ref|YP_958883.1| hypothetical protein Maqu_1612 [Marinobacter aquaeolei VT8]
 gi|206558105|sp|A1U127|Y1612_MARAV RecName: Full=UPF0133 protein Maqu_1612
 gi|120324381|gb|ABM18696.1| conserved hypothetical protein 103 [Marinobacter aquaeolei VT8]
          Length = 107

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 67/107 (62%), Gaps = 1/107 (0%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M+N+  ++ + +++Q +M+K +E I   E  G +G G+V V +NG++ +  V ID SLL 
Sbjct: 2   MNNMGDLMKKAQQMQEQMQKAQEEIAKAEVTGESGAGLVKVTMNGRHDVRKVDIDPSLLS 61

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED  EILEDL+ AA +DA +++E     K   +  G+ +PPG K PF
Sbjct: 62  EDK-EILEDLLAAAVNDAVRRVEANQKDKMSGMMSGMGMPPGFKMPF 107


>gi|269926493|ref|YP_003323116.1| hypothetical protein Tter_1387 [Thermobaculum terrenum ATCC
           BAA-798]
 gi|269790153|gb|ACZ42294.1| conserved hypothetical protein [Thermobaculum terrenum ATCC
           BAA-798]
          Length = 99

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 35/95 (36%), Positives = 58/95 (61%), Gaps = 1/95 (1%)

Query: 11  FKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDL 70
            +E+Q +M K++E +     E  AGGG ++  +NG   L  +KID  ++  ++VE LEDL
Sbjct: 6   VRELQNQMMKIQEQLEHETVEVTAGGGAITAVMNGHMKLLSIKIDPEVVDPEDVETLEDL 65

Query: 71  IIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKF 105
           ++AA ++A  K ++L A +   +T G+ I PGL F
Sbjct: 66  VVAAVNEAITKAQELAAQRMSVLTGGMKI-PGLNF 99


>gi|294650365|ref|ZP_06727732.1| conserved hypothetical protein [Acinetobacter haemolyticus ATCC
           19194]
 gi|292823778|gb|EFF82614.1| conserved hypothetical protein [Acinetobacter haemolyticus ATCC
           19194]
          Length = 109

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 38/109 (34%), Positives = 61/109 (55%), Gaps = 5/109 (4%)

Query: 3   NIMKMVGQFKEIQGKME----KMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSL 58
           NI  ++ Q + +Q  ME    K KE + + E    AGGG+V V +  +N++  ++I   L
Sbjct: 2   NINMLMQQAQRMQKDMELNLKKAKEELANTEVHAEAGGGLVKVTMTCRNVVKRIEISPDL 61

Query: 59  LFEDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           L +D  +++EDLI AA +DA ++ E +   K Q    G+ +PPGL   F
Sbjct: 62  L-QDEADMIEDLIAAAMNDAARQAEAISEEKLQGANSGMGLPPGLSGLF 109


>gi|229015426|ref|ZP_04172429.1| hypothetical protein bcere0030_240 [Bacillus cereus AH1273]
 gi|229021631|ref|ZP_04178219.1| hypothetical protein bcere0029_130 [Bacillus cereus AH1272]
 gi|229074084|ref|ZP_04207133.1| hypothetical protein bcere0024_130 [Bacillus cereus Rock4-18]
 gi|229094744|ref|ZP_04225752.1| hypothetical protein bcere0020_130 [Bacillus cereus Rock3-29]
 gi|229100810|ref|ZP_04231628.1| hypothetical protein bcere0019_220 [Bacillus cereus Rock3-28]
 gi|229113698|ref|ZP_04243135.1| hypothetical protein bcere0017_130 [Bacillus cereus Rock1-3]
 gi|228669764|gb|EEL25169.1| hypothetical protein bcere0017_130 [Bacillus cereus Rock1-3]
 gi|228682617|gb|EEL36676.1| hypothetical protein bcere0019_220 [Bacillus cereus Rock3-28]
 gi|228688682|gb|EEL42552.1| hypothetical protein bcere0020_130 [Bacillus cereus Rock3-29]
 gi|228709047|gb|EEL61171.1| hypothetical protein bcere0024_130 [Bacillus cereus Rock4-18]
 gi|228739677|gb|EEL90085.1| hypothetical protein bcere0029_130 [Bacillus cereus AH1272]
 gi|228745868|gb|EEL95867.1| hypothetical protein bcere0030_240 [Bacillus cereus AH1273]
          Length = 109

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 54/84 (64%)

Query: 20  KMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAH 79
           K +E +     EG AGGGMVSV  NG   +  VKI   ++  +++E+L+DL++AA +DA 
Sbjct: 25  KAQEELGEKTVEGTAGGGMVSVIANGHKQVLEVKIKEEVVDPEDIEMLQDLVLAATNDAL 84

Query: 80  KKIEDLVATKTQEITEGLPIPPGL 103
           KK+++L  +   + T+GL +P G+
Sbjct: 85  KKVDELSNSTMGKFTKGLNLPGGM 108


>gi|38232883|ref|NP_938650.1| hypothetical protein DIP0260 [Corynebacterium diphtheriae NCTC
          13129]
 gi|81401992|sp|Q6NJY1|Y260_CORDI RecName: Full=UPF0133 protein DIP0260
 gi|38199141|emb|CAE48765.1| Conserved hypothetical protein [Corynebacterium diphtheriae]
          Length = 106

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 59/95 (62%)

Query: 3  NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
          ++ +++ Q +++Q K+++ +  I +    G AG G+VS+ + G  M++ V ID  ++  D
Sbjct: 5  DMSQILAQAQQMQAKLQEAQREILATTVTGTAGNGLVSIDMQGNGMVSSVTIDPKVVDAD 64

Query: 63 NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGL 97
          +VE L+DL++ A ++AH+K+  L   K   +++G 
Sbjct: 65 DVETLQDLLVGAFAEAHEKLGTLAEQKMGPLSQGF 99


>gi|227484859|ref|ZP_03915175.1| conserved hypothetical protein [Anaerococcus lactolyticus ATCC
           51172]
 gi|227237219|gb|EEI87234.1| conserved hypothetical protein [Anaerococcus lactolyticus ATCC
           51172]
          Length = 111

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 60/100 (60%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+  M+ Q K++Q +MEK ++ +   E   +AGGG+V   + GK ++T +KI+  ++ 
Sbjct: 9   MPNMNNMMKQVKKMQEEMEKAQQELEEKEFTSSAGGGVVEATVTGKKVVTSIKINPDVVD 68

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
            D+VE+L+DLI+ A +DA  + +         +T G+ IP
Sbjct: 69  PDDVEMLQDLIMVAINDAASQADKFNEDNMGRLTGGINIP 108


>gi|226954029|ref|ZP_03824493.1| conserved hypothetical protein [Acinetobacter sp. ATCC 27244]
 gi|226835219|gb|EEH67602.1| conserved hypothetical protein [Acinetobacter sp. ATCC 27244]
          Length = 109

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 38/109 (34%), Positives = 61/109 (55%), Gaps = 5/109 (4%)

Query: 3   NIMKMVGQFKEIQGKME----KMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSL 58
           NI  ++ Q + +Q  ME    K KE + + E    AGGG+V V +  +N++  ++I   L
Sbjct: 2   NINMLMQQAQRMQKDMESNLKKAKEELANTEVHAEAGGGLVKVTMTCRNVVKRIEISPDL 61

Query: 59  LFEDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           L +D  +++EDLI AA +DA ++ E +   K Q    G+ +PPGL   F
Sbjct: 62  L-QDEADMIEDLIAAAMNDAARQAEAISEEKLQGANSGMGLPPGLSGLF 109


>gi|313895137|ref|ZP_07828694.1| DNA-binding protein, YbaB/EbfC family [Selenomonas sp. oral taxon
           137 str. F0430]
 gi|312976032|gb|EFR41490.1| DNA-binding protein, YbaB/EbfC family [Selenomonas sp. oral taxon
           137 str. F0430]
          Length = 108

 Score = 62.0 bits (149), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 64/94 (68%)

Query: 10  QFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILED 69
           + +++Q +M+KM++ +     E ++GGG V + ++G+  +  + I  + +  +++E+L+D
Sbjct: 14  KVQKMQNEMKKMQDDLKRRTVEVSSGGGAVKIVMDGEKQVQSLVIAPAAVDPEDIEMLQD 73

Query: 70  LIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGL 103
           L+ AA ++A KK++D++A +  ++T GL +PPGL
Sbjct: 74  LLSAAFNEATKKVDDMMAAEMGKLTSGLGLPPGL 107


>gi|238922753|ref|YP_002936266.1| uncharacterized conserved protein, YbaB family [Eubacterium rectale
           ATCC 33656]
 gi|259646956|sp|C4ZB57|Y329_EUBR3 RecName: Full=UPF0133 protein EUBREC_0329
 gi|238874425|gb|ACR74132.1| uncharacterized conserved protein, YbaB family [Eubacterium rectale
           ATCC 33656]
 gi|291526533|emb|CBK92120.1| conserved hypothetical protein TIGR00103 [Eubacterium rectale DSM
           17629]
 gi|291527022|emb|CBK92608.1| conserved hypothetical protein TIGR00103 [Eubacterium rectale
           M104/1]
          Length = 113

 Score = 62.0 bits (149), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 62/97 (63%), Gaps = 3/97 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M+N+MK   Q +++Q +ME+ ++ +   E    AGGG V V ++GK  +T VK+   ++ 
Sbjct: 15  MNNLMK---QAQKMQRQMEEAQKQLEDAEVTAKAGGGAVEVTVSGKKEITKVKLSEEVVD 71

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGL 97
            D++E+LEDLI+AA ++A ++I++       +IT GL
Sbjct: 72  PDDIEMLEDLIMAATNEALRQIDEQSQASMSKITGGL 108


>gi|228995416|ref|ZP_04155087.1| hypothetical protein bmyco0003_220 [Bacillus mycoides Rock3-17]
 gi|229003030|ref|ZP_04160888.1| hypothetical protein bmyco0002_230 [Bacillus mycoides Rock1-4]
 gi|228758230|gb|EEM07417.1| hypothetical protein bmyco0002_230 [Bacillus mycoides Rock1-4]
 gi|228764342|gb|EEM13218.1| hypothetical protein bmyco0003_220 [Bacillus mycoides Rock3-17]
          Length = 109

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 54/84 (64%)

Query: 20  KMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAH 79
           K +E +     EG AGGGMV+V +NG   +  VKI   ++  +++E+L+DL++AA +DA 
Sbjct: 25  KAQEELGEKTVEGTAGGGMVTVIVNGHKQILEVKIKEEVVDPEDIEMLQDLVLAATNDAL 84

Query: 80  KKIEDLVATKTQEITEGLPIPPGL 103
           K+ E+L  +   + T+GL +P G+
Sbjct: 85  KQAEELSNSTMGQFTKGLNLPGGM 108


>gi|295702261|ref|YP_003595336.1| hypothetical protein BMD_0025 [Bacillus megaterium DSM 319]
 gi|294799920|gb|ADF36986.1| conserved hypothetical protein [Bacillus megaterium DSM 319]
          Length = 106

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/79 (37%), Positives = 51/79 (64%)

Query: 22  KESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKK 81
           +E +     EG AGGGMV+V +NG+  +  V I   ++  +++E+L+DL++AA +DA K+
Sbjct: 26  QEELAEKTVEGTAGGGMVTVVVNGQKQVIDVNIKEDVVDPEDIEMLQDLVLAATNDALKQ 85

Query: 82  IEDLVATKTQEITEGLPIP 100
           ++DL      + T+GL IP
Sbjct: 86  MDDLTNNTMGQFTKGLNIP 104


>gi|294496894|ref|YP_003560594.1| hypothetical protein BMQ_0025 [Bacillus megaterium QM B1551]
 gi|294346831|gb|ADE67160.1| conserved hypothetical protein [Bacillus megaterium QM B1551]
          Length = 105

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/79 (37%), Positives = 51/79 (64%)

Query: 22  KESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKK 81
           +E +     EG AGGGMV+V +NG+  +  V I   ++  +++E+L+DL++AA +DA K+
Sbjct: 25  QEELAEKTVEGTAGGGMVTVVVNGQKQVIDVNIKEDVVDPEDIEMLQDLVLAATNDALKQ 84

Query: 82  IEDLVATKTQEITEGLPIP 100
           ++DL      + T+GL IP
Sbjct: 85  MDDLTNNTMGQFTKGLNIP 103


>gi|219856722|ref|YP_002473844.1| hypothetical protein CKR_3379 [Clostridium kluyveri NBRC 12016]
 gi|219570446|dbj|BAH08430.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 120

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 58/94 (61%)

Query: 7   MVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEI 66
           ++ Q ++ Q +ME M+  + + E    AGG  ++V +NGK  +  +KI   ++  ++VE+
Sbjct: 24  LMKQAQKFQKQMEDMQSELENKEFSATAGGEAITVVVNGKKQIVSIKIKPEVVDPEDVEM 83

Query: 67  LEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           LEDL++ A + A K  ED  A++ +++T GL IP
Sbjct: 84  LEDLVLTACNQALKSAEDQTASEMKKLTGGLNIP 117


>gi|148266338|ref|YP_001233044.1| hypothetical protein Gura_4328 [Geobacter uraniireducens Rf4]
 gi|146399838|gb|ABQ28471.1| conserved hypothetical protein 103 [Geobacter uraniireducens Rf4]
          Length = 104

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 62/100 (62%), Gaps = 3/100 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           +++IMK   Q + +Q KM K++E       E  +GGG V+  +NGKN L  + I +  + 
Sbjct: 5   LASIMK---QAQMMQQKMGKLQEEAAQKTVEATSGGGAVTAVVNGKNQLISLTIKKEAVD 61

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
            ++VE+L+DL++AA ++A  K++  +A +  +IT G+ IP
Sbjct: 62  PEDVEMLQDLVVAAVNEALAKVQTEMAEQMNKITGGINIP 101


>gi|254439738|ref|ZP_05053232.1| conserved hypothetical protein TIGR00103 [Octadecabacter
           antarcticus 307]
 gi|198255184|gb|EDY79498.1| conserved hypothetical protein TIGR00103 [Octadecabacter
           antarcticus 307]
          Length = 128

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 61/107 (57%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           + ++  M+ + +E+Q +M ++++ +  +   G +G G+V    + K  L  + ID S+  
Sbjct: 22  LGDMAGMMKKAQEMQKQMGQLQDDLHDIVVVGVSGAGLVKATASAKGELKALDIDPSIFN 81

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            D+ E++EDLI+AA  DA  K  D    +  ++T+GL +P  +K PF
Sbjct: 82  GDDKEVVEDLILAAIKDAQSKASDKAQEEMAKLTDGLGLPADMKLPF 128


>gi|167629258|ref|YP_001679757.1| hypothetical protein HM1_0810 [Heliobacterium modesticaldum Ice1]
 gi|167591998|gb|ABZ83746.1| conserved hypothetical protein [Heliobacterium modesticaldum Ice1]
          Length = 107

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 59/100 (59%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M ++ KM+ Q +++Q  M K++E +     +   GGG V V  NGKN +  + I    + 
Sbjct: 5   MGDMQKMMKQVQKMQQDMVKLQEELVERTVDATGGGGAVKVVANGKNEILSITIAPEAVD 64

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
            D+VE+L+DLI+   ++A +K  ++V+ +  ++T GL IP
Sbjct: 65  PDDVEMLQDLILTVVNEALRKAREMVSQEMSKVTGGLKIP 104


>gi|320529757|ref|ZP_08030835.1| conserved hypothetical protein TIGR00103 [Selenomonas artemidis
           F0399]
 gi|320137996|gb|EFW29900.1| conserved hypothetical protein TIGR00103 [Selenomonas artemidis
           F0399]
          Length = 110

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 64/94 (68%)

Query: 10  QFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILED 69
           + +++Q +M+KM++ +     E ++GGG V + ++G+  +  + I  + +  +++E+L+D
Sbjct: 16  KVQKMQNEMKKMQDDLKRRTVEVSSGGGAVKIVMDGEKQVQSLIIAPAAVDPEDIEMLQD 75

Query: 70  LIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGL 103
           L+ AA ++A KK++D++A +  ++T GL +PPGL
Sbjct: 76  LLSAAFNEATKKVDDMMAAEMGKLTSGLGLPPGL 109


>gi|295107930|emb|CBL21883.1| conserved hypothetical protein TIGR00103 [Ruminococcus obeum
          A2-162]
          Length = 118

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 58/84 (69%), Gaps = 3/84 (3%)

Query: 1  MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
          M+N+MK   Q +++Q +ME+ ++++        AGGG V V ++GK  +TGVK+   ++ 
Sbjct: 16 MNNLMK---QAQKMQRQMEENQKALEEKSFTATAGGGAVEVTVSGKREVTGVKLSEEVVD 72

Query: 61 EDNVEILEDLIIAAHSDAHKKIED 84
           D++E+LEDLI+AA ++A +K+E+
Sbjct: 73 PDDIEMLEDLIVAATNEALRKVEE 96


>gi|255319563|ref|ZP_05360776.1| conserved hypothetical protein [Acinetobacter radioresistens SK82]
 gi|262379861|ref|ZP_06073017.1| recombinational DNA repair protein [Acinetobacter radioresistens
           SH164]
 gi|255303361|gb|EET82565.1| conserved hypothetical protein [Acinetobacter radioresistens SK82]
 gi|262299318|gb|EEY87231.1| recombinational DNA repair protein [Acinetobacter radioresistens
           SH164]
          Length = 109

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 58/96 (60%), Gaps = 1/96 (1%)

Query: 12  KEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLI 71
           K+++  ++K KE +  +E    AGGG+V V +  +N++  ++I+  LL +D  +++EDLI
Sbjct: 15  KDVESNLKKAKEELAQMEVHAEAGGGLVKVTMTCRNVVKRIEINPDLL-QDEPDMIEDLI 73

Query: 72  IAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            AA +DA ++ E +   K +    G+ +PPGL   F
Sbjct: 74  AAAINDAARQAEAISEEKMKSANSGMGLPPGLAGLF 109


>gi|153956410|ref|YP_001397175.1| hypothetical protein CKL_3826 [Clostridium kluyveri DSM 555]
 gi|189040307|sp|A5N3V8|Y3826_CLOK5 RecName: Full=UPF0133 protein CKL_3826
 gi|146349268|gb|EDK35804.1| Conserved hypothetical protein [Clostridium kluyveri DSM 555]
          Length = 114

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 58/94 (61%)

Query: 7   MVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEI 66
           ++ Q ++ Q +ME M+  + + E    AGG  ++V +NGK  +  +KI   ++  ++VE+
Sbjct: 18  LMKQAQKFQKQMEDMQSELENKEFSATAGGEAITVVVNGKKQIVSIKIKPEVVDPEDVEM 77

Query: 67  LEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           LEDL++ A + A K  ED  A++ +++T GL IP
Sbjct: 78  LEDLVLTACNQALKSAEDQTASEMKKLTGGLNIP 111


>gi|303239744|ref|ZP_07326268.1| conserved hypothetical protein [Acetivibrio cellulolyticus CD2]
 gi|302592681|gb|EFL62405.1| conserved hypothetical protein [Acetivibrio cellulolyticus CD2]
          Length = 114

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 36/101 (35%), Positives = 64/101 (63%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           N+  +V Q +++Q  MEK++E +     E +AGGG ++V   GK  +  + I   ++  +
Sbjct: 13  NMNNLVKQAQKMQKDMEKLQEELKDRTIETSAGGGAITVVATGKKEIKEIVIKPEVVDPN 72

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGL 103
           +VE+L+DLI+AA ++A +K +D+V ++  +IT GL   PGL
Sbjct: 73  DVEMLQDLIVAAVNEAIRKADDMVNSEMNKITGGLGGIPGL 113


>gi|257454437|ref|ZP_05619699.1| conserved hypothetical protein [Enhydrobacter aerosaccus SK60]
 gi|257448203|gb|EEV23184.1| conserved hypothetical protein [Enhydrobacter aerosaccus SK60]
          Length = 109

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 60/96 (62%), Gaps = 1/96 (1%)

Query: 12  KEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLI 71
           K+++  +E  K+ +   E    AG G+V V +NG++++  + ID SLL +D+ +++EDLI
Sbjct: 15  KQVEKNVENAKKKLAEKEVHAEAGSGLVKVTMNGRHVVKRLSIDPSLL-QDDPDMIEDLI 73

Query: 72  IAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            AA +DA ++ ++L  T+    T G+ +PPG+   F
Sbjct: 74  AAAINDAVRQADELHETEMASATNGMGLPPGMNGLF 109


>gi|95928308|ref|ZP_01311056.1| conserved hypothetical protein 103 [Desulfuromonas acetoxidans DSM
           684]
 gi|95135579|gb|EAT17230.1| conserved hypothetical protein 103 [Desulfuromonas acetoxidans DSM
           684]
          Length = 104

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 56/81 (69%)

Query: 20  KMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAH 79
           +++E +   E E +AGGGMV+V +NGK  +  +KID +++   +V++L+DLI+ A ++A 
Sbjct: 21  RIQEEVAKQEIEASAGGGMVTVVVNGKQEVLSIKIDPNVVDPQDVDMLQDLILVATNEAV 80

Query: 80  KKIEDLVATKTQEITEGLPIP 100
           +K +D++  +  ++T G+ IP
Sbjct: 81  RKSQDIMQQEMSKLTGGMNIP 101


>gi|190571333|ref|YP_001975691.1| hypothetical protein WPa_0938 [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|190357605|emb|CAQ55046.1| conserved hypothetical protein [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
          Length = 110

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 61/111 (54%), Gaps = 7/111 (6%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRIN----GKNMLTGVKIDR 56
            S IMK   Q +E+Q K+ + +E     E +G +GGG VS+ +     G      V ID 
Sbjct: 3   FSQIMK---QAQEMQKKLAEAQEKYIGKEFQGISGGGKVSILVEVIKIGGYKAKKVNIDL 59

Query: 57  SLLFEDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            L+  +  +I+EDL+ AA +DA KK E+ +A  T ++   + +PPG K PF
Sbjct: 60  ELMRNEEKDIVEDLVTAAFNDAIKKAEEDMANATSDLAGMMGLPPGFKLPF 110


>gi|253580410|ref|ZP_04857675.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39B_FAA]
 gi|251848140|gb|EES76105.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39BFAA]
          Length = 118

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 58/84 (69%), Gaps = 3/84 (3%)

Query: 1  MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
          M+N+MK   Q +++Q +ME+ ++++   E    AGGG V V I+GK  +T VK+   ++ 
Sbjct: 16 MNNLMK---QAQKMQRQMEENQKALEEKEFTATAGGGAVEVTISGKREVTKVKLQEEVVD 72

Query: 61 EDNVEILEDLIIAAHSDAHKKIED 84
           D++E+LEDLI+AA ++A +K+E+
Sbjct: 73 PDDIEMLEDLIVAATNEALRKVEE 96


>gi|167648529|ref|YP_001686192.1| hypothetical protein Caul_4574 [Caulobacter sp. K31]
 gi|189040201|sp|B0T1T3|Y4574_CAUSK RecName: Full=UPF0133 protein Caul_4574
 gi|167350959|gb|ABZ73694.1| conserved hypothetical protein [Caulobacter sp. K31]
          Length = 109

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 60/111 (54%), Gaps = 8/111 (7%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M ++  ++ Q + +Q K+   +  +  L  EG +GGGMV+V + G   L  V +D SL+ 
Sbjct: 1   MKDLGGLMKQAQAMQQKLADAQARLAELTVEGTSGGGMVTVTLRGNGELAKVVLDESLIE 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP------PGLKF 105
               E++ DLI+AAH+DA KK++   A   QE     P+       PG+KF
Sbjct: 61  PGEGEVIADLIVAAHADAKKKLDAQQAQLMQEAAG--PMAGMMGGLPGMKF 109


>gi|159900438|ref|YP_001546685.1| hypothetical protein Haur_3923 [Herpetosiphon aurantiacus ATCC
           23779]
 gi|159893477|gb|ABX06557.1| conserved hypothetical protein [Herpetosiphon aurantiacus ATCC
           23779]
          Length = 101

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 33/95 (34%), Positives = 58/95 (61%)

Query: 6   KMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVE 65
           KM+ Q +++Q K+ + +E +     EG+AGGG++ V++NG   +  + I    +  + +E
Sbjct: 4   KMLNQLQQMQKKLMQAQEDLGKTLVEGSAGGGVIEVKMNGHREILSITIAPEAVDPNEIE 63

Query: 66  ILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           +L+DL++ A +DA KK E+L   K   +T GL IP
Sbjct: 64  MLQDLLMLAINDASKKAEELSNAKMGPLTGGLNIP 98


>gi|323701679|ref|ZP_08113351.1| hypothetical protein DesniDRAFT_0563 [Desulfotomaculum nigrificans
           DSM 574]
 gi|323533452|gb|EGB23319.1| hypothetical protein DesniDRAFT_0563 [Desulfotomaculum nigrificans
           DSM 574]
          Length = 105

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 57/91 (62%)

Query: 10  QFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILED 69
           Q +++Q  M +M+E + +   E  AGGG+V V  +G+  +  + I    +  D+VE+L+D
Sbjct: 12  QVQKMQADMARMQEELANRTVEATAGGGVVKVVASGRQEIVSITIKPEAVDPDDVEMLQD 71

Query: 70  LIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           LI+ A +DA ++ +++VA +  ++T GL IP
Sbjct: 72  LILTAVNDALRQSQEMVAKEMAKLTGGLNIP 102


>gi|311028953|ref|ZP_07707043.1| hypothetical protein Bm3-1_00065 [Bacillus sp. m3-13]
          Length = 109

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 32/83 (38%), Positives = 53/83 (63%)

Query: 18  MEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSD 77
           M K +E +     EG AGGGMV+V +NG+  +  V I   ++  +++E+L+DL++AA +D
Sbjct: 24  MAKAQEELAEKTMEGTAGGGMVTVVVNGQKEIIEVNIKEEVVDPEDIEMLQDLVLAATND 83

Query: 78  AHKKIEDLVATKTQEITEGLPIP 100
           A KK+E+L      + T+GL +P
Sbjct: 84  ALKKMEELTNDTMGQFTKGLNMP 106


>gi|78355114|ref|YP_386563.1| hypothetical protein Dde_0067 [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
 gi|78217519|gb|ABB36868.1| conserved hypothetical protein [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
          Length = 103

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 63/100 (63%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M  +  M+ Q + +Q KM +++E +     + +AGGGMVSV ++GK  L  +KID +++ 
Sbjct: 1   MRGMQDMLRQAQIMQKKMTELQEQLGERTVDASAGGGMVSVTVSGKQELRAIKIDPAVVD 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
             +V++L+DL++AA ++  +  +++V  +   +T GL IP
Sbjct: 61  PQDVDMLQDLVLAAINEGMRLSKEMVEKEMGALTGGLKIP 100


>gi|289523018|ref|ZP_06439872.1| putative cytoplasmic protein [Anaerobaculum hydrogeniformans ATCC
           BAA-1850]
 gi|289503561|gb|EFD24725.1| putative cytoplasmic protein [Anaerobaculum hydrogeniformans ATCC
           BAA-1850]
          Length = 102

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 32/98 (32%), Positives = 61/98 (62%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           N+ K++ Q +++Q +M K++E +     EG +GGG+V V+ NG+     + I+  ++  +
Sbjct: 2   NMDKIMKQAQKMQAQMMKIQEELAKEVVEGESGGGVVKVKCNGQGDFLSISIEPDVVDPE 61

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           +VE+LEDLI+AA +DA +K ++L   +  +   G  +P
Sbjct: 62  DVEMLEDLILAAINDAQRKSKELANERLSKFGAGFGMP 99


>gi|297587503|ref|ZP_06946147.1| transcriptional regulatory protein [Finegoldia magna ATCC 53516]
 gi|297574192|gb|EFH92912.1| transcriptional regulatory protein [Finegoldia magna ATCC 53516]
          Length = 113

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 58/91 (63%)

Query: 10  QFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILED 69
           Q +++Q +ME+ ++ +   E    +GGG + V  NGK  +  +KID  L+ + +VE+L+D
Sbjct: 21  QMQKMQRQMEETQKKLEETEVTATSGGGAIEVVANGKKEIVSIKIDEDLVKDGDVEMLQD 80

Query: 70  LIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           +++ A +DA KK+ D+  ++  +IT G+ IP
Sbjct: 81  MVMVAVNDAIKKVLDMSESELGKITGGINIP 111


>gi|169824210|ref|YP_001691821.1| hypothetical protein FMG_0513 [Finegoldia magna ATCC 29328]
 gi|302380918|ref|ZP_07269380.1| DNA-binding protein, YbaB/EbfC family [Finegoldia magna
           ACS-171-V-Col3]
 gi|303234869|ref|ZP_07321494.1| DNA-binding protein, YbaB/EbfC family [Finegoldia magna BVS033A4]
 gi|226707670|sp|B0S0K7|Y513_FINM2 RecName: Full=UPF0133 protein FMG_0513
 gi|167831015|dbj|BAG07931.1| conserved hypothetical protein [Finegoldia magna ATCC 29328]
 gi|302311296|gb|EFK93315.1| DNA-binding protein, YbaB/EbfC family [Finegoldia magna
           ACS-171-V-Col3]
 gi|302493987|gb|EFL53768.1| DNA-binding protein, YbaB/EbfC family [Finegoldia magna BVS033A4]
          Length = 113

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 58/91 (63%)

Query: 10  QFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILED 69
           Q +++Q +ME+ ++ +   E    +GGG + V  NGK  +  +KID  L+ + +VE+L+D
Sbjct: 21  QMQKMQRQMEETQKRLEETEVTATSGGGAIEVVANGKKEIVSIKIDEDLVKDGDVEMLQD 80

Query: 70  LIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           +++ A +DA KK+ D+  ++  +IT G+ IP
Sbjct: 81  MVMVAVNDAIKKVLDMSESELGKITGGINIP 111


>gi|313616681|gb|EFR89466.1| hypothetical protein NT07LI_3846 [Listeria innocua FSL S4-378]
          Length = 105

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 53/81 (65%)

Query: 20  KMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAH 79
           K +  + + E  G AGGGMV+V+  GK ++T V I+  ++  +++E+L+DL++AA +D  
Sbjct: 23  KAQADLEAQEFTGTAGGGMVTVKATGKRVITDVVINEEVVDPEDIEMLQDLVLAATNDVL 82

Query: 80  KKIEDLVATKTQEITEGLPIP 100
           K+IED  +    + T+GL +P
Sbjct: 83  KQIEDTTSQTMGKFTQGLNLP 103


>gi|302336635|ref|YP_003801841.1| hypothetical protein Spirs_0087 [Spirochaeta smaragdinae DSM 11293]
 gi|301633820|gb|ADK79247.1| conserved hypothetical protein [Spirochaeta smaragdinae DSM 11293]
          Length = 110

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 33/101 (32%), Positives = 58/101 (57%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           N M +    + +Q  M+ M+E +  +   G AGGGMV + +NG+  + GV+I+R ++  +
Sbjct: 2   NPMDLFKNMQNLQSGMKDMQEQLKDIVVIGTAGGGMVVIEMNGQMQIIGVRIEREVVDPE 61

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGL 103
           ++ +LEDL+ AA +DA  K+ + +  K       L +PP L
Sbjct: 62  DIGMLEDLVRAAFNDAFAKVREEMQNKLSGGLGNLNLPPDL 102


>gi|121604576|ref|YP_981905.1| hypothetical protein Pnap_1671 [Polaromonas naphthalenivorans CJ2]
 gi|120593545|gb|ABM36984.1| conserved hypothetical protein 103 [Polaromonas naphthalenivorans
           CJ2]
          Length = 110

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 63/102 (61%), Gaps = 2/102 (1%)

Query: 7   MVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEI 66
           ++ Q + +Q  ++K ++ +  +E   +AG G+V V +  K+ +  ++ID SLL ED  ++
Sbjct: 10  LMKQAQAMQESVKKAQDDLAFVEVTADAGAGLVKVTMTCKHDVKRIEIDPSLLTEDK-DM 68

Query: 67  LEDLIIAAHSDAHKKIEDLVATKTQEITEGLP-IPPGLKFPF 107
           LEDL+ AA + A +K E++   K   +T  +P +P G+KFPF
Sbjct: 69  LEDLVAAAFNAAVRKAEEVSQEKMGNLTAKMPALPGGMKFPF 110


>gi|251794181|ref|YP_003008912.1| hypothetical protein Pjdr2_0145 [Paenibacillus sp. JDR-2]
 gi|247541807|gb|ACS98825.1| conserved hypothetical protein [Paenibacillus sp. JDR-2]
          Length = 103

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 60/100 (60%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M+N+ +M+ Q K++Q +M K +E + +   EG AGGG+V+V  NG   +  + I    + 
Sbjct: 1   MNNMNQMMKQVKKMQEQMMKAQEELVNKTVEGTAGGGVVTVVANGHKKIISIAIKPEAVD 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
            D+VE+L+DL++ A +D   K++++      + T G+ IP
Sbjct: 61  PDDVEMLQDLVLTAVNDVLAKVDEIANQDMGKFTGGMKIP 100


>gi|302872029|ref|YP_003840665.1| hypothetical protein COB47_1389 [Caldicellulosiruptor obsidiansis
           OB47]
 gi|312877254|ref|ZP_07737222.1| conserved hypothetical protein [Caldicellulosiruptor lactoaceticus
           6A]
 gi|302574888|gb|ADL42679.1| uncharacterized protein family UPF0133 [Caldicellulosiruptor
           obsidiansis OB47]
 gi|311795968|gb|EFR12329.1| conserved hypothetical protein [Caldicellulosiruptor lactoaceticus
           6A]
          Length = 113

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 35/98 (35%), Positives = 64/98 (65%), Gaps = 1/98 (1%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           NI ++  Q K++Q ++EK++E +   E E ++GGG V V INGK  +  ++I   ++  +
Sbjct: 14  NINQLQKQAKKMQEEIEKLQEELNQREIEVSSGGGAVKVVINGKKEIKSIQILPEVVDPE 73

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           +VE L+DLI+A  ++A +K++ +V  + Q++T G  IP
Sbjct: 74  DVETLQDLIVACVNEAIRKVDKMVEEEMQKVT-GFGIP 110


>gi|312622614|ref|YP_004024227.1| hypothetical protein Calkro_1553 [Caldicellulosiruptor
           kronotskyensis 2002]
 gi|312203081|gb|ADQ46408.1| Uncharacterized protein family UPF0133 [Caldicellulosiruptor
           kronotskyensis 2002]
          Length = 113

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 35/98 (35%), Positives = 64/98 (65%), Gaps = 1/98 (1%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           NI ++  Q K++Q ++EK++E +   E E ++GGG V V INGK  +  ++I   ++  +
Sbjct: 14  NINQLQKQAKKMQEEIEKLQEELNQREIEVSSGGGAVKVVINGKKEIKSIQILPEVVDPE 73

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           +VE L+DLI+A  ++A +K++ +V  + Q++T G  IP
Sbjct: 74  DVETLQDLIVACVNEAIRKVDKMVEEEMQKVT-GFGIP 110


>gi|157691310|ref|YP_001485772.1| hypothetical protein BPUM_0517 [Bacillus pumilus SAFR-032]
 gi|194018057|ref|ZP_03056662.1| conserved hypothetical protein [Bacillus pumilus ATCC 7061]
 gi|157680068|gb|ABV61212.1| hypothetical protein BPUM_0517 [Bacillus pumilus SAFR-032]
 gi|194010249|gb|EDW19826.1| conserved hypothetical protein [Bacillus pumilus ATCC 7061]
          Length = 114

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 29/83 (34%), Positives = 55/83 (66%)

Query: 18  MEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSD 77
           M K +E +     EG AGGGMV+V++NG+  +  V I+  ++  +++++L+DL++AA +D
Sbjct: 29  MAKAQEELAEKVLEGTAGGGMVTVKVNGQKEVVDVAINEEVVDPEDIDMLQDLVLAATND 88

Query: 78  AHKKIEDLVATKTQEITEGLPIP 100
           A KK+++L      + T+G+ +P
Sbjct: 89  ALKKVDELTNETMGQFTKGMNMP 111


>gi|312793324|ref|YP_004026247.1| hypothetical protein Calkr_1126 [Caldicellulosiruptor
           kristjanssonii 177R1B]
 gi|312180464|gb|ADQ40634.1| Uncharacterized protein family UPF0133 [Caldicellulosiruptor
           kristjanssonii 177R1B]
          Length = 113

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 35/98 (35%), Positives = 64/98 (65%), Gaps = 1/98 (1%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           NI ++  Q K++Q ++EK++E +   E E ++GGG V V INGK  +  ++I   ++  +
Sbjct: 14  NINQLQKQAKKMQEEIEKLQEELNQREIEVSSGGGAVKVVINGKKEIKSIQILPEVVDPE 73

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           +VE L+DLI+A  ++A +K++ +V  + Q++T G  IP
Sbjct: 74  DVETLQDLIVACVNEAIRKVDRMVEEEMQKVT-GFGIP 110


>gi|172056063|ref|YP_001812523.1| hypothetical protein Exig_0019 [Exiguobacterium sibiricum 255-15]
 gi|259491966|sp|B1YGC9|Y019_EXIS2 RecName: Full=UPF0133 protein Exig_0019
 gi|171988584|gb|ACB59506.1| conserved hypothetical protein [Exiguobacterium sibiricum 255-15]
          Length = 106

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 32/83 (38%), Positives = 54/83 (65%)

Query: 18  MEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSD 77
           M K +E +  L   G AGG MVSV  +G   +  V I   ++  D+VE+++DL++AA +D
Sbjct: 21  MAKAQEELKDLTVTGTAGGEMVSVVADGHKNIIDVIIKEEVVDPDDVEMIQDLVLAATND 80

Query: 78  AHKKIEDLVATKTQEITEGLPIP 100
           A KK+++LV++K  + T+G+ +P
Sbjct: 81  ALKKVDELVSSKMGKFTQGMNMP 103


>gi|311070667|ref|YP_003975590.1| hypothetical protein BATR1942_18710 [Bacillus atrophaeus 1942]
 gi|310871184|gb|ADP34659.1| hypothetical protein BATR1942_18710 [Bacillus atrophaeus 1942]
          Length = 107

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 29/83 (34%), Positives = 54/83 (65%)

Query: 18  MEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSD 77
           M K +E +     EG AGGGMV+V++NG+  +  + I   ++  +++E+L+DL++AA +D
Sbjct: 22  MAKAQEELAEKVLEGTAGGGMVTVKVNGQKEVVDISIQEEVVDPEDIEMLQDLVLAATND 81

Query: 78  AHKKIEDLVATKTQEITEGLPIP 100
           A KKI+++      + T+G+ +P
Sbjct: 82  ALKKIDEMTNETMGQFTKGMNMP 104


>gi|225571143|ref|ZP_03780141.1| hypothetical protein CLOHYLEM_07231 [Clostridium hylemonae DSM
           15053]
 gi|225159974|gb|EEG72593.1| hypothetical protein CLOHYLEM_07231 [Clostridium hylemonae DSM
           15053]
          Length = 115

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 64/100 (64%), Gaps = 3/100 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M+N+MK   Q +++Q +ME+  + + + E   +AGGG V V ++G   +  VK+D  ++ 
Sbjct: 16  MANLMK---QAQKMQRQMEEQAKEMETKEFTASAGGGAVEVTVSGTRQVLKVKLDEEVVD 72

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
            D++E+LEDLI+AA ++A  K+E+  A+   ++T G  +P
Sbjct: 73  PDDIEMLEDLIVAAVNEAIGKVEEESASAMSKLTGGGQMP 112


>gi|149375204|ref|ZP_01892976.1| hypothetical protein MDG893_06284 [Marinobacter algicola DG893]
 gi|149360568|gb|EDM49020.1| hypothetical protein MDG893_06284 [Marinobacter algicola DG893]
          Length = 106

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 67/107 (62%), Gaps = 1/107 (0%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M+N+  ++ + +++Q +M+K +E     E  G AG G+V V +NG++ +  V ID SLL 
Sbjct: 1   MNNMGDLMKKAQQMQEEMKKAQEEAAKAEITGEAGAGLVKVTMNGRHDVRKVDIDPSLLS 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED  EILEDL+ AA +DA +++E+    K   +  G+ +PPG K PF
Sbjct: 61  EDK-EILEDLLAAAINDAVRRVEENQKDKMSGMMSGMGMPPGFKMPF 106


>gi|309790308|ref|ZP_07684875.1| hypothetical protein OSCT_0826 [Oscillochloris trichoides DG6]
 gi|308227642|gb|EFO81303.1| hypothetical protein OSCT_0826 [Oscillochloris trichoides DG6]
          Length = 103

 Score = 60.8 bits (146), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 51/81 (62%)

Query: 23  ESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKKI 82
           E +   E EG+AGGG ++V++NG   L G+ I    +  D+VE+L+D+++AA +DA KK 
Sbjct: 22  EELAVAEVEGSAGGGAITVKMNGHRELKGISISPDAIDPDDVEMLQDMLMAAFNDASKKA 81

Query: 83  EDLVATKTQEITEGLPIPPGL 103
           +++   +   +T G+   PGL
Sbjct: 82  QEMAEQRLGPLTGGMKGIPGL 102


>gi|304440576|ref|ZP_07400462.1| conserved hypothetical protein [Peptoniphilus duerdenii ATCC
           BAA-1640]
 gi|304370952|gb|EFM24572.1| conserved hypothetical protein [Peptoniphilus duerdenii ATCC
           BAA-1640]
          Length = 110

 Score = 60.8 bits (146), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 63/100 (63%), Gaps = 3/100 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M+N+MK   Q +++Q +ME ++E + + E   ++GGG V   +NGK  L  +KID +++ 
Sbjct: 12  MNNMMK---QMQKLQKQMENLEEELKNQEVTASSGGGAVEATVNGKKELIRIKIDEAVVD 68

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
            ++V +LEDL++ A + A  + +++   +  ++T GL IP
Sbjct: 69  PEDVGMLEDLVLTAVNSAMDEADNIANKRMGKLTGGLNIP 108


>gi|71065353|ref|YP_264080.1| hypothetical protein Psyc_0793 [Psychrobacter arcticus 273-4]
 gi|123649112|sp|Q4FTL2|Y793_PSYA2 RecName: Full=UPF0133 protein Psyc_0793
 gi|71038338|gb|AAZ18646.1| conserved hypothetical protein [Psychrobacter arcticus 273-4]
          Length = 109

 Score = 60.8 bits (146), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 59/96 (61%), Gaps = 1/96 (1%)

Query: 12  KEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLI 71
           K+++  +E  K+ + + E    AG G+V V + G++++  + ID SLL ED  +++EDLI
Sbjct: 15  KKVEANVENAKKDLANKEVHAEAGSGLVKVTMTGRHVVKRLTIDPSLL-EDEPDMIEDLI 73

Query: 72  IAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            AA +DA ++ ++L  T     T G+ +PPG++  F
Sbjct: 74  AAAINDAVRQADELYETTMAGATSGMGLPPGMQGMF 109


>gi|308066975|ref|YP_003868580.1| hypothetical protein PPE_00144 [Paenibacillus polymyxa E681]
 gi|305856254|gb|ADM68042.1| Conserved hypothetical protein [Paenibacillus polymyxa E681]
          Length = 103

 Score = 60.8 bits (146), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 60/100 (60%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M+N+ +M+ Q K++Q +M K +E +     EG +GGG+V+V +NG   +  + I    + 
Sbjct: 1   MNNMNQMMKQVKKMQEQMLKAQEELGGKVIEGTSGGGVVTVEVNGHKKVLSITIKPEAVD 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
            D+VE+L+DL++ A +DA  K ++L      + T G+ IP
Sbjct: 61  PDDVEMLQDLVLTAVNDALSKADELANDDMGKFTGGMKIP 100


>gi|291165757|gb|EFE27805.1| transcriptional regulatory protein [Filifactor alocis ATCC 35896]
          Length = 115

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 31/98 (31%), Positives = 61/98 (62%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           N+  M+ Q +++Q  MEKM+  +   E E + GGG V V  NGK  +  ++I   ++  +
Sbjct: 15  NMNNMLKQVQKMQKDMEKMQAELEEKEVEASVGGGAVKVVANGKKQIISIEIKPEVVDPE 74

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           ++E+L+DL+++A ++A +  +++ A K  ++T G+ IP
Sbjct: 75  DIEMLQDLVLSAVNEALRSADEMSAGKMAQLTGGMNIP 112


>gi|289450108|ref|YP_003475320.1| YbaB/EbfC family DNA-binding protein [Clostridiales genomosp. BVAB3
           str. UPII9-5]
 gi|289184655|gb|ADC91080.1| DNA-binding protein, YbaB/EbfC family [Clostridiales genomosp.
           BVAB3 str. UPII9-5]
          Length = 118

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 59/97 (60%), Gaps = 4/97 (4%)

Query: 2   SNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFE 61
           +N+ +++ Q +++Q  ME  +  I++ E E  AGGGMV  +ING + L  ++I    +  
Sbjct: 22  ANMNQLIQQAQKMQRDMEAAQADISASEIEATAGGGMVKAKINGDHRLLALEIKPEAVDP 81

Query: 62  DNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLP 98
           D++E+L+D+I +A ++A    E L+A KT  I   LP
Sbjct: 82  DDIELLQDMICSAVNEA----ERLLAEKTASIMPKLP 114


>gi|187776530|ref|ZP_02993003.1| hypothetical protein CLOSPO_00035 [Clostridium sporogenes ATCC
           15579]
 gi|187775189|gb|EDU38991.1| hypothetical protein CLOSPO_00035 [Clostridium sporogenes ATCC
           15579]
          Length = 113

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 62/100 (62%), Gaps = 3/100 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M+N+MK   Q +++Q  MEKM+  +   E     GGG V    NGK  +  ++I   ++ 
Sbjct: 14  MNNLMK---QAQKLQQDMEKMQVEMEKKEFSATVGGGAVIAVANGKKQIVDIRIKPEVVD 70

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           ED++E+L+DLI++A ++A KK E+  +++ + +T G+ +P
Sbjct: 71  EDDIEMLQDLIMSACNEALKKAEEDTSSEMKRLTGGMNLP 110


>gi|253698848|ref|YP_003020037.1| hypothetical protein GM21_0194 [Geobacter sp. M21]
 gi|251773698|gb|ACT16279.1| conserved hypothetical protein [Geobacter sp. M21]
          Length = 104

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 63/100 (63%), Gaps = 3/100 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           ++ IMK   Q + +Q KM K++E  ++  AE   GGG V+V +NGKN +  + I +  + 
Sbjct: 5   LAQIMK---QAQMMQQKMGKLQEEASAKTAEVTTGGGAVTVVVNGKNQVLSLVIKKEAVD 61

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
            ++VE+L+DL++ A ++A KK+   ++ +  +IT GL IP
Sbjct: 62  PEDVEMLQDLVLTAVNEALKKVHAEMSEEMSKITGGLSIP 101


>gi|322417712|ref|YP_004196935.1| hypothetical protein GM18_0170 [Geobacter sp. M18]
 gi|320124099|gb|ADW11659.1| Uncharacterized protein family UPF0133 [Geobacter sp. M18]
          Length = 104

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 61/100 (61%), Gaps = 3/100 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           ++ IMK   Q + +Q KM K++E      AE   GGG V+V +NGKN +  + I +  + 
Sbjct: 5   LAQIMK---QAQMMQQKMGKLQEEAAERTAEVTTGGGAVTVVVNGKNQVLSLVIKKEAVD 61

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
            ++VE+L+DL++ A ++A KK+   ++ +  +IT GL IP
Sbjct: 62  PEDVEMLQDLVMTAVNEALKKVHQQMSEEMSKITGGLSIP 101


>gi|226329026|ref|ZP_03804544.1| hypothetical protein PROPEN_02928 [Proteus penneri ATCC 35198]
 gi|225202212|gb|EEG84566.1| hypothetical protein PROPEN_02928 [Proteus penneri ATCC 35198]
          Length = 76

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 48/67 (71%), Gaps = 1/67 (1%)

Query: 18 MEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSD 77
          M++M+E I +LE  G +G G+V + ING +    V+ID SLL ED+ E+LEDLI AA +D
Sbjct: 1  MQQMQEEIANLEVTGESGAGLVKITINGAHNCRRVEIDPSLL-EDDKEMLEDLIAAAFND 59

Query: 78 AHKKIED 84
          A ++I++
Sbjct: 60 AARRIDE 66


>gi|269792614|ref|YP_003317518.1| hypothetical protein Taci_1004 [Thermanaerovibrio acidaminovorans
          DSM 6589]
 gi|269100249|gb|ACZ19236.1| conserved hypothetical protein [Thermanaerovibrio acidaminovorans
          DSM 6589]
          Length = 101

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 58/91 (63%)

Query: 4  IMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDN 63
          I K++ Q +++Q +M  ++E +  +E EG++GGGMV  R+NG+  L  +KI   ++  ++
Sbjct: 3  IDKLLKQAQKMQAQMATLQEELAKMEHEGSSGGGMVVARVNGQGDLVSIKISPEVIDPED 62

Query: 64 VEILEDLIIAAHSDAHKKIEDLVATKTQEIT 94
           E+LEDL+ +A ++A ++  D  + +   +T
Sbjct: 63 PEMLEDLVTSAVNEAVRRSRDFASERMSMLT 93


>gi|210616981|ref|ZP_03291316.1| hypothetical protein CLONEX_03538 [Clostridium nexile DSM 1787]
 gi|210149504|gb|EEA80513.1| hypothetical protein CLONEX_03538 [Clostridium nexile DSM 1787]
          Length = 118

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 60/94 (63%), Gaps = 3/94 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M+N+MK   Q +++Q +ME+  + + S E    AGGG V V ++G   +T VK+   ++ 
Sbjct: 16  MANLMK---QAQKMQRQMEEQAKELESKEFTATAGGGAVEVTVSGTREVTKVKLQEEVVD 72

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEIT 94
            D++E+LEDLI+AA ++A +K+E   A+   ++T
Sbjct: 73  PDDIEMLEDLIVAATNEALRKVEAESASAMSKLT 106


>gi|299770309|ref|YP_003732335.1| hypothetical protein AOLE_10365 [Acinetobacter sp. DR1]
 gi|298700397|gb|ADI90962.1| hypothetical protein AOLE_10365 [Acinetobacter sp. DR1]
          Length = 109

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 38/109 (34%), Positives = 62/109 (56%), Gaps = 5/109 (4%)

Query: 3   NIMKMVGQFKEIQGKME----KMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSL 58
           NI  ++ Q + +Q  ME    K KE +   E    AGGG+V V + G+ ++  ++I+  L
Sbjct: 2   NINMLMQQAQRMQKDMETNIKKAKEELAQTEVHAEAGGGLVKVTMTGRYLVKRIEINPEL 61

Query: 59  LFEDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           L +D  +++EDLI AA +DA ++ E +   K Q+   G+ +PPGL   F
Sbjct: 62  L-QDEPDMIEDLIAAAVNDAVRQAEVISEEKMQKANSGMGLPPGLAGMF 109


>gi|323705217|ref|ZP_08116793.1| hypothetical protein family UPF0133 [Thermoanaerobacterium
           xylanolyticum LX-11]
 gi|323535643|gb|EGB25418.1| hypothetical protein family UPF0133 [Thermoanaerobacterium
           xylanolyticum LX-11]
          Length = 111

 Score = 60.8 bits (146), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 38/98 (38%), Positives = 64/98 (65%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           N+  M+ Q +++Q +M+KM+E + +   E +AGGG V V  NG+  L  +KID  ++ +D
Sbjct: 11  NMNNMIKQAQQMQEQMKKMQEELENKTVEESAGGGAVKVVANGRKELISIKIDPDVVDKD 70

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           +VE+LEDL++AA + A +  E ++A +  +IT G  IP
Sbjct: 71  DVEMLEDLVLAAVNQALRSAEKMIAEEMGKITGGFNIP 108


>gi|294789338|ref|ZP_06754576.1| conserved hypothetical protein [Simonsiella muelleri ATCC 29453]
 gi|294482763|gb|EFG30452.1| conserved hypothetical protein [Simonsiella muelleri ATCC 29453]
          Length = 111

 Score = 60.8 bits (146), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 33/98 (33%), Positives = 58/98 (59%), Gaps = 2/98 (2%)

Query: 10  QFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFE--DNVEIL 67
           Q +++Q  M+K +  +   +  G AG G+V V     +++  + ID  L+ +  D+ E+L
Sbjct: 13  QAQKMQENMKKAQAELAQTQVNGEAGNGLVKVTATCNHVIHKIDIDPKLIAQSVDDKEML 72

Query: 68  EDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKF 105
           EDL++AA +DA++K EDL +++  + T GLP   G  F
Sbjct: 73  EDLVLAAIADAYEKAEDLTSSRMSQFTAGLPAGMGDFF 110


>gi|116874070|ref|YP_850851.1| hypothetical protein lwe2654 [Listeria welshimeri serovar 6b str.
           SLCC5334]
 gi|289435978|ref|YP_003465850.1| hypothetical protein lse_2617 [Listeria seeligeri serovar 1/2b str.
           SLCC3954]
 gi|123466681|sp|A0AM40|Y2654_LISW6 RecName: Full=UPF0133 protein lwe2654
 gi|116742948|emb|CAK22072.1| conserved hypothetical protein [Listeria welshimeri serovar 6b str.
           SLCC5334]
 gi|289172222|emb|CBH28768.1| conserved hypothetical protein [Listeria seeligeri serovar 1/2b
           str. SLCC3954]
 gi|313635973|gb|EFS01904.1| hypothetical protein NT04LS_3155 [Listeria seeligeri FSL S4-171]
          Length = 105

 Score = 60.8 bits (146), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 49/72 (68%)

Query: 29  EAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKKIEDLVAT 88
           E  G AGGGMV+V+  GK ++T V I+  ++  +++E+L+DL++AA +D  K+IED  + 
Sbjct: 32  EFTGTAGGGMVTVKATGKRVITDVVINEEVVDPEDIEMLQDLVLAATNDVLKQIEDTTSQ 91

Query: 89  KTQEITEGLPIP 100
              + T+GL +P
Sbjct: 92  TMGKFTQGLNLP 103


>gi|307332254|ref|ZP_07611334.1| conserved hypothetical protein [Streptomyces violaceusniger Tu
           4113]
 gi|306882115|gb|EFN13221.1| conserved hypothetical protein [Streptomyces violaceusniger Tu
           4113]
          Length = 111

 Score = 60.8 bits (146), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 56/103 (54%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           N+ +++ Q +++Q  +   +E +     EG+AGGG+V   + G   L G+ ID   +  +
Sbjct: 9   NMQQLLQQAQKMQQDLAAAQEELARTHVEGSAGGGLVKATVTGSGELQGLVIDPKAVDPE 68

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKF 105
           + E L DL++AA  DA+   ++L   K   + +GL   PGL F
Sbjct: 69  DTETLADLVVAAVRDANNAAQELQQQKLGPLAQGLGGMPGLPF 111


>gi|153815987|ref|ZP_01968655.1| hypothetical protein RUMTOR_02232 [Ruminococcus torques ATCC 27756]
 gi|317500927|ref|ZP_07959137.1| hypothetical protein HMPREF1026_01080 [Lachnospiraceae bacterium
           8_1_57FAA]
 gi|331089173|ref|ZP_08338076.1| hypothetical protein HMPREF1025_01659 [Lachnospiraceae bacterium
           3_1_46FAA]
 gi|145846634|gb|EDK23552.1| hypothetical protein RUMTOR_02232 [Ruminococcus torques ATCC 27756]
 gi|316897630|gb|EFV19691.1| hypothetical protein HMPREF1026_01080 [Lachnospiraceae bacterium
           8_1_57FAA]
 gi|330405950|gb|EGG85476.1| hypothetical protein HMPREF1025_01659 [Lachnospiraceae bacterium
           3_1_46FAA]
          Length = 117

 Score = 60.8 bits (146), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 62/94 (65%), Gaps = 3/94 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M+N+MK   Q +++Q +ME+ ++ + + E    AGGG V V ++GK  +T VK+   ++ 
Sbjct: 16  MANLMK---QAQKMQRQMEEQQKELEAKEFTATAGGGAVEVTVSGKREVTKVKLAEEVVD 72

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEIT 94
            D++E+LEDLI+AA ++A ++I++   +   ++T
Sbjct: 73  PDDIEMLEDLIVAATNEALRQIDEATGSAMSKLT 106


>gi|222529135|ref|YP_002573017.1| hypothetical protein Athe_1143 [Caldicellulosiruptor bescii DSM
           6725]
 gi|254799953|sp|B9MRE0|Y1143_ANATD RecName: Full=UPF0133 protein Athe_1143
 gi|222455982|gb|ACM60244.1| conserved hypothetical protein [Caldicellulosiruptor bescii DSM
           6725]
          Length = 113

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 34/98 (34%), Positives = 64/98 (65%), Gaps = 1/98 (1%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           NI ++  Q +++Q ++EK++E +   E E ++GGG V V INGK  +  ++I   ++  +
Sbjct: 14  NINQLQKQARKMQEEIEKLQEELNQREIEVSSGGGAVKVVINGKKEIKSIQILPEVVDPE 73

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           +VE L+DLI+A  ++A +K++ +V  + Q++T G  IP
Sbjct: 74  DVETLQDLIVACVNEAIRKVDKMVEEEMQKVT-GFGIP 110


>gi|262375230|ref|ZP_06068463.1| recombinational DNA repair protein [Acinetobacter lwoffii SH145]
 gi|262309484|gb|EEY90614.1| recombinational DNA repair protein [Acinetobacter lwoffii SH145]
          Length = 109

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 58/96 (60%), Gaps = 1/96 (1%)

Query: 12  KEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLI 71
           KE++  ++K KE +   E    AGGG+V V +  +N++  ++I+  LL +D+ +++EDLI
Sbjct: 15  KEVENNVKKAKEELAQTEVHAEAGGGLVKVTMTCRNVVKRIEINPELL-QDDPDMIEDLI 73

Query: 72  IAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            AA +DA ++ E +   + +    G+ +PPGL   F
Sbjct: 74  AAAMNDAARQAEVVSDERMKAANSGMGLPPGLAGMF 109


>gi|256826613|ref|YP_003150572.1| hypothetical protein Ccur_01590 [Cryptobacterium curtum DSM 15641]
 gi|256582756|gb|ACU93890.1| conserved hypothetical protein TIGR00103 [Cryptobacterium curtum
           DSM 15641]
          Length = 101

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 57/95 (60%)

Query: 6   KMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVE 65
           KM+ Q +++Q ++   ++ I  +  E +AGGGMV   + G+  L  + ID   +  D+ E
Sbjct: 5   KMMRQAQKMQAQLAAAQDEIKDMTYEASAGGGMVKATVTGEMTLQSISIDPVAVDPDDTE 64

Query: 66  ILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           +L+D+++AA ++A + + DL  T+   +T G+ +P
Sbjct: 65  MLQDMVLAAVNEALRGMADLSNTRLNAVTGGMNLP 99


>gi|254475415|ref|ZP_05088801.1| conserved hypothetical protein TIGR00103 [Ruegeria sp. R11]
 gi|214029658|gb|EEB70493.1| conserved hypothetical protein TIGR00103 [Ruegeria sp. R11]
          Length = 114

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 35/107 (32%), Positives = 61/107 (57%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           + ++ KM+   +E+Q KM +M+E + ++   G AG G+V    + K  L  + ID S+  
Sbjct: 8   LGDMAKMMKSAQELQTKMAQMQEDLHNVMVTGEAGAGLVKATASAKGDLKALDIDPSIFN 67

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            D+ E++EDLI+AA  DA  K  +    +  ++TE + +P  +K PF
Sbjct: 68  GDDKEVVEDLILAAIKDAQAKAAEKAQDEMGKLTESMGLPKDIKLPF 114


>gi|239825604|ref|YP_002948228.1| hypothetical protein GWCH70_0020 [Geobacillus sp. WCH70]
 gi|295402711|ref|ZP_06812653.1| conserved hypothetical protein [Geobacillus thermoglucosidasius
           C56-YS93]
 gi|312109170|ref|YP_003987486.1| hypothetical protein GY4MC1_0019 [Geobacillus sp. Y4.1MC1]
 gi|259491967|sp|C5D346|Y020_GEOSW RecName: Full=UPF0133 protein GWCH70_0020
 gi|239805897|gb|ACS22962.1| conserved hypothetical protein [Geobacillus sp. WCH70]
 gi|294975242|gb|EFG50878.1| conserved hypothetical protein [Geobacillus thermoglucosidasius
           C56-YS93]
 gi|311214271|gb|ADP72875.1| Uncharacterized protein family UPF0133 [Geobacillus sp. Y4.1MC1]
          Length = 108

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 32/79 (40%), Positives = 50/79 (63%)

Query: 22  KESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKK 81
           +E +     EG AGGGMV+V  NG   +  VKI   ++  +++E+L+DL++AA +DA KK
Sbjct: 27  QEQLAEKTVEGTAGGGMVTVIANGHKQILEVKIKEEVVDPEDIEMLQDLVLAATNDALKK 86

Query: 82  IEDLVATKTQEITEGLPIP 100
            ++L A    + T+GL IP
Sbjct: 87  ADELAAEMMGQFTKGLNIP 105


>gi|312127802|ref|YP_003992676.1| hypothetical protein Calhy_1591 [Caldicellulosiruptor
           hydrothermalis 108]
 gi|311777821|gb|ADQ07307.1| conserved hypothetical protein [Caldicellulosiruptor hydrothermalis
           108]
          Length = 113

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 35/98 (35%), Positives = 63/98 (64%), Gaps = 1/98 (1%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           NI ++  Q K++Q ++EK+ E +   E E ++GGG V V INGK  +  ++I   ++  +
Sbjct: 14  NINQLQKQAKKMQEEIEKLHEELNQREIEVSSGGGAVKVVINGKKEIKSIQILPEVVDPE 73

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           +VE L+DLI+A  ++A +K++ +V  + Q++T G  IP
Sbjct: 74  DVETLQDLIVACVNEAIRKVDKMVEEEMQKVT-GFGIP 110


>gi|163737245|ref|ZP_02144663.1| hypothetical protein RGBS107_03843 [Phaeobacter gallaeciensis
           BS107]
 gi|161389849|gb|EDQ14200.1| hypothetical protein RGBS107_03843 [Phaeobacter gallaeciensis
           BS107]
          Length = 114

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 35/107 (32%), Positives = 60/107 (56%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           + ++ KM+   +E+Q KM +M+E + ++   G AG G+V    + K  L  + ID S+  
Sbjct: 8   LGDMAKMMKSAQELQTKMAQMQEDLHNVMVTGEAGAGLVKATASAKGDLKALDIDPSIFN 67

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            D+ E++EDLI+AA  DA  K  +    +   +TE + +P  +K PF
Sbjct: 68  GDDKEVVEDLILAAIKDAQAKAAEKAQEEMANLTESMGLPKDIKLPF 114


>gi|50085408|ref|YP_046918.1| hypothetical protein ACIAD2313 [Acinetobacter sp. ADP1]
 gi|49531384|emb|CAG69096.1| conserved hypothetical protein [Acinetobacter sp. ADP1]
          Length = 110

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 63/111 (56%), Gaps = 5/111 (4%)

Query: 1   MSNIMKMVGQFKEIQGKME----KMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDR 56
           M NI  ++ Q + +Q  ME    K KE +   E +  AGGG+V V + G+ ++  ++I+ 
Sbjct: 1   MMNINMLMQQAQRMQKDMEANAKKAKEELAKTEVQAEAGGGLVKVTMTGRFVVKRIEINP 60

Query: 57  SLLFEDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            LL +D  E++EDLI AA +DA ++ E +   K +    G+ +PPGL   F
Sbjct: 61  DLL-QDEPEMIEDLIAAAVNDAVRQAEAVADEKMKGANSGMGLPPGLSGLF 110


>gi|42520869|ref|NP_966784.1| hypothetical protein WD1061 [Wolbachia endosymbiont of Drosophila
           melanogaster]
 gi|225630795|ref|YP_002727586.1| hypothetical protein WRi_010980 [Wolbachia sp. wRi]
 gi|42410609|gb|AAS14718.1| conserved hypothetical protein TIGR00103 [Wolbachia endosymbiont of
           Drosophila melanogaster]
 gi|225592776|gb|ACN95795.1| conserved hypothetical protein [Wolbachia sp. wRi]
          Length = 110

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 60/111 (54%), Gaps = 7/111 (6%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRIN----GKNMLTGVKIDR 56
            S IMK   Q +E+Q K+ + +E     E +G +GGG VSV +     G      V ID 
Sbjct: 3   FSQIMK---QAQEMQKKLAEAQEKYVGKEFQGISGGGKVSVLVEVIKIGSYKAKKVNIDL 59

Query: 57  SLLFEDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            L+  +  +I+EDL+ AA +DA KK E+ +A  T ++   + +P G K PF
Sbjct: 60  ELMRNEEKDIVEDLVTAAFNDAVKKAEEDMANATSDLAGMMGLPSGFKLPF 110


>gi|240146664|ref|ZP_04745265.1| putative cytoplasmic protein [Roseburia intestinalis L1-82]
 gi|257201208|gb|EEU99492.1| putative cytoplasmic protein [Roseburia intestinalis L1-82]
 gi|291537702|emb|CBL10814.1| conserved hypothetical protein TIGR00103 [Roseburia intestinalis
           M50/1]
 gi|291537840|emb|CBL10951.1| conserved hypothetical protein TIGR00103 [Roseburia intestinalis
           XB6B4]
          Length = 116

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 61/94 (64%), Gaps = 3/94 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M+N+MK   Q +++Q +ME+ ++ +   E    AGGG V V ++GK  +T VK+   ++ 
Sbjct: 15  MNNLMK---QAQKMQRQMEEAQKELEEKEITAAAGGGAVEVTVSGKREITKVKLSEEVVD 71

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEIT 94
            D++E+LEDLI+AA ++A +++E+  +    +IT
Sbjct: 72  PDDIEMLEDLIMAATNEALRQLEEFSSDSMSKIT 105


>gi|116326906|ref|YP_796626.1| hypothetical protein LBL_0065 [Leptospira borgpetersenii serovar
           Hardjo-bovis L550]
 gi|116332430|ref|YP_802148.1| hypothetical protein LBJ_3002 [Leptospira borgpetersenii serovar
           Hardjo-bovis JB197]
 gi|122279844|sp|Q04NY0|Y3002_LEPBJ RecName: Full=UPF0133 protein LBJ_3002
 gi|122285244|sp|Q056Q2|Y065_LEPBL RecName: Full=UPF0133 protein LBL_0065
 gi|116119650|gb|ABJ77693.1| Conserved hypothetical protein [Leptospira borgpetersenii serovar
           Hardjo-bovis L550]
 gi|116126119|gb|ABJ77390.1| Conserved hypothetical protein [Leptospira borgpetersenii serovar
           Hardjo-bovis JB197]
          Length = 115

 Score = 60.5 bits (145), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 59/100 (59%), Gaps = 3/100 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           +S ++  +G  +E   KME +K+ I S+   G+AG GMV+V   G+  +  V I++ L  
Sbjct: 8   LSELLSNMGALRE---KMEDVKKRIASIRVVGDAGAGMVTVTATGEGQIINVFINKQLFD 64

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
            D+ ++LEDL++AA +DA KK ++  A + Q  + GL   
Sbjct: 65  SDDNKMLEDLVMAATNDALKKAKEATAYEFQAASGGLDFS 104


>gi|229009534|ref|ZP_04166763.1| hypothetical protein bmyco0001_130 [Bacillus mycoides DSM 2048]
 gi|229053870|ref|ZP_04195307.1| hypothetical protein bcere0026_130 [Bacillus cereus AH603]
 gi|229165013|ref|ZP_04292811.1| hypothetical protein bcere0007_130 [Bacillus cereus AH621]
 gi|228618465|gb|EEK75492.1| hypothetical protein bcere0007_130 [Bacillus cereus AH621]
 gi|228721480|gb|EEL72997.1| hypothetical protein bcere0026_130 [Bacillus cereus AH603]
 gi|228751745|gb|EEM01542.1| hypothetical protein bmyco0001_130 [Bacillus mycoides DSM 2048]
          Length = 109

 Score = 60.5 bits (145), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 31/84 (36%), Positives = 54/84 (64%)

Query: 20  KMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAH 79
           K +E +     EG AGGGMV+V  NG   +  VKI   ++  +++E+L+DL++AA +DA 
Sbjct: 25  KAQEELGEKTVEGTAGGGMVTVIANGHKQVLEVKIKEEVVDPEDIEMLQDLVLAATNDAL 84

Query: 80  KKIEDLVATKTQEITEGLPIPPGL 103
           KK+++L  +   + T+G+ +P G+
Sbjct: 85  KKVDELSNSTMGKFTKGMNLPGGM 108


>gi|229194414|ref|ZP_04321219.1| hypothetical protein bcere0001_120 [Bacillus cereus m1293]
 gi|228589070|gb|EEK47083.1| hypothetical protein bcere0001_120 [Bacillus cereus m1293]
          Length = 108

 Score = 60.1 bits (144), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 31/87 (35%), Positives = 55/87 (63%)

Query: 17  KMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHS 76
           +M K +E +     EG AGGGM++V  NG   +  VK+   ++  +++E+L+DL++AA +
Sbjct: 21  EMAKAQEELGEKTVEGTAGGGMITVIANGHKQILEVKVKEEVVDPEDIEMLQDLVLAATN 80

Query: 77  DAHKKIEDLVATKTQEITEGLPIPPGL 103
           DA KK ++L  +   + T+GL +P G+
Sbjct: 81  DALKKADELSNSTMGKFTKGLNLPGGM 107


>gi|225387324|ref|ZP_03757088.1| hypothetical protein CLOSTASPAR_01076 [Clostridium asparagiforme
           DSM 15981]
 gi|225046573|gb|EEG56819.1| hypothetical protein CLOSTASPAR_01076 [Clostridium asparagiforme
           DSM 15981]
          Length = 118

 Score = 60.1 bits (144), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 65/107 (60%), Gaps = 3/107 (2%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M+N+MK   Q + +Q +ME+  + + + E    +GGG VSV +NGK  +  VK+   ++ 
Sbjct: 15  MNNLMK---QAQRMQRQMEETTKELETKEYTAASGGGAVSVTVNGKKEVVSVKLSEEVVD 71

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            D++E+LEDLI+AA ++A +++E   A    ++T GL    G  FPF
Sbjct: 72  PDDIEMLEDLIVAATNEAFRQMEAESAEAMSKLTGGLGGALGGGFPF 118


>gi|229131031|ref|ZP_04259946.1| hypothetical protein bcere0014_120 [Bacillus cereus BDRD-ST196]
 gi|228652426|gb|EEL08348.1| hypothetical protein bcere0014_120 [Bacillus cereus BDRD-ST196]
          Length = 109

 Score = 60.1 bits (144), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 31/84 (36%), Positives = 54/84 (64%)

Query: 20  KMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAH 79
           K +E +     EG AGGGMV+V  NG   +  VKI   ++  +++E+L+DL++AA +DA 
Sbjct: 25  KAQEELGEKTVEGTAGGGMVTVIANGHKQVLEVKIKEEVVDPEDIEMLQDLVLAAMNDAL 84

Query: 80  KKIEDLVATKTQEITEGLPIPPGL 103
           KK+++L  +   + T+G+ +P G+
Sbjct: 85  KKVDELSNSTMGKFTKGMNLPGGM 108


>gi|160878208|ref|YP_001557176.1| hypothetical protein Cphy_0047 [Clostridium phytofermentans ISDg]
 gi|229554835|sp|A9KQC8|Y047_CLOPH RecName: Full=UPF0133 protein Cphy_0047
 gi|160426874|gb|ABX40437.1| conserved hypothetical protein [Clostridium phytofermentans ISDg]
          Length = 119

 Score = 60.1 bits (144), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 59/94 (62%), Gaps = 3/94 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M+N+MK   Q + +Q +ME   + +   + E  AGGG V+V ++GK  +  VK+ + ++ 
Sbjct: 16  MNNLMK---QAQRMQKQMEDKTKEMEEKQWEATAGGGAVTVTVSGKKEVVSVKLSKEVVD 72

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEIT 94
            D++E+LEDLI+AA ++A +K+E+  A+    I 
Sbjct: 73  PDDIEMLEDLIVAATNEALRKMEEESASAMNSIA 106


>gi|197302302|ref|ZP_03167361.1| hypothetical protein RUMLAC_01029 [Ruminococcus lactaris ATCC
          29176]
 gi|197298733|gb|EDY33274.1| hypothetical protein RUMLAC_01029 [Ruminococcus lactaris ATCC
          29176]
          Length = 117

 Score = 60.1 bits (144), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 31/84 (36%), Positives = 56/84 (66%), Gaps = 3/84 (3%)

Query: 1  MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
          M+N+MK   Q + +Q +ME+ ++ + + E    AGGG V V + GK  +T VK+   ++ 
Sbjct: 16 MANLMK---QAQRMQRQMEEQQKELETKEFTATAGGGAVEVTVTGKREVTKVKLAEEVVD 72

Query: 61 EDNVEILEDLIIAAHSDAHKKIED 84
           D++E+LEDLI+AA ++A +++E+
Sbjct: 73 PDDIEMLEDLIVAATNEALRQVEE 96


>gi|169830251|ref|YP_001716233.1| hypothetical protein Daud_0032 [Candidatus Desulforudis audaxviator
           MP104C]
 gi|169637095|gb|ACA58601.1| conserved hypothetical protein 103 [Candidatus Desulforudis
           audaxviator MP104C]
          Length = 102

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 59/97 (60%)

Query: 4   IMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDN 63
           I KM+ Q +EIQ KM +++E +     E   GGG V V  NG+  +  ++I    +  ++
Sbjct: 3   INKMMKQVQEIQAKMVRLQEELGERTVEATVGGGAVKVVANGRQEVLSIEILPEAIDPED 62

Query: 64  VEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           VE+L+DL++ A ++A ++  ++VA +  ++T GL IP
Sbjct: 63  VEMLQDLVLTAVNEALRQSREMVAGEMSKLTGGLKIP 99


>gi|262370488|ref|ZP_06063814.1| recombinational DNA repair protein [Acinetobacter johnsonii SH046]
 gi|262314830|gb|EEY95871.1| recombinational DNA repair protein [Acinetobacter johnsonii SH046]
          Length = 109

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 61/109 (55%), Gaps = 5/109 (4%)

Query: 3   NIMKMVGQFKEIQGKME----KMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSL 58
           NI  ++ Q + +Q  ME    K KE +   E    AGGG+V V +  +N++  ++I+  L
Sbjct: 2   NINMLMQQAQRMQKDMESNIKKAKEELAQTEVHAEAGGGLVKVTMTCRNVVKRIEINPEL 61

Query: 59  LFEDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           L +D+ +++EDLI AA +DA ++ E +   + +    G  +PPGL   F
Sbjct: 62  L-QDDADMIEDLIAAAMNDAARQAEVITEERMKAANSGAGLPPGLAGLF 109


>gi|227549652|ref|ZP_03979701.1| conserved hypothetical protein [Corynebacterium lipophiloflavum
          DSM 44291]
 gi|227078276|gb|EEI16239.1| conserved hypothetical protein [Corynebacterium lipophiloflavum
          DSM 44291]
          Length = 122

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 54/88 (61%)

Query: 2  SNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFE 61
          +++ +++ Q  E+Q  +++ ++ + S   EG+AGGG+V+V + G   +T + I    +  
Sbjct: 12 NDMQELIRQAAEMQAHLQRAQQELLSTTVEGSAGGGLVTVTMTGGAEITDLSIKPEAVDP 71

Query: 62 DNVEILEDLIIAAHSDAHKKIEDLVATK 89
          ++VE L+DLI+AA+ DAH K   L   K
Sbjct: 72 EDVETLQDLILAAYRDAHTKAGRLAEDK 99


>gi|213018729|ref|ZP_03334537.1| conserved hypothetical protein [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
 gi|212995680|gb|EEB56320.1| conserved hypothetical protein [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
          Length = 104

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 57/102 (55%), Gaps = 4/102 (3%)

Query: 10  QFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRIN----GKNMLTGVKIDRSLLFEDNVE 65
           Q +E+Q K+ + +E     E +G +GGG VS+ +     G      V ID  L+  +  +
Sbjct: 3   QAQEMQKKLAEAQEKYIGKEFQGISGGGKVSILVEVIKIGGYKAKKVNIDLELMRNEEKD 62

Query: 66  ILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           I+EDL+ AA +DA KK E+ +A  T ++   + +PPG K PF
Sbjct: 63  IVEDLVTAAFNDAIKKAEEDMANATSDLAGMMGLPPGFKLPF 104


>gi|293608166|ref|ZP_06690469.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292828739|gb|EFF87101.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|325122104|gb|ADY81627.1| hypothetical protein BDGL_001041 [Acinetobacter calcoaceticus
           PHEA-2]
          Length = 109

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 38/109 (34%), Positives = 62/109 (56%), Gaps = 5/109 (4%)

Query: 3   NIMKMVGQFKEIQGKME----KMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSL 58
           NI  ++ Q + +Q  ME    K KE +   E    AGGG+V V + G+ ++  ++I+  L
Sbjct: 2   NINMLMQQAQRMQKDMESNIKKAKEELAQTEVHAEAGGGLVKVTMTGRYIVKRIEINPEL 61

Query: 59  LFEDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           L +D  +++EDLI AA +DA ++ E +   K Q+   G+ +PPGL   F
Sbjct: 62  L-QDEPDMIEDLIAAAVNDAVRQAEVISEEKMQKANSGMGLPPGLAGMF 109


>gi|197103835|ref|YP_002129212.1| hypothetical protein PHZ_c0369 [Phenylobacterium zucineum HLK1]
 gi|238690163|sp|B4RDT4|Y369_PHEZH RecName: Full=UPF0133 protein PHZ_c0369
 gi|196477255|gb|ACG76783.1| conserved hypothetical protein [Phenylobacterium zucineum HLK1]
          Length = 107

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 59/106 (55%), Gaps = 3/106 (2%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M ++  ++ Q + +Q K+   +  I  +E EG +GGGMV + + G   L  V +D SL+ 
Sbjct: 1   MKDLNSLMKQAQAMQQKLADAQGRIAEMEVEGTSGGGMVKLVLKGTGELARVDLDESLMA 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEIT---EGLPIPPGL 103
               E++ DLI+AAH+DA +K+++  A   +E      G+P  P L
Sbjct: 61  PGEGEVVADLIVAAHADAKRKLDEKQAEVMREAAGPFAGMPGMPKL 106


>gi|297193079|ref|ZP_06910477.1| UPF0133 protein [Streptomyces pristinaespiralis ATCC 25486]
 gi|197719791|gb|EDY63699.1| UPF0133 protein [Streptomyces pristinaespiralis ATCC 25486]
          Length = 113

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 56/103 (54%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           N+ +++ Q +++Q  + K +E +   E EG AGGG+V   + G   L G+ ID   +  +
Sbjct: 11  NMQQLLQQAQKMQQDLAKAQEELAQTEVEGQAGGGLVKATVTGSGELRGLVIDPKAVDPE 70

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKF 105
           + E L DL++AA   A++  + L   K   + +GL   PG+ F
Sbjct: 71  DTETLADLVVAAVQAANENAQQLQQDKLGPLAQGLGGMPGMPF 113


>gi|154497737|ref|ZP_02036115.1| hypothetical protein BACCAP_01713 [Bacteroides capillosus ATCC
           29799]
 gi|150273235|gb|EDN00380.1| hypothetical protein BACCAP_01713 [Bacteroides capillosus ATCC
           29799]
          Length = 114

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 56/91 (61%)

Query: 10  QFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILED 69
           Q +++Q  M+KM+  + + E    AGGG+VS  + GK  L  + ID   +  ++VE+L+D
Sbjct: 23  QAQKMQENMQKMQAELEAKEYSAQAGGGVVSATVTGKRELVSLTIDPEAVDPEDVEMLQD 82

Query: 70  LIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           +I+AA ++A +  E  +A   ++IT GL +P
Sbjct: 83  MIVAAVNEAIRSAETDMADNMRQITGGLNLP 113


>gi|238021244|ref|ZP_04601670.1| hypothetical protein GCWU000324_01142 [Kingella oralis ATCC 51147]
 gi|237868224|gb|EEP69230.1| hypothetical protein GCWU000324_01142 [Kingella oralis ATCC 51147]
          Length = 111

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 54/91 (59%), Gaps = 2/91 (2%)

Query: 10  QFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFE--DNVEIL 67
           Q +++Q  M+K +  +   E EG AG G+V V     +++  + I   L+ E  D+ E+L
Sbjct: 13  QAQKMQENMKKAQAELAQTEVEGQAGNGLVKVTATCSHVVRKISISPDLISEAADDPEML 72

Query: 68  EDLIIAAHSDAHKKIEDLVATKTQEITEGLP 98
           EDLI+AA +DAH+K E   + K  + T+GLP
Sbjct: 73  EDLILAAINDAHEKGEAATSAKMAQFTQGLP 103


>gi|16801911|ref|NP_472179.1| hypothetical protein lin2851 [Listeria innocua Clip11262]
 gi|21264177|sp|Q927D8|Y2851_LISIN RecName: Full=UPF0133 protein lin2851
 gi|16415386|emb|CAC98077.1| lin2851 [Listeria innocua Clip11262]
          Length = 105

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 53/81 (65%)

Query: 20  KMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAH 79
           K +  + + E  G AGGGMV+V+  GK ++T V I+  ++  +++E+L+DL++AA +D  
Sbjct: 23  KAQADLEAQEFTGTAGGGMVTVKAIGKRVITDVVINEEVVDPEDIEMLQDLVLAATNDVL 82

Query: 80  KKIEDLVATKTQEITEGLPIP 100
           K+IED  +    + T+GL +P
Sbjct: 83  KQIEDTTSQTMGKFTQGLNLP 103


>gi|169633535|ref|YP_001707271.1| hypothetical protein ABSDF1914 [Acinetobacter baumannii SDF]
 gi|169796041|ref|YP_001713834.1| hypothetical protein ABAYE1967 [Acinetobacter baumannii AYE]
 gi|184158038|ref|YP_001846377.1| hypothetical protein ACICU_01718 [Acinetobacter baumannii ACICU]
 gi|213157225|ref|YP_002319270.1| hypothetical protein AB57_1909 [Acinetobacter baumannii AB0057]
 gi|215483499|ref|YP_002325716.1| hypothetical protein ABBFA_001813 [Acinetobacter baumannii
           AB307-0294]
 gi|239501843|ref|ZP_04661153.1| hypothetical protein AbauAB_05970 [Acinetobacter baumannii AB900]
 gi|260555083|ref|ZP_05827304.1| UPF0133 protein [Acinetobacter baumannii ATCC 19606]
 gi|301345595|ref|ZP_07226336.1| hypothetical protein AbauAB0_05108 [Acinetobacter baumannii AB056]
 gi|301510306|ref|ZP_07235543.1| hypothetical protein AbauAB05_01984 [Acinetobacter baumannii AB058]
 gi|301597270|ref|ZP_07242278.1| hypothetical protein AbauAB059_15671 [Acinetobacter baumannii
           AB059]
 gi|332851691|ref|ZP_08433616.1| DNA-binding protein, YbaB/EbfC family [Acinetobacter baumannii
           6013150]
 gi|332865934|ref|ZP_08436714.1| DNA-binding protein, YbaB/EbfC family [Acinetobacter baumannii
           6013113]
 gi|332874498|ref|ZP_08442401.1| DNA-binding protein, YbaB/EbfC family [Acinetobacter baumannii
           6014059]
 gi|226695979|sp|B7H3B8|Y1813_ACIB3 RecName: Full=UPF0133 protein ABBFA_001813
 gi|226732153|sp|B7I5V5|Y1909_ACIB5 RecName: Full=UPF0133 protein AB57_1909
 gi|238685515|sp|A3M5B7|Y1684_ACIBT RecName: Full=UPF0133 protein A1S_1684
 gi|238688103|sp|B0VDW7|Y1967_ACIBY RecName: Full=UPF0133 protein ABAYE1967
 gi|238688148|sp|B0VPL6|Y1914_ACIBS RecName: Full=UPF0133 protein ABSDF1914
 gi|238691011|sp|B2I0A5|Y1718_ACIBC RecName: Full=UPF0133 protein ACICU_01718
 gi|169148968|emb|CAM86845.1| conserved hypothetical protein [Acinetobacter baumannii AYE]
 gi|169152327|emb|CAP01249.1| conserved hypothetical protein [Acinetobacter baumannii]
 gi|183209632|gb|ACC57030.1| uncharacterized protein conserved in bacteria [Acinetobacter
           baumannii ACICU]
 gi|193077318|gb|ABO12111.2| hypothetical protein A1S_1684 [Acinetobacter baumannii ATCC 17978]
 gi|213056385|gb|ACJ41287.1| conserved hypothetical protein [Acinetobacter baumannii AB0057]
 gi|213987505|gb|ACJ57804.1| conserved hypothetical protein [Acinetobacter baumannii AB307-0294]
 gi|260411625|gb|EEX04922.1| UPF0133 protein [Acinetobacter baumannii ATCC 19606]
 gi|322508357|gb|ADX03811.1| Putative uncharacterized protein [Acinetobacter baumannii 1656-2]
 gi|323517979|gb|ADX92360.1| hypothetical protein ABTW07_1931 [Acinetobacter baumannii
           TCDC-AB0715]
 gi|332729698|gb|EGJ61033.1| DNA-binding protein, YbaB/EbfC family [Acinetobacter baumannii
           6013150]
 gi|332734984|gb|EGJ66070.1| DNA-binding protein, YbaB/EbfC family [Acinetobacter baumannii
           6013113]
 gi|332737342|gb|EGJ68266.1| DNA-binding protein, YbaB/EbfC family [Acinetobacter baumannii
           6014059]
          Length = 109

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 38/109 (34%), Positives = 62/109 (56%), Gaps = 5/109 (4%)

Query: 3   NIMKMVGQFKEIQGKME----KMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSL 58
           NI  ++ Q + +Q  ME    K KE +   E    AGGG+V V + G+ ++  ++I+  L
Sbjct: 2   NINMLMQQAQRMQKDMESNIKKAKEELAQTEVHAEAGGGLVKVTMTGRYIVKRIEINPEL 61

Query: 59  LFEDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           L +D  +++EDLI AA +DA ++ E +   K Q+   G+ +PPGL   F
Sbjct: 62  L-QDEPDMIEDLIAAAVNDAVRQAEVVSEEKMQKANSGMGLPPGLAGMF 109


>gi|167759645|ref|ZP_02431772.1| hypothetical protein CLOSCI_02003 [Clostridium scindens ATCC 35704]
 gi|167662771|gb|EDS06901.1| hypothetical protein CLOSCI_02003 [Clostridium scindens ATCC 35704]
          Length = 119

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 37/104 (35%), Positives = 64/104 (61%), Gaps = 4/104 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M+N+MK   Q +++Q +ME+  + + + E    AGGG V V ++G   +  VK+D   + 
Sbjct: 18  MANLMK---QAQKMQRQMEEQAKEMETKEFTATAGGGAVEVTVSGTKKVLKVKLDEEAVD 74

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP-PGL 103
            D+VE+LEDLI+AA ++A  K++++ A+   + T G+    PGL
Sbjct: 75  PDDVEMLEDLIVAAVNEAMDKVDEVSASAMSKFTGGMGGQMPGL 118


>gi|260554176|ref|ZP_05826434.1| UPF0133 protein [Acinetobacter sp. RUH2624]
 gi|260404682|gb|EEW98194.1| UPF0133 protein [Acinetobacter sp. RUH2624]
          Length = 109

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 38/109 (34%), Positives = 62/109 (56%), Gaps = 5/109 (4%)

Query: 3   NIMKMVGQFKEIQGKME----KMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSL 58
           NI  ++ Q + +Q  ME    K KE +   E    AGGG+V V + G+ ++  ++I+  L
Sbjct: 2   NINMLMQQAQRMQKDMESNIKKAKEELAQTEVNAEAGGGLVKVTMTGRYIVKRIEINPEL 61

Query: 59  LFEDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           L +D  +++EDLI AA +DA ++ E +   K Q+   G+ +PPGL   F
Sbjct: 62  L-QDEPDMIEDLIAAAVNDAVRQAEVVSEEKMQKANSGMGLPPGLAGMF 109


>gi|325283368|ref|YP_004255909.1| hypothetical protein Deipr_1140 [Deinococcus proteolyticus MRP]
 gi|324315177|gb|ADY26292.1| UPF0133 protein ybaB [Deinococcus proteolyticus MRP]
          Length = 96

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 35/98 (35%), Positives = 57/98 (58%), Gaps = 5/98 (5%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           ++ +++ Q ++ Q    +++E + +   EG A G +V V +NG   +  +KID   +  D
Sbjct: 2   DMKRLMKQMQQAQSAANRIQEDLAAKTVEGTASG-LVRVTMNGHGKVQSLKIDPQAVDGD 60

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           +VE LEDLI+AA  DA  +++DL     QE T GL IP
Sbjct: 61  DVEALEDLILAAIQDAAGQVDDL----QQEATRGLSIP 94


>gi|312134984|ref|YP_004002322.1| hypothetical protein Calow_0956 [Caldicellulosiruptor owensensis
           OL]
 gi|311775035|gb|ADQ04522.1| Uncharacterized protein family UPF0133 [Caldicellulosiruptor
           owensensis OL]
          Length = 113

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 34/98 (34%), Positives = 64/98 (65%), Gaps = 1/98 (1%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           NI ++  Q K++Q ++EK++E +   E E ++GGG V V INGK  +  ++I   ++  +
Sbjct: 14  NINQLQKQAKKMQEEIEKLQEELNQKEIEVSSGGGAVKVIINGKKEVKSIQILPEVVDPE 73

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           ++E L+DLI+A  ++A +K++ +V  + Q++T G  IP
Sbjct: 74  DIETLQDLIVACVNEAIRKVDKMVEEEMQKVT-GFGIP 110


>gi|197116611|ref|YP_002137038.1| hypothetical protein Gbem_0211 [Geobacter bemidjiensis Bem]
 gi|197085971|gb|ACH37242.1| protein of unknown function DUF149 [Geobacter bemidjiensis Bem]
          Length = 104

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 62/100 (62%), Gaps = 3/100 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           ++ IMK   Q + +Q KM K++E   +  AE   GGG V+V +NGKN +  + I +  + 
Sbjct: 5   LAQIMK---QAQMMQQKMGKLQEEAAAKTAEVATGGGAVTVVVNGKNQVLSLVIKKEAVD 61

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
            ++VE+L+DL++ A ++A KK+   ++ +  +IT GL IP
Sbjct: 62  PEDVEMLQDLVLTAVNEALKKVHTEMSEEMSKITGGLSIP 101


>gi|289422934|ref|ZP_06424757.1| DNA-binding protein, YbaB/EbfC family [Peptostreptococcus
           anaerobius 653-L]
 gi|289156657|gb|EFD05299.1| DNA-binding protein, YbaB/EbfC family [Peptostreptococcus
           anaerobius 653-L]
          Length = 114

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 60/94 (63%)

Query: 7   MVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEI 66
           ++ Q +++Q  M++ +E + + E E + GGG V V++ GK  LT + I   ++  D++E+
Sbjct: 20  LLKQAQKMQEDMQRQQEELEAKEVEASVGGGAVVVKMTGKRELTSITIKPEVVDPDDIEM 79

Query: 67  LEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           LEDL+I+A +   + IE++  ++  ++T G+ +P
Sbjct: 80  LEDLVISAVNQVLRDIEEMQKSQMSKLTGGMNLP 113


>gi|225374829|ref|ZP_03752050.1| hypothetical protein ROSEINA2194_00450 [Roseburia inulinivorans DSM
           16841]
 gi|225213398|gb|EEG95752.1| hypothetical protein ROSEINA2194_00450 [Roseburia inulinivorans DSM
           16841]
          Length = 116

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 61/94 (64%), Gaps = 3/94 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M+N+MK   Q + +Q +ME+ ++ +   E    AGGG V V ++GK+ +T +K+   ++ 
Sbjct: 15  MNNLMK---QAQRMQRQMEEAQKELEEKEVTATAGGGAVEVTVSGKHEVTKIKLSEEVVD 71

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEIT 94
            D++E+LEDLI+AA ++A +K+++   +   +IT
Sbjct: 72  PDDIEMLEDLIMAATNEAFRKLDEESQSSMAKIT 105


>gi|124006388|ref|ZP_01691222.1| conserved hypothetical protein [Microscilla marina ATCC 23134]
 gi|123988045|gb|EAY27716.1| conserved hypothetical protein [Microscilla marina ATCC 23134]
          Length = 110

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 67/106 (63%), Gaps = 1/106 (0%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M ++  ++G+ KE+Q KM+++++S+  ++    +G GMV   +NGK  +  +++D+ L+ 
Sbjct: 1   MFDLNNLMGKVKEMQDKMKEVQDSLAQVKVTAESGAGMVKATVNGKRQVISIEVDKDLVK 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEG-LPIPPGLKF 105
            ++ ++++DLI+AA + A ++ + +   + Q+ T+G +P  PG   
Sbjct: 61  PEDQDMMQDLIVAAINKALEEADVVAKEEMQKATQGVMPNIPGFDL 106


>gi|254419077|ref|ZP_05032801.1| conserved hypothetical protein TIGR00103 [Brevundimonas sp. BAL3]
 gi|196185254|gb|EDX80230.1| conserved hypothetical protein TIGR00103 [Brevundimonas sp. BAL3]
          Length = 109

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/66 (46%), Positives = 46/66 (69%), Gaps = 4/66 (6%)

Query: 20 KMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAH 79
          KM E+     AEG++GGG+V+V + G   +T +KID SLL     EIL DLI+AAH+DA 
Sbjct: 24 KMAET----SAEGSSGGGLVTVALKGAGEITAIKIDDSLLSPGEGEILADLIVAAHADAK 79

Query: 80 KKIEDL 85
          +K++++
Sbjct: 80 RKLDEV 85


>gi|218132673|ref|ZP_03461477.1| hypothetical protein BACPEC_00533 [Bacteroides pectinophilus ATCC
           43243]
 gi|217992399|gb|EEC58402.1| hypothetical protein BACPEC_00533 [Bacteroides pectinophilus ATCC
           43243]
          Length = 118

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 38/107 (35%), Positives = 66/107 (61%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M+N+MK   Q + +Q +ME+  + + S E   +AGGG V V ++GK  +  VK+   ++ 
Sbjct: 16  MNNLMK---QAQRMQRQMEETTKELESKEFTASAGGGAVEVTVSGKKEVLSVKLSEEVVD 72

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            D++E+L+DLI+AA ++A +K+E+   ++  +IT G     G  FPF
Sbjct: 73  PDDIEMLQDLIVAATNEALRKMEEESQSQMSKIT-GGLGGMGGGFPF 118


>gi|330813512|ref|YP_004357751.1| hypothetical protein SAR11G3_00537 [Candidatus Pelagibacter sp.
           IMCC9063]
 gi|327486607|gb|AEA81012.1| hypothetical protein SAR11G3_00537 [Candidatus Pelagibacter sp.
           IMCC9063]
          Length = 105

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 63/102 (61%), Gaps = 1/102 (0%)

Query: 6   KMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVE 65
           KM+ Q +E+Q KM   KES+ ++  EG +GGG V V +NG   +  ++ID  +L E+   
Sbjct: 5   KMLEQAQEMQKKMADAKESLKNISVEGESGGGGVKVILNGNGEMISIQIDPKILAEEK-S 63

Query: 66  ILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ++EDLI+AA ++A K +E     +  ++T GL +P G K PF
Sbjct: 64  VIEDLIVAATNNAKKNVESKTQEEMSKLTGGLQLPAGFKLPF 105


>gi|189219683|ref|YP_001940324.1| hypothetical protein Minf_1672 [Methylacidiphilum infernorum V4]
 gi|226736406|sp|B3DWR3|Y1672_METI4 RecName: Full=UPF0133 protein Minf_1672
 gi|189186541|gb|ACD83726.1| Uncharacterized conserved protein [Methylacidiphilum infernorum V4]
          Length = 102

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 33/98 (33%), Positives = 60/98 (61%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           NI K++ Q +++Q + +K++E + SL  EG +GGG V   +NG+  L  + +D +LL   
Sbjct: 2   NINKLLKQAQKLQEEAKKIQEQMASLSFEGESGGGKVKATVNGEGFLLKMHVDPTLLEAK 61

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           + E++EDLI+ A   A +K ++   ++ Q++   L IP
Sbjct: 62  DNEMIEDLIVVAVQAAQEKAKEASQSQFQKLGGNLGIP 99


>gi|254456199|ref|ZP_05069628.1| conserved hypothetical protein TIGR00103 [Candidatus Pelagibacter
           sp. HTCC7211]
 gi|207083201|gb|EDZ60627.1| conserved hypothetical protein TIGR00103 [Candidatus Pelagibacter
           sp. HTCC7211]
          Length = 105

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 64/107 (59%), Gaps = 2/107 (1%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M++  K++ + KE++ KM++ +E I  ++AEG +G   V + ++G+  +  +++   ++ 
Sbjct: 1   MTDFTKILDKAKELEAKMKESQEKIKEIKAEGVSGSNSVKITLDGEGEMQKIELSDEIIK 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED   I+EDLI+AAH+ A  +++     +  + T G  I PG K+P 
Sbjct: 61  EDKA-IIEDLIVAAHNSAKSQLKTKTTEEISKATGGFGI-PGFKWPL 105


>gi|262372598|ref|ZP_06065877.1| conserved hypothetical protein [Acinetobacter junii SH205]
 gi|262312623|gb|EEY93708.1| conserved hypothetical protein [Acinetobacter junii SH205]
          Length = 109

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 37/109 (33%), Positives = 60/109 (55%), Gaps = 5/109 (4%)

Query: 3   NIMKMVGQFKEIQGKME----KMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSL 58
           NI  ++ Q + +Q  ME    K KE +   E    AGGG+V V +  ++++  ++I   L
Sbjct: 2   NINMLMQQAQRMQKDMETNLKKAKEELAKTEVHAEAGGGLVKVTMTCRHVVKRIEISPDL 61

Query: 59  LFEDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           L +D  +++EDLI AA +DA ++ E +   K Q    G+ +PPGL   F
Sbjct: 62  L-QDEADMIEDLIAAAMNDAARQAEAISEEKLQGANSGMGLPPGLSGLF 109


>gi|153813526|ref|ZP_01966194.1| hypothetical protein RUMOBE_03948 [Ruminococcus obeum ATCC 29174]
 gi|149830397|gb|EDM85489.1| hypothetical protein RUMOBE_03948 [Ruminococcus obeum ATCC 29174]
          Length = 118

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 58/84 (69%), Gaps = 3/84 (3%)

Query: 1  MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
          M+N+MK   Q +++Q +ME+ ++++   E    AGGG V V ++GK  +T VK+   ++ 
Sbjct: 16 MNNLMK---QAQKMQRQMEENQKALEEKEFTAAAGGGAVEVTVSGKREVTKVKLAEEVVD 72

Query: 61 EDNVEILEDLIIAAHSDAHKKIED 84
           D++E+LEDLI+AA ++A +K+E+
Sbjct: 73 PDDIEMLEDLIVAATNEALRKVEE 96


>gi|258513457|ref|YP_003189679.1| hypothetical protein Dtox_0093 [Desulfotomaculum acetoxidans DSM
           771]
 gi|257777162|gb|ACV61056.1| conserved hypothetical protein [Desulfotomaculum acetoxidans DSM
           771]
          Length = 104

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 34/98 (34%), Positives = 60/98 (61%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           N+ KM+ Q +++Q  M KM+E + +      AGGG V V +NGK  +  ++I    +  +
Sbjct: 4   NMNKMMKQVQKMQADMLKMQEELANRTVVSTAGGGAVKVTVNGKQEILAIEIKPEAVDPE 63

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           +VE+L+DLI+AA ++  K  +++V  +  ++T GL IP
Sbjct: 64  DVEMLQDLILAAVNEGIKNSQEMVNKEMGKLTGGLNIP 101


>gi|166033191|ref|ZP_02236020.1| hypothetical protein DORFOR_02913 [Dorea formicigenerans ATCC
           27755]
 gi|166027548|gb|EDR46305.1| hypothetical protein DORFOR_02913 [Dorea formicigenerans ATCC
           27755]
          Length = 113

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 60/97 (61%), Gaps = 3/97 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M+N+MK   Q +++Q +ME+  + + + E    AGGG V V ++G   L  VK+D  ++ 
Sbjct: 16  MANLMK---QAQKMQRQMEEQAKEMETKEFTATAGGGAVEVTVSGSKKLVKVKLDEEVVD 72

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGL 97
            D+VE+LEDL++AA ++A  K+++  A    + T G+
Sbjct: 73  PDDVEMLEDLLVAAVNEALDKVDEASAASMSKFTGGM 109


>gi|260437833|ref|ZP_05791649.1| putative cytoplasmic protein [Butyrivibrio crossotus DSM 2876]
 gi|292809858|gb|EFF69063.1| putative cytoplasmic protein [Butyrivibrio crossotus DSM 2876]
          Length = 115

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 65/107 (60%), Gaps = 7/107 (6%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M+N+MK   Q + +Q +ME+ ++ +   E    AGGG V V I+GK  +T VK+   ++ 
Sbjct: 16  MNNLMK---QAQRMQKQMEEQQKELEEKEFTAAAGGGAVEVTISGKKEVTKVKLQPEVVD 72

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            D++E+LEDLI+AA ++A +++ED       +IT GL    G  FPF
Sbjct: 73  PDDIEMLEDLIMAATNEAIRQVEDYSQESMAKITGGL----GGGFPF 115


>gi|332971095|gb|EGK10063.1| hypothetical protein HMPREF9374_2654 [Desmospora sp. 8437]
          Length = 103

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/78 (39%), Positives = 50/78 (64%)

Query: 23  ESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKKI 82
           E +   E EG AGGG+V V +NG   +  V+ID   +  ++VE+L+D++ AA ++A K +
Sbjct: 23  EELADKEVEGTAGGGVVKVVMNGHKQVLSVEIDPEAVDPEDVEMLQDMVTAAFNEAMKNV 82

Query: 83  EDLVATKTQEITEGLPIP 100
           +DLV+    ++T GL IP
Sbjct: 83  DDLVSKDLGKLTGGLNIP 100


>gi|312142720|ref|YP_003994166.1| Uncharacterized protein family UPF0133 [Halanaerobium sp.
           'sapolanicus']
 gi|311903371|gb|ADQ13812.1| Uncharacterized protein family UPF0133 [Halanaerobium sp.
           'sapolanicus']
          Length = 102

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 36/95 (37%), Positives = 62/95 (65%)

Query: 6   KMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVE 65
           K++ Q +++Q KM KM+E +     E  AGGG V V +NGK  L  ++ID   +  D+VE
Sbjct: 5   KLMKQAQQMQTKMAKMQEELEEKTLESTAGGGAVKVVVNGKQELVDLQIDPDAVDPDDVE 64

Query: 66  ILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           +LEDLI+AA + A ++++++V  +  ++T G+ +P
Sbjct: 65  MLEDLILAAVNQAMREMQEMVNEEMGKVTGGMNLP 99


>gi|229083336|ref|ZP_04215696.1| hypothetical protein bcere0022_200 [Bacillus cereus Rock3-44]
 gi|228699983|gb|EEL52608.1| hypothetical protein bcere0022_200 [Bacillus cereus Rock3-44]
          Length = 108

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 52/84 (61%)

Query: 20  KMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAH 79
           K +E +     EG AGGGMV V  NG   +  VKI   ++  +++E+L+DL++AA +DA 
Sbjct: 24  KAQEELGDKTVEGTAGGGMVIVIANGHKQIIDVKIKEEVVDPEDIEMLQDLVLAATNDAL 83

Query: 80  KKIEDLVATKTQEITEGLPIPPGL 103
           K+ E+L  +   + T+GL +P G+
Sbjct: 84  KQAEELSNSTMGQFTKGLNLPGGM 107


>gi|149924602|ref|ZP_01912957.1| hypothetical protein PPSIR1_33029 [Plesiocystis pacifica SIR-1]
 gi|149814527|gb|EDM74112.1| hypothetical protein PPSIR1_33029 [Plesiocystis pacifica SIR-1]
          Length = 107

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 39/103 (37%), Positives = 63/103 (61%), Gaps = 9/103 (8%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           +S +M+   Q +E   +ME +++ +     EG+AGGGMV V + G   + GVKID ++  
Sbjct: 6   LSQLMQQAQQMRE---RMEYLQKGLADQRVEGSAGGGMVKVEMTGTQQVLGVKIDPAVRD 62

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGL 103
           ED +E+L+DLI+AA + A +K + L     QE + G  +PPG+
Sbjct: 63  ED-LEMLQDLIVAATNSAIEKSKAL----AQE-SLGSMLPPGM 99


>gi|30316314|sp|Q8KE85|Y805_CHLTE RecName: Full=UPF0133 protein CT0805
          Length = 111

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 34/107 (31%), Positives = 61/107 (57%), Gaps = 2/107 (1%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N   M+ Q +E   KM+ +++ +  L +EG AGGGMV  ++NG+  L  + ID  ++ 
Sbjct: 3   MPNFGDMMKQLQEAGAKMQDLQKQLEKLVSEGEAGGGMVRAKVNGRQKLLELTIDPEIM- 61

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            D+V++++DL++AA + A +    L  ++ Q+   G+  P  L   F
Sbjct: 62  -DDVDMVQDLVVAAVNKALEASAQLAQSEIQKAAGGMINPADLMKQF 107


>gi|134297922|ref|YP_001111418.1| hypothetical protein Dred_0043 [Desulfotomaculum reducens MI-1]
 gi|189030261|sp|A4J0J0|Y043_DESRM RecName: Full=UPF0133 protein Dred_0043
 gi|134050622|gb|ABO48593.1| conserved hypothetical protein 103 [Desulfotomaculum reducens MI-1]
          Length = 105

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 57/91 (62%)

Query: 10  QFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILED 69
           Q +++Q  M KM+E + +   E  AGGG+V V  +GK  +  + I    +  D+VE+L+D
Sbjct: 12  QVQKMQQDMAKMQEELGNRTVETTAGGGVVKVVASGKQEIISITIKPEAVDPDDVEMLQD 71

Query: 70  LIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           L+I A +DA ++ +++VA +  ++T GL IP
Sbjct: 72  LLITAVNDALRQSQEMVAKEMGKLTGGLNIP 102


>gi|329890900|ref|ZP_08269243.1| hypothetical protein BDIM_26090 [Brevundimonas diminuta ATCC
          11568]
 gi|328846201|gb|EGF95765.1| hypothetical protein BDIM_26090 [Brevundimonas diminuta ATCC
          11568]
          Length = 109

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 31/66 (46%), Positives = 45/66 (68%), Gaps = 4/66 (6%)

Query: 20 KMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAH 79
          KM ES     AEG +GGG+V++ + G   +T VKID SL+     EIL DLI+AAH+DA 
Sbjct: 24 KMAEST----AEGTSGGGLVTIALKGPGEITSVKIDDSLMAPGEGEILADLIVAAHADAK 79

Query: 80 KKIEDL 85
          +K++++
Sbjct: 80 RKLDEI 85


>gi|126641729|ref|YP_001084713.1| hypothetical protein A1S_1684 [Acinetobacter baumannii ATCC 17978]
          Length = 97

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 58/96 (60%), Gaps = 1/96 (1%)

Query: 12  KEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLI 71
           K+++  ++K KE +   E    AGGG+V V + G+ ++  ++I+  LL +D  +++EDLI
Sbjct: 3   KDMESNIKKAKEELAQTEVHAEAGGGLVKVTMTGRYIVKRIEINPELL-QDEPDMIEDLI 61

Query: 72  IAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            AA +DA ++ E +   K Q+   G+ +PPGL   F
Sbjct: 62  AAAVNDAVRQAEVVSEEKMQKANSGMGLPPGLAGMF 97


>gi|291548743|emb|CBL25005.1| conserved hypothetical protein TIGR00103 [Ruminococcus torques
          L2-14]
          Length = 117

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 57/83 (68%), Gaps = 3/83 (3%)

Query: 1  MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
          M+N+MK   Q +++Q +ME+ ++ + + E    AGGG V V ++GK  +T VK+   ++ 
Sbjct: 16 MANLMK---QAQKMQRQMEEQQKELETKEFTAAAGGGAVEVTVSGKREVTKVKLAEEVVD 72

Query: 61 EDNVEILEDLIIAAHSDAHKKIE 83
           D++E+LEDLI+AA ++A +++E
Sbjct: 73 PDDIEMLEDLIVAATNEALRQVE 95


>gi|258650920|ref|YP_003200076.1| hypothetical protein Namu_0672 [Nakamurella multipartita DSM
          44233]
 gi|258554145|gb|ACV77087.1| conserved hypothetical protein [Nakamurella multipartita DSM
          44233]
          Length = 191

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 52/86 (60%)

Query: 1  MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
          M +  +++ Q +++Q +ME+ + S++  E  G AGGG+V+  + G   L  + ID S++ 
Sbjct: 5  MPDFSQILIQAQQMQAEMERAQASLSEQEVTGTAGGGLVTAVLTGGGDLVRLSIDPSVVD 64

Query: 61 EDNVEILEDLIIAAHSDAHKKIEDLV 86
             VE LEDLI+AA  DA +  +D+ 
Sbjct: 65 PAEVETLEDLIVAAVHDARRAAQDIA 90


>gi|21673634|ref|NP_661699.1| hypothetical protein CT0805 [Chlorobium tepidum TLS]
 gi|21646750|gb|AAM72041.1| conserved hypothetical protein [Chlorobium tepidum TLS]
          Length = 121

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 34/107 (31%), Positives = 61/107 (57%), Gaps = 2/107 (1%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N   M+ Q +E   KM+ +++ +  L +EG AGGGMV  ++NG+  L  + ID  ++ 
Sbjct: 13  MPNFGDMMKQLQEAGAKMQDLQKQLEKLVSEGEAGGGMVRAKVNGRQKLLELTIDPEIM- 71

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            D+V++++DL++AA + A +    L  ++ Q+   G+  P  L   F
Sbjct: 72  -DDVDMVQDLVVAAVNKALEASAQLAQSEIQKAAGGMINPADLMKQF 117


>gi|43322|emb|CAA28176.1| unnamed protein product [Escherichia coli]
          Length = 75

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 35/73 (47%), Positives = 49/73 (67%), Gaps = 4/73 (5%)

Query: 1  MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
          + N+MK   Q +++Q KM+KM+E I  LE  G +G G+V V ING +    V+ID SLL 
Sbjct: 7  LGNLMK---QAQQMQEKMQKMQEEIAQLEVTGESGAGLVKVTINGAHNCRRVEIDPSLL- 62

Query: 61 EDNVEILEDLIIA 73
          ED+ E+LEDL+ A
Sbjct: 63 EDDKEMLEDLVAA 75


>gi|315305098|ref|ZP_07875120.1| hypothetical protein NT05LI_3322 [Listeria ivanovii FSL F6-596]
 gi|313626531|gb|EFR95642.1| hypothetical protein NT05LI_3322 [Listeria ivanovii FSL F6-596]
          Length = 105

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/72 (38%), Positives = 48/72 (66%)

Query: 29  EAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKKIEDLVAT 88
           E  G AGGGMV+V+  GK  +T + I+  ++  +++E+L+DL++AA +D  K+IED  + 
Sbjct: 32  EFTGTAGGGMVTVKATGKRAITDIVINEEVVDPEDIEMLQDLVLAATNDVLKQIEDTTSQ 91

Query: 89  KTQEITEGLPIP 100
              + T+GL +P
Sbjct: 92  TMGKFTQGLNLP 103


>gi|229170873|ref|ZP_04298478.1| hypothetical protein bcere0006_130 [Bacillus cereus MM3]
 gi|228612608|gb|EEK69825.1| hypothetical protein bcere0006_130 [Bacillus cereus MM3]
          Length = 109

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 31/84 (36%), Positives = 53/84 (63%)

Query: 20  KMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAH 79
           K +E +     EG AGGGMV+V  NG   +  VK+   ++  +++E+L+DL++AA +DA 
Sbjct: 25  KAQEELGEKTVEGTAGGGMVTVIANGHKQILEVKVKEEVVDPEDIEMLQDLVLAATNDAL 84

Query: 80  KKIEDLVATKTQEITEGLPIPPGL 103
           KK ++L  +   + T+GL +P G+
Sbjct: 85  KKADELSNSTMGKFTKGLNLPGGM 108


>gi|189423437|ref|YP_001950614.1| hypothetical protein Glov_0366 [Geobacter lovleyi SZ]
 gi|189419696|gb|ACD94094.1| conserved hypothetical protein [Geobacter lovleyi SZ]
          Length = 104

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 64/100 (64%), Gaps = 3/100 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           ++ IMK   Q + IQ KM K++E     EAE  AGGG V+V +NGKN +  + I    + 
Sbjct: 5   LAGIMK---QAQMIQQKMAKLQEEAALKEAEATAGGGAVTVVVNGKNEIKALTIKPEAVD 61

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
            ++VE+L+DLIIAA ++A KK+ + ++ +  +IT G+ IP
Sbjct: 62  PNDVEMLQDLIIAAANEALKKVHEELSAEMSKITGGMSIP 101


>gi|297616248|ref|YP_003701407.1| hypothetical protein Slip_0035 [Syntrophothermus lipocalidus DSM
           12680]
 gi|297144085|gb|ADI00842.1| conserved hypothetical protein [Syntrophothermus lipocalidus DSM
           12680]
          Length = 107

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 31/98 (31%), Positives = 59/98 (60%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           N+ KM+ Q +++Q +M K++E +     E +AGGG V V + G   L  + I   ++  D
Sbjct: 8   NLNKMMKQAQKMQQEMMKLQEELKERTVEASAGGGAVKVTVTGSQELVSISIAPEVVDPD 67

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           +VE+L+DL++AA ++   K  ++  ++  +IT G+ +P
Sbjct: 68  DVEMLQDLVLAAVNEGLNKAREMAKSEMAKITGGVTLP 105


>gi|126739560|ref|ZP_01755252.1| hypothetical protein RSK20926_04872 [Roseobacter sp. SK209-2-6]
 gi|126719206|gb|EBA15916.1| hypothetical protein RSK20926_04872 [Roseobacter sp. SK209-2-6]
          Length = 114

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/107 (33%), Positives = 62/107 (57%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           + ++ KM+   +E+Q KM +M+E + ++   G AG G+V    + K  L G+ ID S+  
Sbjct: 8   LGDMAKMMKSAQELQTKMAEMQEELHNVMVTGEAGAGLVKATASAKGDLKGLDIDPSIFN 67

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            D+ E++EDLI+AA  DA  K  +    +  ++TE + +P  +K PF
Sbjct: 68  GDDKEVVEDLILAAIKDAQAKAAEKAKDEMTKLTESMGLPKDIKLPF 114


>gi|310639622|ref|YP_003944380.1| transcriptional regulatory protein [Paenibacillus polymyxa SC2]
 gi|309244572|gb|ADO54139.1| Transcriptional regulatory protein [Paenibacillus polymyxa SC2]
          Length = 103

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 61/100 (61%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M+N+ +M+ Q K++Q +M K +E +     EG++GGG+V+V ++G   +  + I    + 
Sbjct: 1   MNNMNQMMKQVKKMQEQMLKAQEELGGKVIEGSSGGGVVTVEVSGHKKVLSITIKPEAVD 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
            D+VE+L+DL++ A +DA  K ++L      + T G+ IP
Sbjct: 61  PDDVEMLQDLVLTAVNDALSKADELANDDMGKFTGGMKIP 100


>gi|94676884|ref|YP_588587.1| hypothetical protein BCI_0116 [Baumannia cicadellinicola str. Hc
           (Homalodisca coagulata)]
 gi|166977721|sp|Q1LTX7|Y116_BAUCH RecName: Full=UPF0133 protein BCI_0116
 gi|94220034|gb|ABF14193.1| conserved hypothetical protein TIGR00103 [Baumannia cicadellinicola
           str. Hc (Homalodisca coagulata)]
          Length = 112

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 50/85 (58%), Gaps = 3/85 (3%)

Query: 25  ITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKKIED 84
           I  LE  G +G G+V V ING      V+ID SLL +D+ ++LEDLI AA +DA ++I +
Sbjct: 28  IAKLEVNGESGAGLVKVTINGVYHCRRVEIDSSLL-QDDKDMLEDLITAAFNDAVRRITE 86

Query: 85  LVATKTQEITEGLPIPPGLKF--PF 107
           +   K   ++  L +P G  +  PF
Sbjct: 87  IKKDKMTSLSSSLQMPLGFNWNMPF 111


>gi|328956231|ref|YP_004373564.1| Uncharacterized protein family UPF0133 [Coriobacterium glomerans
           PW2]
 gi|328456555|gb|AEB07749.1| Uncharacterized protein family UPF0133 [Coriobacterium glomerans
           PW2]
          Length = 103

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 61/103 (59%), Gaps = 1/103 (0%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           ++ +M+ Q +++Q ++   +E +     + +AGGG V V +NG+  LT + ID   L  +
Sbjct: 2   DMQQMMKQARKMQEQLAAAQEDLAQTTVDASAGGGTVKVTVNGEMELTSLTIDPEALDPE 61

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKF 105
           + E+L+D+IIAA ++A + I D+   +   I  GL + PGL F
Sbjct: 62  DAELLQDMIIAAVNEALRGINDIANKQMGGIAGGLNM-PGLPF 103


>gi|254393635|ref|ZP_05008764.1| conserved hypothetical protein [Streptomyces clavuligerus ATCC
           27064]
 gi|294813447|ref|ZP_06772090.1| DUF149 domain-containing protein [Streptomyces clavuligerus ATCC
           27064]
 gi|197707251|gb|EDY53063.1| conserved hypothetical protein [Streptomyces clavuligerus ATCC
           27064]
 gi|294326046|gb|EFG07689.1| DUF149 domain-containing protein [Streptomyces clavuligerus ATCC
           27064]
          Length = 113

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 56/103 (54%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           N+ +++ Q +++Q  + + +E +   E EG AGGG+V+  + G   L  + ID   +  +
Sbjct: 11  NMQQLLQQAQKMQQDLARAQEELARTEVEGQAGGGLVTATVTGSGELRALVIDPRAVDPE 70

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKF 105
           + E L DL++AA   A++  + L   K   + +GL   PGL F
Sbjct: 71  DTETLADLVVAAVQAANENAQQLQQNKLGPLAQGLGGMPGLPF 113


>gi|30018296|ref|NP_829927.1| hypothetical protein BC0025 [Bacillus cereus ATCC 14579]
 gi|206972674|ref|ZP_03233614.1| conserved hypothetical protein TIGR00103 [Bacillus cereus AH1134]
 gi|218235146|ref|YP_002364874.1| hypothetical protein BCB4264_A0025 [Bacillus cereus B4264]
 gi|218895160|ref|YP_002443571.1| hypothetical protein BCG9842_B5293 [Bacillus cereus G9842]
 gi|228898777|ref|ZP_04063061.1| hypothetical protein bthur0014_130 [Bacillus thuringiensis IBL
           4222]
 gi|228905820|ref|ZP_04069719.1| hypothetical protein bthur0013_130 [Bacillus thuringiensis IBL 200]
 gi|228918974|ref|ZP_04082355.1| hypothetical protein bthur0011_120 [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
 gi|228937326|ref|ZP_04099974.1| hypothetical protein bthur0008_130 [Bacillus thuringiensis serovar
           berliner ATCC 10792]
 gi|228950571|ref|ZP_04112707.1| hypothetical protein bthur0006_130 [Bacillus thuringiensis serovar
           kurstaki str. T03a001]
 gi|228956464|ref|ZP_04118262.1| hypothetical protein bthur0005_120 [Bacillus thuringiensis serovar
           pakistani str. T13001]
 gi|228963121|ref|ZP_04124292.1| hypothetical protein bthur0004_140 [Bacillus thuringiensis serovar
           sotto str. T04001]
 gi|228970212|ref|ZP_04130873.1| hypothetical protein bthur0003_120 [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228976782|ref|ZP_04137196.1| hypothetical protein bthur0002_120 [Bacillus thuringiensis Bt407]
 gi|229039928|ref|ZP_04189694.1| hypothetical protein bcere0027_120 [Bacillus cereus AH676]
 gi|229067787|ref|ZP_04201106.1| hypothetical protein bcere0025_130 [Bacillus cereus F65185]
 gi|229077296|ref|ZP_04209979.1| hypothetical protein bcere0023_220 [Bacillus cereus Rock4-2]
 gi|229107709|ref|ZP_04237347.1| hypothetical protein bcere0018_120 [Bacillus cereus Rock1-15]
 gi|229125540|ref|ZP_04254574.1| hypothetical protein bcere0015_120 [Bacillus cereus BDRD-Cer4]
 gi|229142829|ref|ZP_04271273.1| hypothetical protein bcere0012_120 [Bacillus cereus BDRD-ST24]
 gi|229148432|ref|ZP_04276690.1| hypothetical protein bcere0011_120 [Bacillus cereus m1550]
 gi|229176623|ref|ZP_04304029.1| hypothetical protein bcere0005_120 [Bacillus cereus 172560W]
 gi|229188308|ref|ZP_04315359.1| hypothetical protein bcere0002_130 [Bacillus cereus ATCC 10876]
 gi|296500857|ref|YP_003662557.1| hypothetical protein BMB171_C0019 [Bacillus thuringiensis BMB171]
 gi|47117501|sp|Q814C9|Y025_BACCR RecName: Full=UPF0133 protein BC_0025
 gi|226707694|sp|B7IS38|Y5293_BACC2 RecName: Full=UPF0133 protein BCG9842_B5293
 gi|226734012|sp|B7HIJ2|Y025_BACC4 RecName: Full=UPF0133 protein BCB4264_A0025
 gi|29893836|gb|AAP07128.1| hypothetical Transcriptional Regulatory Protein [Bacillus cereus
           ATCC 14579]
 gi|206732394|gb|EDZ49576.1| conserved hypothetical protein TIGR00103 [Bacillus cereus AH1134]
 gi|218163103|gb|ACK63095.1| conserved hypothetical protein TIGR00103 [Bacillus cereus B4264]
 gi|218545731|gb|ACK98125.1| conserved hypothetical protein TIGR00103 [Bacillus cereus G9842]
 gi|228595176|gb|EEK52944.1| hypothetical protein bcere0002_130 [Bacillus cereus ATCC 10876]
 gi|228606853|gb|EEK64268.1| hypothetical protein bcere0005_120 [Bacillus cereus 172560W]
 gi|228635041|gb|EEK91612.1| hypothetical protein bcere0011_120 [Bacillus cereus m1550]
 gi|228640643|gb|EEK97029.1| hypothetical protein bcere0012_120 [Bacillus cereus BDRD-ST24]
 gi|228657924|gb|EEL13728.1| hypothetical protein bcere0015_120 [Bacillus cereus BDRD-Cer4]
 gi|228675749|gb|EEL30955.1| hypothetical protein bcere0018_120 [Bacillus cereus Rock1-15]
 gi|228706019|gb|EEL58324.1| hypothetical protein bcere0023_220 [Bacillus cereus Rock4-2]
 gi|228715340|gb|EEL67197.1| hypothetical protein bcere0025_130 [Bacillus cereus F65185]
 gi|228727418|gb|EEL78609.1| hypothetical protein bcere0027_120 [Bacillus cereus AH676]
 gi|228782944|gb|EEM31108.1| hypothetical protein bthur0002_120 [Bacillus thuringiensis Bt407]
 gi|228789513|gb|EEM37431.1| hypothetical protein bthur0003_120 [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228796577|gb|EEM44014.1| hypothetical protein bthur0004_140 [Bacillus thuringiensis serovar
           sotto str. T04001]
 gi|228803221|gb|EEM50041.1| hypothetical protein bthur0005_120 [Bacillus thuringiensis serovar
           pakistani str. T13001]
 gi|228809114|gb|EEM55597.1| hypothetical protein bthur0006_130 [Bacillus thuringiensis serovar
           kurstaki str. T03a001]
 gi|228822351|gb|EEM68331.1| hypothetical protein bthur0008_130 [Bacillus thuringiensis serovar
           berliner ATCC 10792]
 gi|228840689|gb|EEM85949.1| hypothetical protein bthur0011_120 [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
 gi|228853828|gb|EEM98586.1| hypothetical protein bthur0013_130 [Bacillus thuringiensis IBL 200]
 gi|228860869|gb|EEN05245.1| hypothetical protein bthur0014_130 [Bacillus thuringiensis IBL
           4222]
 gi|296321909|gb|ADH04837.1| hypothetical protein BMB171_C0019 [Bacillus thuringiensis BMB171]
 gi|326937816|gb|AEA13712.1| hypothetical protein CT43_CH0019 [Bacillus thuringiensis serovar
           chinensis CT-43]
          Length = 109

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 31/84 (36%), Positives = 53/84 (63%)

Query: 20  KMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAH 79
           K +E +     EG AGGGM++V  NG   +  VKI   ++  +++E+L+DL++AA +DA 
Sbjct: 25  KAQEELGEKTVEGTAGGGMITVIANGHKQILEVKIKEEVVDPEDIEMLQDLVLAATNDAL 84

Query: 80  KKIEDLVATKTQEITEGLPIPPGL 103
           KK ++L  +   + T+GL +P G+
Sbjct: 85  KKADELSNSTMGKFTKGLNLPGGM 108


>gi|212696576|ref|ZP_03304704.1| hypothetical protein ANHYDRO_01114 [Anaerococcus hydrogenalis DSM
           7454]
 gi|325846772|ref|ZP_08169687.1| DNA-binding protein, YbaB/EbfC family [Anaerococcus hydrogenalis
           ACS-025-V-Sch4]
 gi|212676432|gb|EEB36039.1| hypothetical protein ANHYDRO_01114 [Anaerococcus hydrogenalis DSM
           7454]
 gi|325481530|gb|EGC84571.1| DNA-binding protein, YbaB/EbfC family [Anaerococcus hydrogenalis
           ACS-025-V-Sch4]
          Length = 111

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 59/100 (59%), Gaps = 3/100 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M+N+MK V   K++Q  M K ++ I   E    AGGG++   +NGK  +  +KID  ++ 
Sbjct: 12  MNNMMKKV---KKMQEDMAKAQQEIEEKEFSSTAGGGVIEAVVNGKKEVIKIKIDEDVVD 68

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
            ++ E+LEDL++AA +DA KK +     +  ++T  + IP
Sbjct: 69  PEDTEMLEDLVVAAVNDALKKADQYTQKEMGKLTGNINIP 108


>gi|225026635|ref|ZP_03715827.1| hypothetical protein EUBHAL_00886 [Eubacterium hallii DSM 3353]
 gi|224956005|gb|EEG37214.1| hypothetical protein EUBHAL_00886 [Eubacterium hallii DSM 3353]
          Length = 131

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 57/83 (68%), Gaps = 3/83 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M+N+MK   Q +++Q +M +  +++     E +AGGG+VSV ++GK  +T +KI   ++ 
Sbjct: 32  MNNLMK---QAQKMQKQMAETTKALEEKSYEASAGGGVVSVTVSGKKEVTAIKIAEEVVD 88

Query: 61  EDNVEILEDLIIAAHSDAHKKIE 83
            D++E+LEDLI+AA ++A + +E
Sbjct: 89  PDDIEMLEDLIMAATNEAFRAME 111


>gi|227502438|ref|ZP_03932487.1| conserved hypothetical protein [Corynebacterium accolens ATCC
           49725]
 gi|306834999|ref|ZP_07468048.1| conserved hypothetical protein [Corynebacterium accolens ATCC
           49726]
 gi|227076807|gb|EEI14770.1| conserved hypothetical protein [Corynebacterium accolens ATCC
           49725]
 gi|304569119|gb|EFM44635.1| conserved hypothetical protein [Corynebacterium accolens ATCC
           49726]
          Length = 122

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 58/96 (60%)

Query: 2   SNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFE 61
           +++  ++ Q  ++Q +++K +E I +   EG+AG G+V V + G   L  ++ID+S++  
Sbjct: 11  NDMNDLIAQAAQVQAELQKAQEEILATNVEGSAGNGLVKVTMTGGAELVDLQIDKSVVDP 70

Query: 62  DNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGL 97
           ++++ L+DL++ A  DAH     L   K   +++G+
Sbjct: 71  EDIDTLQDLVMGAFKDAHAAAGKLAQEKIGPLSQGM 106


>gi|320333445|ref|YP_004170156.1| hypothetical protein Deima_0836 [Deinococcus maricopensis DSM
          21211]
 gi|319754734|gb|ADV66491.1| UPF0133 protein ybaB [Deinococcus maricopensis DSM 21211]
          Length = 99

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 34/90 (37%), Positives = 55/90 (61%), Gaps = 1/90 (1%)

Query: 3  NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
          ++ K++ Q ++ Q    K++E +  +  EG+AGG MVSV +NG+  +T +KI    +  D
Sbjct: 2  DMRKLMKQMQQAQTAAGKIQEKLAEMSVEGSAGG-MVSVTMNGQGHMTAIKIKPEAVDPD 60

Query: 63 NVEILEDLIIAAHSDAHKKIEDLVATKTQE 92
          +VE LEDLI+ A  DA  K  +L   +TQ+
Sbjct: 61 DVEALEDLILVAVQDAAAKANELQQQETQK 90


>gi|148653526|ref|YP_001280619.1| hypothetical protein PsycPRwf_1729 [Psychrobacter sp. PRwf-1]
 gi|172048544|sp|A5WG78|Y1729_PSYWF RecName: Full=UPF0133 protein PsycPRwf_1729
 gi|148572610|gb|ABQ94669.1| conserved hypothetical protein 103 [Psychrobacter sp. PRwf-1]
          Length = 110

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 57/94 (60%), Gaps = 1/94 (1%)

Query: 14  IQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIA 73
           ++  +EK K+ +   E +  AG G+V V + G++++  + ID SLL ED  +++EDLI A
Sbjct: 17  VEANVEKAKKELADKEVQAEAGNGLVKVTMTGRHVVKRLSIDPSLL-EDEPDLIEDLIAA 75

Query: 74  AHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           A + A  K ++L  T   + T G+ +PPG++  F
Sbjct: 76  AINAAVTKADELSETTLAKATSGMGLPPGMQGLF 109


>gi|83816328|ref|YP_446654.1| hypothetical protein SRU_2556 [Salinibacter ruber DSM 13855]
 gi|83757722|gb|ABC45835.1| conserved hypothetical protein TIGR00103, putative [Salinibacter
           ruber DSM 13855]
          Length = 178

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 56/103 (54%), Gaps = 1/103 (0%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           N+  M G+  E+Q KM   ++ +        AGGGMV V  NG   +TG++ID   +  D
Sbjct: 72  NMQDMFGKMMEMQEKMNAAQDELADKTVTAEAGGGMVKVTANGAQEITGIEIDPEAVDPD 131

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKF 105
           ++E+LEDL+IA  + A +   D+   + ++   G+ +P G+  
Sbjct: 132 DLELLEDLVIAGVNKALEDASDMAQEEMKDSMGGM-LPQGMDL 173


>gi|196229726|ref|ZP_03128590.1| conserved hypothetical protein [Chthoniobacter flavus Ellin428]
 gi|196226052|gb|EDY20558.1| conserved hypothetical protein [Chthoniobacter flavus Ellin428]
          Length = 104

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 61/103 (59%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           N+ KM+ Q  ++Q ++ + +  +        AGGG V+V  NG   +  +KID++++  +
Sbjct: 2   NLKKMMQQAAKMQEQLAQTQSELADKTVTATAGGGKVTVTANGAGEVLSIKIDKTVVDPE 61

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKF 105
           +VE LEDLI++    A ++ + L  ++  ++T G+ +PPG+ F
Sbjct: 62  DVESLEDLILSGVQKAIEEGKALQQSEMSKLTAGMGLPPGMGF 104


>gi|126652952|ref|ZP_01725094.1| hypothetical protein BB14905_03871 [Bacillus sp. B14905]
 gi|169825652|ref|YP_001695810.1| hypothetical protein Bsph_0039 [Lysinibacillus sphaericus C3-41]
 gi|299542067|ref|ZP_07052383.1| hypothetical protein BFZC1_23973 [Lysinibacillus fusiformis ZC1]
 gi|238688180|sp|B1HS62|Y039_LYSSC RecName: Full=UPF0133 protein Bsph_0039
 gi|126590282|gb|EAZ84404.1| hypothetical protein BB14905_03871 [Bacillus sp. B14905]
 gi|168990140|gb|ACA37680.1| UPF0133 protein [Lysinibacillus sphaericus C3-41]
 gi|298725382|gb|EFI66030.1| hypothetical protein BFZC1_23973 [Lysinibacillus fusiformis ZC1]
          Length = 104

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 54/79 (68%)

Query: 22  KESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKK 81
           +E++ + + EG AGGGMV V ++G+  +  V +D S++  +++E+L+DLI+ A ++A KK
Sbjct: 25  QEALNAEQFEGVAGGGMVKVTVSGQREVVSVNLDESVVDPEDIEMLQDLIVIATNEALKK 84

Query: 82  IEDLVATKTQEITEGLPIP 100
           +E+   +   + T+GL +P
Sbjct: 85  VEEKTNSTMGKFTQGLNLP 103


>gi|320104516|ref|YP_004180107.1| hypothetical protein Isop_2993 [Isosphaera pallida ATCC 43644]
 gi|319751798|gb|ADV63558.1| Uncharacterized protein family UPF0133 [Isosphaera pallida ATCC
           43644]
          Length = 116

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 55/97 (56%), Gaps = 2/97 (2%)

Query: 6   KMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLL--FEDN 63
            ++G   +++ +ME+++  + ++ AEG AGGGMV+   NGK  L  ++ID   L    ++
Sbjct: 10  NLLGDPAKLREQMERVQAELAAIRAEGTAGGGMVTAVFNGKLDLVRLRIDPQALSNAAND 69

Query: 64  VEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
            E+LEDLI AA      +  + VA     +  G+PIP
Sbjct: 70  PELLEDLITAAIHQGMARAREEVARTISSLAGGMPIP 106


>gi|229027871|ref|ZP_04184028.1| hypothetical protein bcere0028_130 [Bacillus cereus AH1271]
 gi|229159198|ref|ZP_04287224.1| hypothetical protein bcere0009_130 [Bacillus cereus R309803]
 gi|228624279|gb|EEK81079.1| hypothetical protein bcere0009_130 [Bacillus cereus R309803]
 gi|228733447|gb|EEL84272.1| hypothetical protein bcere0028_130 [Bacillus cereus AH1271]
          Length = 109

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/84 (35%), Positives = 53/84 (63%)

Query: 20  KMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAH 79
           K +E +     EG AGGGM++V  NG   +  VK+   ++  +++E+L+DL++AA +DA 
Sbjct: 25  KAQEELGEKTVEGTAGGGMITVIANGHKQILEVKVKEEVVDPEDIEMLQDLVLAATNDAL 84

Query: 80  KKIEDLVATKTQEITEGLPIPPGL 103
           KK ++L  +   + T+GL +P G+
Sbjct: 85  KKADELSNSTMGKFTKGLNLPGGM 108


>gi|30260214|ref|NP_842591.1| hypothetical protein BA_0020 [Bacillus anthracis str. Ames]
 gi|42779102|ref|NP_976349.1| hypothetical protein BCE_0021 [Bacillus cereus ATCC 10987]
 gi|47525275|ref|YP_016624.1| hypothetical protein GBAA_0020 [Bacillus anthracis str. 'Ames
           Ancestor']
 gi|49183058|ref|YP_026310.1| hypothetical protein BAS0022 [Bacillus anthracis str. Sterne]
 gi|49476695|ref|YP_034379.1| hypothetical protein BT9727_0020 [Bacillus thuringiensis serovar
           konkukian str. 97-27]
 gi|52145189|ref|YP_081638.1| hypothetical protein BCZK0020 [Bacillus cereus E33L]
 gi|65317486|ref|ZP_00390445.1| COG0718: Uncharacterized protein conserved in bacteria [Bacillus
           anthracis str. A2012]
 gi|118475797|ref|YP_892948.1| hypothetical protein BALH_0020 [Bacillus thuringiensis str. Al
           Hakam]
 gi|165873225|ref|ZP_02217836.1| conserved hypothetical protein TIGR00103 [Bacillus anthracis str.
           A0488]
 gi|167635033|ref|ZP_02393350.1| conserved hypothetical protein TIGR00103 [Bacillus anthracis str.
           A0442]
 gi|167642056|ref|ZP_02400283.1| conserved hypothetical protein TIGR00103 [Bacillus anthracis str.
           A0193]
 gi|170688897|ref|ZP_02880099.1| conserved hypothetical protein TIGR00103 [Bacillus anthracis str.
           A0465]
 gi|170707508|ref|ZP_02897961.1| conserved hypothetical protein TIGR00103 [Bacillus anthracis str.
           A0389]
 gi|177655690|ref|ZP_02937015.1| conserved hypothetical protein TIGR00103 [Bacillus anthracis str.
           A0174]
 gi|190569329|ref|ZP_03022221.1| conserved hypothetical protein TIGR00103 [Bacillus anthracis
           Tsiankovskii-I]
 gi|196036391|ref|ZP_03103788.1| conserved hypothetical protein TIGR00103 [Bacillus cereus W]
 gi|196041938|ref|ZP_03109225.1| conserved hypothetical protein TIGR00103 [Bacillus cereus
           NVH0597-99]
 gi|196047695|ref|ZP_03114899.1| conserved hypothetical protein TIGR00103 [Bacillus cereus 03BB108]
 gi|206978345|ref|ZP_03239219.1| conserved hypothetical protein TIGR00103 [Bacillus cereus H3081.97]
 gi|217957600|ref|YP_002336142.1| hypothetical protein BCAH187_A0027 [Bacillus cereus AH187]
 gi|218901225|ref|YP_002449059.1| conserved hypothetical protein TIGR00103 [Bacillus cereus AH820]
 gi|222093794|ref|YP_002527842.1| hypothetical protein BCQ_0027 [Bacillus cereus Q1]
 gi|225862076|ref|YP_002747454.1| conserved hypothetical protein TIGR00103 [Bacillus cereus 03BB102]
 gi|227812697|ref|YP_002812706.1| conserved hypothetical protein TIGR00103 [Bacillus anthracis str.
           CDC 684]
 gi|228912762|ref|ZP_04076411.1| hypothetical protein bthur0012_130 [Bacillus thuringiensis serovar
           pulsiensis BGSC 4CC1]
 gi|228931526|ref|ZP_04094434.1| hypothetical protein bthur0009_210 [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|228943830|ref|ZP_04106217.1| hypothetical protein bthur0007_130 [Bacillus thuringiensis serovar
           monterrey BGSC 4AJ1]
 gi|228983279|ref|ZP_04143494.1| hypothetical protein bthur0001_120 [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
 gi|229089156|ref|ZP_04220439.1| hypothetical protein bcere0021_130 [Bacillus cereus Rock3-42]
 gi|229119686|ref|ZP_04248949.1| hypothetical protein bcere0016_130 [Bacillus cereus 95/8201]
 gi|229153803|ref|ZP_04281935.1| hypothetical protein bcere0010_120 [Bacillus cereus ATCC 4342]
 gi|229182418|ref|ZP_04309671.1| hypothetical protein bcere0004_130 [Bacillus cereus BGSC 6E1]
 gi|229601910|ref|YP_002864675.1| conserved hypothetical protein TIGR00103 [Bacillus anthracis str.
           A0248]
 gi|254686612|ref|ZP_05150471.1| hypothetical protein BantC_22544 [Bacillus anthracis str.
           CNEVA-9066]
 gi|254724165|ref|ZP_05185950.1| hypothetical protein BantA1_17118 [Bacillus anthracis str. A1055]
 gi|254737000|ref|ZP_05194705.1| hypothetical protein BantWNA_17746 [Bacillus anthracis str. Western
           North America USA6153]
 gi|254744198|ref|ZP_05201879.1| hypothetical protein BantKB_24886 [Bacillus anthracis str. Kruger
           B]
 gi|254751189|ref|ZP_05203228.1| hypothetical protein BantV_01917 [Bacillus anthracis str. Vollum]
 gi|254761659|ref|ZP_05213677.1| hypothetical protein BantA9_25376 [Bacillus anthracis str.
           Australia 94]
 gi|301051760|ref|YP_003789971.1| hypothetical protein BACI_c00270 [Bacillus anthracis CI]
 gi|47117505|sp|Q81W17|Y020_BACAN RecName: Full=UPF0133 protein BA_0020/GBAA_0020/BAS0022
 gi|81397517|sp|Q6HPZ1|Y020_BACHK RecName: Full=UPF0133 protein BT9727_0020
 gi|81411407|sp|Q73FI5|Y021_BACC1 RecName: Full=UPF0133 protein BCE_0021
 gi|81689884|sp|Q63HE9|Y020_BACCZ RecName: Full=UPF0133 protein BCE33L0020
 gi|166227767|sp|A0R898|Y020_BACAH RecName: Full=UPF0133 protein BALH_0020
 gi|226734011|sp|B7JJD5|Y024_BACC0 RecName: Full=UPF0133 protein BCAH820_0024
 gi|226734017|sp|B7HPT5|Y027_BACC7 RecName: Full=UPF0133 protein BCAH187_A0027
 gi|254799457|sp|C3P9G9|Y027_BACAA RecName: Full=UPF0133 protein BAA_0027
 gi|254799458|sp|C3LIZ6|Y027_BACAC RecName: Full=UPF0133 protein BAMEG_0027
 gi|254799459|sp|C1ES26|Y027_BACC3 RecName: Full=UPF0133 protein BCA_0027
 gi|254799460|sp|B9IYI8|Y027_BACCQ RecName: Full=UPF0133 protein BCQ_0027
 gi|30253535|gb|AAP24077.1| DNA-binding protein, YbaB/EbfC family [Bacillus anthracis str.
           Ames]
 gi|42735017|gb|AAS38957.1| conserved hypothetical protein TIGR00103 [Bacillus cereus ATCC
           10987]
 gi|47500423|gb|AAT29099.1| conserved hypothetical protein TIGR00103 [Bacillus anthracis str.
           'Ames Ancestor']
 gi|49176985|gb|AAT52361.1| conserved hypothetical protein TIGR00103 [Bacillus anthracis str.
           Sterne]
 gi|49328251|gb|AAT58897.1| conserved hypothetical protein [Bacillus thuringiensis serovar
           konkukian str. 97-27]
 gi|51978658|gb|AAU20208.1| conserved hypothetical protein [Bacillus cereus E33L]
 gi|118415022|gb|ABK83441.1| conserved hypothetical protein [Bacillus thuringiensis str. Al
           Hakam]
 gi|164711023|gb|EDR16589.1| conserved hypothetical protein TIGR00103 [Bacillus anthracis str.
           A0488]
 gi|167509990|gb|EDR85409.1| conserved hypothetical protein TIGR00103 [Bacillus anthracis str.
           A0193]
 gi|167529507|gb|EDR92257.1| conserved hypothetical protein TIGR00103 [Bacillus anthracis str.
           A0442]
 gi|170127504|gb|EDS96378.1| conserved hypothetical protein TIGR00103 [Bacillus anthracis str.
           A0389]
 gi|170667121|gb|EDT17882.1| conserved hypothetical protein TIGR00103 [Bacillus anthracis str.
           A0465]
 gi|172080030|gb|EDT65130.1| conserved hypothetical protein TIGR00103 [Bacillus anthracis str.
           A0174]
 gi|190559551|gb|EDV13544.1| conserved hypothetical protein TIGR00103 [Bacillus anthracis
           Tsiankovskii-I]
 gi|195991021|gb|EDX54992.1| conserved hypothetical protein TIGR00103 [Bacillus cereus W]
 gi|196021480|gb|EDX60183.1| conserved hypothetical protein TIGR00103 [Bacillus cereus 03BB108]
 gi|196027193|gb|EDX65813.1| conserved hypothetical protein TIGR00103 [Bacillus cereus
           NVH0597-99]
 gi|206743437|gb|EDZ54870.1| conserved hypothetical protein TIGR00103 [Bacillus cereus H3081.97]
 gi|217066296|gb|ACJ80546.1| conserved hypothetical protein TIGR00103 [Bacillus cereus AH187]
 gi|218536861|gb|ACK89259.1| conserved hypothetical protein TIGR00103 [Bacillus cereus AH820]
 gi|221237840|gb|ACM10550.1| YaaK [Bacillus cereus Q1]
 gi|225789586|gb|ACO29803.1| conserved hypothetical protein TIGR00103 [Bacillus cereus 03BB102]
 gi|227003781|gb|ACP13524.1| conserved hypothetical protein TIGR00103 [Bacillus anthracis str.
           CDC 684]
 gi|228601064|gb|EEK58631.1| hypothetical protein bcere0004_130 [Bacillus cereus BGSC 6E1]
 gi|228629672|gb|EEK86367.1| hypothetical protein bcere0010_120 [Bacillus cereus ATCC 4342]
 gi|228663777|gb|EEL19354.1| hypothetical protein bcere0016_130 [Bacillus cereus 95/8201]
 gi|228694179|gb|EEL47859.1| hypothetical protein bcere0021_130 [Bacillus cereus Rock3-42]
 gi|228776459|gb|EEM24810.1| hypothetical protein bthur0001_120 [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
 gi|228815854|gb|EEM62088.1| hypothetical protein bthur0007_130 [Bacillus thuringiensis serovar
           monterrey BGSC 4AJ1]
 gi|228828144|gb|EEM73870.1| hypothetical protein bthur0009_210 [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|228846889|gb|EEM91892.1| hypothetical protein bthur0012_130 [Bacillus thuringiensis serovar
           pulsiensis BGSC 4CC1]
 gi|229266318|gb|ACQ47955.1| conserved hypothetical protein TIGR00103 [Bacillus anthracis str.
           A0248]
 gi|300373929|gb|ADK02833.1| conserved hypothetical protein [Bacillus cereus biovar anthracis
           str. CI]
 gi|324324013|gb|ADY19273.1| hypothetical protein YBT020_00100 [Bacillus thuringiensis serovar
           finitimus YBT-020]
          Length = 109

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/84 (35%), Positives = 53/84 (63%)

Query: 20  KMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAH 79
           K +E +     EG AGGGM++V  NG   +  VK+   ++  +++E+L+DL++AA +DA 
Sbjct: 25  KAQEELGEKTVEGTAGGGMITVIANGHKQILEVKVKEEVVDPEDIEMLQDLVLAATNDAL 84

Query: 80  KKIEDLVATKTQEITEGLPIPPGL 103
           KK ++L  +   + T+GL +P G+
Sbjct: 85  KKADELSNSTMGKFTKGLNLPGGM 108


>gi|312880092|ref|ZP_07739892.1| conserved hypothetical protein [Aminomonas paucivorans DSM 12260]
 gi|310783383|gb|EFQ23781.1| conserved hypothetical protein [Aminomonas paucivorans DSM 12260]
          Length = 101

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 56/95 (58%)

Query: 6   KMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVE 65
           K++ Q + +Q +M  ++E +  +  EG +GGGMV   +NG   L  +KI   ++   + E
Sbjct: 5   KLLKQAQRMQAQMASLQEELAKVTVEGTSGGGMVRASVNGHGDLLSLKIAPEVIDPQDPE 64

Query: 66  ILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           +LEDL+++A ++A +K +D    +  ++T G+  P
Sbjct: 65  MLEDLVLSAVNEAIRKSKDQANGQVNQLTGGMSFP 99


>gi|331092482|ref|ZP_08341305.1| hypothetical protein HMPREF9477_01948 [Lachnospiraceae bacterium
           2_1_46FAA]
 gi|330400985|gb|EGG80585.1| hypothetical protein HMPREF9477_01948 [Lachnospiraceae bacterium
           2_1_46FAA]
          Length = 117

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 61/94 (64%), Gaps = 3/94 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M+N+MK   Q +++Q +ME+  + + S E    AGGG V V ++G   +T VK+   ++ 
Sbjct: 15  MANLMK---QAQKMQRQMEEQAKEMESKEFTATAGGGAVEVTVSGTRAVTKVKLQEEVVD 71

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEIT 94
            D++E+LEDLI+AA ++A +K+++  ++   ++T
Sbjct: 72  PDDIEMLEDLIMAATNEALRKVDEESSSAMAKLT 105


>gi|228925277|ref|ZP_04088375.1| hypothetical protein bthur0010_130 [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|228834391|gb|EEM79930.1| hypothetical protein bthur0010_130 [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
          Length = 109

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/84 (35%), Positives = 53/84 (63%)

Query: 20  KMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAH 79
           K +E +     EG AGGGM++V  NG   +  VK+   ++  +++E+L+DL++AA +DA 
Sbjct: 25  KAQEELGEKTVEGTAGGGMITVIANGHKQILEVKVKEEVVDPEDIEMLQDLVLAAMNDAL 84

Query: 80  KKIEDLVATKTQEITEGLPIPPGL 103
           KK ++L  +   + T+GL +P G+
Sbjct: 85  KKADELSNSTMGKFTKGLNLPGGM 108


>gi|327438119|dbj|BAK14484.1| uncharacterized protein [Solibacillus silvestris StLB046]
          Length = 104

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 53/79 (67%)

Query: 22  KESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKK 81
           +E++ +   EG AGGGMV V +NG+  +  V +D S++  +++E+L+DLI+ A ++A KK
Sbjct: 25  QEALNAQLFEGAAGGGMVKVVMNGQRQMLEVNLDESVVDPEDIEMLQDLIVIATNEALKK 84

Query: 82  IEDLVATKTQEITEGLPIP 100
           +E+   +   + T+G+ +P
Sbjct: 85  VEETTNSTMGKFTQGMNLP 103


>gi|294508589|ref|YP_003572648.1| hypothetical protein SRM_02775 [Salinibacter ruber M8]
 gi|294344918|emb|CBH25696.1| conserved hypothetical protein [Salinibacter ruber M8]
          Length = 108

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 56/103 (54%), Gaps = 1/103 (0%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           N+  M G+  E+Q KM   ++ +        AGGGMV V  NG   +TG++ID   +  D
Sbjct: 2   NMQDMFGKMMEMQEKMNAAQDELADKTVTAEAGGGMVKVTANGAQEITGIEIDPEAVDPD 61

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKF 105
           ++E+LEDL+IA  + A +   D+   + ++   G+ +P G+  
Sbjct: 62  DLELLEDLVIAGVNKALEDASDMAQEEMKDSMGGM-LPQGMDL 103


>gi|227499705|ref|ZP_03929805.1| conserved hypothetical protein [Anaerococcus tetradius ATCC 35098]
 gi|227218172|gb|EEI83435.1| conserved hypothetical protein [Anaerococcus tetradius ATCC 35098]
          Length = 112

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 57/100 (57%), Gaps = 3/100 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M+N+MK   Q K++Q +MEK +  I   E    AGGG++   +NGK  +  +KI+  ++ 
Sbjct: 13  MNNMMK---QVKKMQEQMEKAQAEIEEKEFSSTAGGGVIEATVNGKKEVLAIKINPDVVD 69

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
            ++VE+LEDLI+ A +DA  K           +T G+ IP
Sbjct: 70  PEDVEMLEDLIMVAINDAMAKAASYNEETMGRLTGGINIP 109


>gi|194333713|ref|YP_002015573.1| hypothetical protein Paes_0882 [Prosthecochloris aestuarii DSM 271]
 gi|194311531|gb|ACF45926.1| conserved hypothetical protein [Prosthecochloris aestuarii DSM 271]
          Length = 118

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 32/97 (32%), Positives = 59/97 (60%), Gaps = 2/97 (2%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+  M+ Q K+   KM+ +++ +  + AEG+AGGGMV   +NGK  +  V ID  ++ 
Sbjct: 10  MPNLNDMMKQLKQAGEKMQDVQKQLEKITAEGDAGGGMVRAVVNGKQRVLSVTIDPEIV- 68

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGL 97
            D+VE+++DL++AA + A + +  L   +  ++  G+
Sbjct: 69  -DDVEMVQDLVVAAVNSALENVTGLAQEEMSKVAGGM 104


>gi|302544191|ref|ZP_07296533.1| conserved hypothetical YaaK [Streptomyces hygroscopicus ATCC 53653]
 gi|302461809|gb|EFL24902.1| conserved hypothetical YaaK [Streptomyces himastatinicus ATCC
           53653]
          Length = 111

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 57/103 (55%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           ++ +++ Q +++Q  +   +E +     EG++GGG+V   + G   L G+ ID   +  +
Sbjct: 9   DMQQLLQQAQKMQQDLAAAQEELARTPVEGSSGGGLVKATVTGAGELQGLVIDPKAVDPE 68

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKF 105
           + E L DL++AA  DA+   ++L  TK   + +GL   PGL F
Sbjct: 69  DTETLADLVVAAVRDANHVAQELQQTKLGPLAQGLGGMPGLPF 111


>gi|256545279|ref|ZP_05472644.1| transcriptional regulatory protein [Anaerococcus vaginalis ATCC
           51170]
 gi|256399106|gb|EEU12718.1| transcriptional regulatory protein [Anaerococcus vaginalis ATCC
           51170]
          Length = 111

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 31/98 (31%), Positives = 59/98 (60%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           N+  M+ + +++Q +M + ++ I   E    AGGG++   +NGK  +  +KID  ++  D
Sbjct: 11  NMNSMMKKVQKMQQEMARTQQEIEEKEFSSTAGGGVIEAVVNGKKEVLKIKIDEDVVDPD 70

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           + E+LEDL++AA +DA KK ++    +  ++T  + IP
Sbjct: 71  DTEMLEDLVVAAINDALKKADEYSQKEMGKLTGNINIP 108


>gi|332971002|gb|EGK09974.1| hypothetical protein HMPREF9373_2007 [Psychrobacter sp. 1501(2011)]
          Length = 110

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 56/94 (59%), Gaps = 1/94 (1%)

Query: 14  IQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIA 73
           ++  +EK K+ +   E +  AG G+V V + G++++  + ID SLL ED  +++EDLI A
Sbjct: 17  VEANVEKAKKELADKEVQAEAGNGLVKVTMTGRHVVKRLSIDPSLL-EDEPDLIEDLIAA 75

Query: 74  AHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           A + A  K ++L  T     T G+ +PPG++  F
Sbjct: 76  AINAAVTKADELSETTLANATSGMGLPPGMQGLF 109


>gi|297519066|ref|ZP_06937452.1| hypothetical protein EcolOP_15608 [Escherichia coli OP50]
          Length = 63

 Score = 58.2 bits (139), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 42/64 (65%), Gaps = 1/64 (1%)

Query: 44  NGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGL 103
           NG +    V+ID SLL ED+ E+LEDL+ AA +DA ++IE+    K   ++ G+ +PPG 
Sbjct: 1   NGAHNCRRVEIDPSLL-EDDKEMLEDLVAAAFNDAARRIEETQKEKMASVSSGMQLPPGF 59

Query: 104 KFPF 107
           K PF
Sbjct: 60  KMPF 63


>gi|229829735|ref|ZP_04455804.1| hypothetical protein GCWU000342_01832 [Shuttleworthia satelles DSM
           14600]
 gi|229791724|gb|EEP27838.1| hypothetical protein GCWU000342_01832 [Shuttleworthia satelles DSM
           14600]
          Length = 109

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 59/99 (59%), Gaps = 3/99 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M+N+MK   Q +++Q +ME+ +  +   +    AGGG VSV ++GK  L  ++IDR ++ 
Sbjct: 14  MNNLMK---QAQKMQKQMEQAQADLEERDFTATAGGGAVSVVVSGKRELKSIEIDREVVD 70

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPI 99
            ++VE+L+DLI+AA ++  K+++          T G  I
Sbjct: 71  PEDVEMLQDLILAAVNEGLKQVDSFSQQSMSRFTGGFGI 109


>gi|163938032|ref|YP_001642916.1| hypothetical protein BcerKBAB4_0019 [Bacillus weihenstephanensis
           KBAB4]
 gi|229557880|sp|A9VN37|Y019_BACWK RecName: Full=UPF0133 protein BcerKBAB4_0019
 gi|163860229|gb|ABY41288.1| conserved hypothetical protein [Bacillus weihenstephanensis KBAB4]
          Length = 109

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 30/84 (35%), Positives = 54/84 (64%)

Query: 20  KMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAH 79
           K +E +     EG AGGGMV+V  +G   +  VKI   ++  +++E+L+DL++AA +DA 
Sbjct: 25  KAQEELGEKTVEGTAGGGMVTVIASGHKQVLEVKIKEEVVDPEDIEMLQDLVLAATNDAL 84

Query: 80  KKIEDLVATKTQEITEGLPIPPGL 103
           KK+++L  +   + T+G+ +P G+
Sbjct: 85  KKVDELSNSTMGKFTKGMNLPGGM 108


>gi|284049059|ref|YP_003399398.1| hypothetical protein Acfer_1727 [Acidaminococcus fermentans DSM
           20731]
 gi|283953280|gb|ADB48083.1| conserved hypothetical protein [Acidaminococcus fermentans DSM
           20731]
          Length = 110

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 60/100 (60%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M+ +  M+ + +++Q +M ++++ +   E EG AGG  V   +NG   L  + +    + 
Sbjct: 8   MNGMQGMLKKVQKMQSEMTRLQDELKEREVEGTAGGEAVKAVVNGNKNLVSLTLSPDAVD 67

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
            ++VE+L+DLI+ A +DA KK++++   +  ++T GL +P
Sbjct: 68  PEDVEMLQDLIVTAVNDAMKKVDEMTEKELGKVTGGLKLP 107


>gi|282863699|ref|ZP_06272757.1| conserved hypothetical protein [Streptomyces sp. ACTE]
 gi|282561400|gb|EFB66944.1| conserved hypothetical protein [Streptomyces sp. ACTE]
          Length = 111

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 55/103 (53%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           N+ +++ Q +++Q  +   +E +   E EG AGGG+V   + G   L G+ ID   +  +
Sbjct: 9   NMQQLLQQAQKMQQDLAVAQEELARTEVEGQAGGGLVKATVTGSGDLRGLVIDPKAVDPE 68

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKF 105
           + E L DL++AA   A++  + L   K   + +GL   PGL F
Sbjct: 69  DTETLADLVVAAVQAANENAQQLQQQKLGPLAQGLGGMPGLPF 111


>gi|328883422|emb|CCA56661.1| hypothetical protein co-occurring with RecR [Streptomyces
           venezuelae ATCC 10712]
          Length = 111

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 56/103 (54%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           N+ +++ Q +++Q  + + ++ + + E +G AGGG+V   + G   L G+ ID   +  +
Sbjct: 9   NMQQLLQQAQKMQQDLARAQQELAATEVDGQAGGGLVKATVTGSGELRGLVIDPKAVDPE 68

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKF 105
           + E L DLI+AA   A+   + L   K   + +G+   PGL F
Sbjct: 69  DTETLADLIVAAVQAANDNAQQLQQAKLGPLAQGMGGMPGLGF 111


>gi|218960783|ref|YP_001740558.1| hypothetical protein CLOAM0449 [Candidatus Cloacamonas
           acidaminovorans]
 gi|167729440|emb|CAO80351.1| conserved hypothetical protein [Candidatus Cloacamonas
           acidaminovorans]
          Length = 107

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 62/98 (63%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           N+ +++ Q +++Q ++ K +E + +     ++GGGMV+V +NG+  +  +KID  ++  +
Sbjct: 7   NMQQLMKQAQKMQAEIMKQQEELANTVFSASSGGGMVTVEMNGQFEVVSLKIDPQVVDPE 66

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           +VE+LEDLI AA  +   K+ +  ++   ++T G+ IP
Sbjct: 67  DVEMLEDLITAAVQEVLNKVNEASSSVMSKVTGGINIP 104


>gi|91201431|emb|CAJ74491.1| conserved hypothetical protein [Candidatus Kuenenia
           stuttgartiensis]
          Length = 115

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 48/70 (68%)

Query: 31  EGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKKIEDLVATKT 90
           E  +GGGM++V +NGK  +  +KID  ++  ++V++LEDLI++A S A KK ++L  ++ 
Sbjct: 38  EATSGGGMITVHMNGKQEILSIKIDPEVVDPEDVQMLEDLILSAVSQALKKSQELYQSEM 97

Query: 91  QEITEGLPIP 100
            + T GL IP
Sbjct: 98  GKFTGGLNIP 107


>gi|295691234|ref|YP_003594927.1| hypothetical protein Cseg_3889 [Caulobacter segnis ATCC 21756]
 gi|295433137|gb|ADG12309.1| conserved hypothetical protein [Caulobacter segnis ATCC 21756]
          Length = 116

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 60/111 (54%), Gaps = 8/111 (7%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M ++  ++ Q + +Q K++  +  +     +G +GGGMV+V + G   L  V +D SL+ 
Sbjct: 8   MKDLGGLMKQAQAMQQKLQDAQARLAETTVDGTSGGGMVTVTLMGNGELVRVLMDESLVQ 67

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP------PGLKF 105
               E++ DLIIAAH+DA KK++   A   QE     P+       PG+KF
Sbjct: 68  PGEGEVIADLIIAAHADAKKKLDAKQAQLMQEAAG--PMAGLMGGLPGMKF 116


>gi|193212497|ref|YP_001998450.1| hypothetical protein Cpar_0834 [Chlorobaculum parvum NCIB 8327]
 gi|238692636|sp|B3QMU7|Y834_CHLP8 RecName: Full=UPF0133 protein Cpar_0834
 gi|193085974|gb|ACF11250.1| conserved hypothetical protein [Chlorobaculum parvum NCIB 8327]
          Length = 111

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 34/107 (31%), Positives = 59/107 (55%), Gaps = 2/107 (1%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N   M+ Q +E   KM+ +++ +  L +EG AGGGMV  ++NG+  L  + ID  ++ 
Sbjct: 3   MPNFGDMMKQLQEAGAKMQDVQKQLEKLVSEGEAGGGMVKAKVNGRQKLLELSIDPEIM- 61

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            D+V++++DL++AA + A      L   + Q+   G+  P  L   F
Sbjct: 62  -DDVDMVQDLVVAAVNKALDASAQLAQNEIQKAAGGMINPADLLKQF 107


>gi|154250712|ref|YP_001411536.1| hypothetical protein Plav_0256 [Parvibaculum lavamentivorans
          DS-1]
 gi|154154662|gb|ABS61879.1| conserved hypothetical protein [Parvibaculum lavamentivorans
          DS-1]
          Length = 102

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 49/72 (68%), Gaps = 3/72 (4%)

Query: 1  MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
          M +IMK   Q +++Q +M+ M+  +++ E EG AGGG+VS+ ++GK  +  V ID SL+ 
Sbjct: 1  MFDIMK---QAQQLQSRMQDMQAELSAAEVEGRAGGGLVSIVMSGKGEIKKVSIDPSLMK 57

Query: 61 EDNVEILEDLII 72
           +  EILEDLI+
Sbjct: 58 AEEHEILEDLIV 69


>gi|302878405|ref|YP_003846969.1| uncharacterized protein family UPF0133 [Gallionella
           capsiferriformans ES-2]
 gi|302581194|gb|ADL55205.1| uncharacterized protein family UPF0133 [Gallionella
           capsiferriformans ES-2]
          Length = 106

 Score = 57.8 bits (138), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 56/98 (57%), Gaps = 2/98 (2%)

Query: 10  QFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILED 69
           Q +++Q  M++ +  + ++E  G A  G+V V ++  + +  V +D S+L +   E+LED
Sbjct: 11  QAQQMQKNMQQAQAELATIEVVGQAASGLVKVTMSCAHEVRRVALDDSVLADK--EMLED 68

Query: 70  LIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           LI+ A +DA K++      +      G+ +PPG+K PF
Sbjct: 69  LIVLALNDAVKQVAATTEQRMSGFGAGMGLPPGMKLPF 106


>gi|118594960|ref|ZP_01552307.1| hypothetical protein MB2181_04790 [Methylophilales bacterium
           HTCC2181]
 gi|118440738|gb|EAV47365.1| hypothetical protein MB2181_04790 [Methylophilales bacterium
           HTCC2181]
          Length = 102

 Score = 57.8 bits (138), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 36/107 (33%), Positives = 63/107 (58%), Gaps = 10/107 (9%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M NIMK   Q + +Q  ++K +  + S++ +G+A  G+V + ++ K+ +  + ID S+L 
Sbjct: 6   MGNIMK---QAQMMQANLQKAQAELASIDVQGSASNGLVKIVMSCKHEVKKIDIDPSIL- 61

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           ED  E+LED+++ A  D  +KIE   ++K      G  +PPG+  PF
Sbjct: 62  EDK-EMLEDMLVVALKDTLQKIEATTSSKM-----GGLVPPGMNLPF 102


>gi|60594224|pdb|1YBX|A Chain A, Conserved Hypothetical Protein Cth-383 From Clostridium
           Thermocellum
 gi|60594225|pdb|1YBX|B Chain B, Conserved Hypothetical Protein Cth-383 From Clostridium
           Thermocellum
          Length = 143

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 35/101 (34%), Positives = 59/101 (58%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           NI  +V Q ++ Q   E+++E +     E +AGGG V+V   G+  +  + I   ++  D
Sbjct: 42  NINNLVKQAQKXQRDXERVQEELKEKTVEASAGGGAVTVVATGRKDIKEITIKPEVVDPD 101

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGL 103
           +VE L+DLI+AA ++A +K ++ V  +  +IT GL   PGL
Sbjct: 102 DVEXLQDLILAAVNEALRKADEXVTAEISKITGGLGGIPGL 142


>gi|239623039|ref|ZP_04666070.1| conserved hypothetical protein [Clostridiales bacterium
          1_7_47_FAA]
 gi|239522406|gb|EEQ62272.1| conserved hypothetical protein [Clostridiales bacterium
          1_7_47FAA]
          Length = 118

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 55/83 (66%), Gaps = 3/83 (3%)

Query: 1  MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
          M+N+MK   Q + +Q +ME+  + + + E    +GGG VSV ++GK  +  VK+   ++ 
Sbjct: 15 MNNLMK---QAQRMQRQMEEATKELEAKEYTATSGGGAVSVTVSGKKEVVSVKLSEEVVD 71

Query: 61 EDNVEILEDLIIAAHSDAHKKIE 83
           D++E+LEDLI+AA ++A +++E
Sbjct: 72 PDDIEMLEDLIMAATNEAFRQME 94


>gi|229816112|ref|ZP_04446430.1| hypothetical protein COLINT_03165 [Collinsella intestinalis DSM
          13280]
 gi|229808312|gb|EEP44096.1| hypothetical protein COLINT_03165 [Collinsella intestinalis DSM
          13280]
          Length = 108

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 56/83 (67%)

Query: 3  NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
          N+ +++ Q +++Q K+ + +ES+  +  + +AGGGMV V ++G   L  V ID   L  +
Sbjct: 5  NMQQLMKQAQQMQKKLAEAQESMNEVTVDASAGGGMVKVTVDGNMQLQSVTIDPDALDPE 64

Query: 63 NVEILEDLIIAAHSDAHKKIEDL 85
          +V++L+D+I+AA ++A++ + ++
Sbjct: 65 DVDMLQDMIVAAVNEAYRGVAEI 87


>gi|331087182|ref|ZP_08336252.1| hypothetical protein HMPREF0987_02555 [Lachnospiraceae bacterium
           9_1_43BFAA]
 gi|330408868|gb|EGG88329.1| hypothetical protein HMPREF0987_02555 [Lachnospiraceae bacterium
           9_1_43BFAA]
          Length = 118

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 59/94 (62%), Gaps = 3/94 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M+N+MK   Q +++Q +ME+  + + S E    AGGG V V ++G   +  VK+   ++ 
Sbjct: 16  MANLMK---QAQKMQRQMEEQAKEMESKEFTATAGGGAVEVTVSGTREVLKVKLQEEVVD 72

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEIT 94
            D++E+LEDLI+AA ++A +K+E   A+   ++T
Sbjct: 73  PDDIEMLEDLIVAATNEALRKVEAESASAMSKLT 106


>gi|325972846|ref|YP_004249037.1| hypothetical protein SpiBuddy_3037 [Spirochaeta sp. Buddy]
 gi|324028084|gb|ADY14843.1| UPF0133 protein ybaB [Spirochaeta sp. Buddy]
          Length = 101

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 53/81 (65%)

Query: 3  NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
          N  +++   K IQ  M++M++ + ++ A G+AG GMV V +NGK ++T V I++ L+   
Sbjct: 4  NPFELLKNMKGIQENMKRMQDLLPTITATGSAGAGMVEVTLNGKFIVTDVHIEKELVDPQ 63

Query: 63 NVEILEDLIIAAHSDAHKKIE 83
          +++ L+ LI +A +DA  KI+
Sbjct: 64 DIQTLQVLITSAFNDASAKIQ 84


>gi|319942675|ref|ZP_08016982.1| hypothetical protein HMPREF9464_02201 [Sutterella wadsworthensis
           3_1_45B]
 gi|319803758|gb|EFW00693.1| hypothetical protein HMPREF9464_02201 [Sutterella wadsworthensis
           3_1_45B]
          Length = 114

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 56/101 (55%), Gaps = 3/101 (2%)

Query: 7   MVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEI 66
           ++ Q +++Q K+ K++E +   E  G A  G V V I G +    +KID  ++  +++E+
Sbjct: 17  LMAQAQKMQQKLAKVQEELKQTEFTGEAANGAVKVVITGGHECRSIKIDPKVVDPEDIEM 76

Query: 67  LEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           LEDL++ A ++A +            + + +P+P G+K PF
Sbjct: 77  LEDLVMLAFNNAQQTCR---TESEAAMNKAVPLPAGMKLPF 114


>gi|311741092|ref|ZP_07714917.1| conserved hypothetical protein [Corynebacterium pseudogenitalium
           ATCC 33035]
 gi|311303894|gb|EFQ79972.1| conserved hypothetical protein [Corynebacterium pseudogenitalium
           ATCC 33035]
          Length = 122

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 59/104 (56%)

Query: 2   SNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFE 61
           +++  ++ Q  ++Q +++K +E I +   EG AG G+V V + G   L  ++ID+S++  
Sbjct: 11  NDMNDLIAQAAQVQAELQKAQEEILATNVEGQAGNGLVKVTMTGGAELVDLQIDKSVVDP 70

Query: 62  DNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKF 105
           ++V+ L+DL++ A  +AH     L   K   +++G+    G  F
Sbjct: 71  EDVDTLQDLVMGAFKEAHAAAGRLAQEKIGPLSQGMGGQGGPSF 114


>gi|99034678|ref|ZP_01314619.1| hypothetical protein Wendoof_01000561 [Wolbachia endosymbiont of
           Drosophila willistoni TSC#14030-0811.24]
          Length = 104

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 55/102 (53%), Gaps = 4/102 (3%)

Query: 10  QFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRIN----GKNMLTGVKIDRSLLFEDNVE 65
           Q +E+Q K+ + +E     E +G +GGG VSV +     G      V ID  L+  +  +
Sbjct: 3   QAQEMQKKLAEAQEKYVGKEFQGISGGGKVSVLVEVIKIGSYKAKKVNIDLELMRNEEKD 62

Query: 66  ILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           I+EDL+ AA +DA KK E+ +A  T  +   + +P G K PF
Sbjct: 63  IVEDLVTAAFNDAVKKAEEDMANATSGLAGMMGLPSGFKLPF 104


>gi|295106096|emb|CBL03639.1| conserved hypothetical protein TIGR00103 [Gordonibacter pamelaeae
           7-10-1-b]
          Length = 115

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 55/91 (60%)

Query: 10  QFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILED 69
           Q +++Q ++ K ++ I  +E E  AGGGMV V   G   +  + ID   +  ++V++L+D
Sbjct: 22  QAQKMQAELAKAQDEIKDMEYEATAGGGMVKVVATGDMAIKSIVIDPEAVDPEDVDLLQD 81

Query: 70  LIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           +++AA ++A + + D+ A +   +T G+ IP
Sbjct: 82  MVLAAVNEALRGMSDVSAQRLNSVTGGMNIP 112


>gi|256845536|ref|ZP_05550994.1| conserved hypothetical protein [Fusobacterium sp. 3_1_36A2]
 gi|294785167|ref|ZP_06750455.1| transcriptional regulatory protein [Fusobacterium sp. 3_1_27]
 gi|256719095|gb|EEU32650.1| conserved hypothetical protein [Fusobacterium sp. 3_1_36A2]
 gi|294486881|gb|EFG34243.1| transcriptional regulatory protein [Fusobacterium sp. 3_1_27]
          Length = 116

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 60/100 (60%), Gaps = 2/100 (2%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFE- 61
           N   +V Q + +Q +M +++E + S E   + GGG VSV++NG+  L  VK+   +L + 
Sbjct: 14  NQADIVKQAQVMQQQMLEVQEQLKSKEVSSSVGGGAVSVKVNGQKELIEVKLSDEVLKDA 73

Query: 62  -DNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
            ++ E+LEDLI+ A  DA  K E+L   +  ++T G+ IP
Sbjct: 74  ANDKEMLEDLILTAVKDAMAKAEELAEGEMAKVTGGINIP 113


>gi|291460809|ref|ZP_06600199.1| putative cytoplasmic protein [Oribacterium sp. oral taxon 078
          str. F0262]
 gi|291416582|gb|EFE90301.1| putative cytoplasmic protein [Oribacterium sp. oral taxon 078
          str. F0262]
          Length = 96

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 53/84 (63%), Gaps = 3/84 (3%)

Query: 1  MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
          M+N+MK   Q++++Q K+E+ +E +   E     GGG V V ++G+  +T + ID+  L 
Sbjct: 1  MNNLMK---QYQKMQKKLEETREELAKTEYSAQVGGGAVKVTVSGEKRITKLSIDKDALD 57

Query: 61 EDNVEILEDLIIAAHSDAHKKIED 84
           ++VE L+D+II A + A  ++E+
Sbjct: 58 PEDVETLQDMIITACNQALSEMEE 81


>gi|160936875|ref|ZP_02084239.1| hypothetical protein CLOBOL_01763 [Clostridium bolteae ATCC
          BAA-613]
 gi|158440065|gb|EDP17812.1| hypothetical protein CLOBOL_01763 [Clostridium bolteae ATCC
          BAA-613]
          Length = 118

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 55/83 (66%), Gaps = 3/83 (3%)

Query: 1  MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
          M+N+MK   Q + +Q +ME+  + + + E    +GGG VSV ++GK  +  VK+   ++ 
Sbjct: 15 MNNLMK---QAQRMQRQMEETTKELENKEYTAASGGGAVSVTVSGKKEVVSVKLSPDVVD 71

Query: 61 EDNVEILEDLIIAAHSDAHKKIE 83
           D++E+LEDLI+AA ++A +++E
Sbjct: 72 PDDIEMLEDLIVAATNEAFRQME 94


>gi|296329048|ref|ZP_06871554.1| conserved hypothetical protein [Fusobacterium nucleatum subsp.
           nucleatum ATCC 23726]
 gi|296153852|gb|EFG94664.1| conserved hypothetical protein [Fusobacterium nucleatum subsp.
           nucleatum ATCC 23726]
          Length = 116

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 60/100 (60%), Gaps = 2/100 (2%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFE- 61
           N   +V Q + +Q +M +++E + S E   + GGG VSV++NG+  L  VK+   +L + 
Sbjct: 14  NQADIVKQAQVMQQQMLEVQEQLKSKEVSSSVGGGAVSVKVNGQKELMEVKLSDEVLKDA 73

Query: 62  -DNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
            ++ E+LEDLI+ A  DA  K E+L   +  ++T G+ IP
Sbjct: 74  ANDKEMLEDLILTAVKDAMAKAEELAEGEMAKVTGGINIP 113


>gi|258545554|ref|ZP_05705788.1| cytoplasmic protein [Cardiobacterium hominis ATCC 15826]
 gi|258519254|gb|EEV88113.1| cytoplasmic protein [Cardiobacterium hominis ATCC 15826]
          Length = 109

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 34/101 (33%), Positives = 54/101 (53%), Gaps = 1/101 (0%)

Query: 7   MVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEI 66
           M+ + +E+Q  M+KM+  + +    G AG G V V +NG      V++    L ED  ++
Sbjct: 10  MMKKAQEMQENMQKMQAELANRHIVGIAGAGAVKVTLNGHYACQRVELTEEALKEDK-DM 68

Query: 67  LEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           LE L+ AA SDA  K+  +   +   +T G+ +P G K PF
Sbjct: 69  LEALLAAAISDASAKVNAMTQEEMANLTGGMGLPGGFKLPF 109


>gi|317126765|ref|YP_004093047.1| hypothetical protein Bcell_0024 [Bacillus cellulosilyticus DSM
           2522]
 gi|315471713|gb|ADU28316.1| Uncharacterized protein family UPF0133 [Bacillus cellulosilyticus
           DSM 2522]
          Length = 103

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 54/83 (65%)

Query: 18  MEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSD 77
           M K +E +     E +AGGGMV+V  +G+  +  ++I   ++  D+VE+L+DL++AA ++
Sbjct: 18  MAKAQEQLKEETVEASAGGGMVTVIASGEKKILDIQIKEEVVDPDDVEMLQDLVLAATNE 77

Query: 78  AHKKIEDLVATKTQEITEGLPIP 100
           A  K+++LV  K  + T+G+ IP
Sbjct: 78  ALVKVDELVNEKMGKFTKGMNIP 100


>gi|225163780|ref|ZP_03726079.1| conserved hypothetical protein [Opitutaceae bacterium TAV2]
 gi|224801610|gb|EEG19907.1| conserved hypothetical protein [Opitutaceae bacterium TAV2]
          Length = 102

 Score = 57.0 bits (136), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 57/100 (57%), Gaps = 1/100 (1%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M+ + K++ Q +++Q ++E ++  I S E +  +GGG V V+ING      +KID   L 
Sbjct: 1   MAGVGKLLKQAQKMQRQIETLQTEIGSKEFDITSGGGAVQVKINGSGQFLSLKIDPEFLK 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           ED   ++ D ++AA  DA ++ +D    +  ++T G  +P
Sbjct: 61  EDAT-VVSDTLLAAIQDAARQAKDYSEAEMGKVTSGFAMP 99


>gi|325663668|ref|ZP_08152072.1| hypothetical protein HMPREF0490_02813 [Lachnospiraceae bacterium
           4_1_37FAA]
 gi|325470161|gb|EGC73394.1| hypothetical protein HMPREF0490_02813 [Lachnospiraceae bacterium
           4_1_37FAA]
          Length = 118

 Score = 57.0 bits (136), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 59/94 (62%), Gaps = 3/94 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M+N+MK   Q +++Q +ME+  + + S E    AGGG V V ++G   +  VK+   ++ 
Sbjct: 16  MANLMK---QAQKMQRQMEEQAKEMESKEFTATAGGGAVEVTVSGTREVLKVKLQEEVVD 72

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEIT 94
            D++E+LEDL++AA ++A +K+E   A+   ++T
Sbjct: 73  PDDIEMLEDLVVAATNEALRKVEAESASAMSKLT 106


>gi|260589049|ref|ZP_05854962.1| putative cytoplasmic protein [Blautia hansenii DSM 20583]
 gi|331083245|ref|ZP_08332358.1| hypothetical protein HMPREF0992_01282 [Lachnospiraceae bacterium
           6_1_63FAA]
 gi|260540828|gb|EEX21397.1| putative cytoplasmic protein [Blautia hansenii DSM 20583]
 gi|330404326|gb|EGG83871.1| hypothetical protein HMPREF0992_01282 [Lachnospiraceae bacterium
           6_1_63FAA]
          Length = 118

 Score = 57.0 bits (136), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 38/107 (35%), Positives = 66/107 (61%), Gaps = 4/107 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M+N+MK   Q +++Q +ME+ ++++   E    AGGG V V ++GK  +  VK+   ++ 
Sbjct: 16  MNNLMK---QAQKMQRQMEENQKALEEKEFTAAAGGGAVEVTVSGKKEVLKVKLAEEVVD 72

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            D++E+LEDLI+AA ++A +K+E+  A    ++T G     G  FPF
Sbjct: 73  PDDIEMLEDLIVAATNEALRKMEEESAAVMSKLT-GGLGGMGGGFPF 118


>gi|319648543|ref|ZP_08002758.1| hypothetical protein HMPREF1012_03797 [Bacillus sp. BT1B_CT2]
 gi|317389391|gb|EFV70203.1| hypothetical protein HMPREF1012_03797 [Bacillus sp. BT1B_CT2]
          Length = 111

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/70 (38%), Positives = 49/70 (70%)

Query: 31  EGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKKIEDLVATKT 90
           EG AGGGMV+V++NG+  +  V I   ++  ++VE+L+DL++AA +DA KK++++     
Sbjct: 39  EGTAGGGMVTVKVNGQKEVIDVIIKEEVVDPEDVEMLQDLVLAATNDALKKVDEVTNETM 98

Query: 91  QEITEGLPIP 100
            + T+G+ +P
Sbjct: 99  GKFTKGMNMP 108


>gi|255324355|ref|ZP_05365474.1| conserved hypothetical protein [Corynebacterium tuberculostearicum
           SK141]
 gi|255298574|gb|EET77872.1| conserved hypothetical protein [Corynebacterium tuberculostearicum
           SK141]
          Length = 122

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 58/104 (55%)

Query: 2   SNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFE 61
           +++  ++ Q  ++Q  ++K +E I +   EG AG G+V V + G   L  ++ID+S++  
Sbjct: 11  NDMNDLIAQAAQVQADLQKAQEEILATNVEGQAGNGLVKVTMTGGAELVDLQIDKSVVDP 70

Query: 62  DNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKF 105
           ++V+ L+DL++ A  +AH     L   K   +++G+    G  F
Sbjct: 71  EDVDTLQDLVMGAFKEAHAAAGRLAQEKIGPLSQGMGGQGGPSF 114


>gi|319950864|ref|ZP_08024747.1| hypothetical protein ES5_14688 [Dietzia cinnamea P4]
 gi|319435477|gb|EFV90714.1| hypothetical protein ES5_14688 [Dietzia cinnamea P4]
          Length = 111

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 43/65 (66%)

Query: 25 ITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKKIED 84
          I +   +G AGGG+V+V + G   +TGV ID  ++  ++VE L+DL++ A  DAH K+++
Sbjct: 28 IAASTVDGQAGGGLVTVSMRGTGEVTGVTIDPKVVDPEDVETLQDLLVGAFGDAHTKVQE 87

Query: 85 LVATK 89
          L  ++
Sbjct: 88 LAESR 92


>gi|297182770|gb|ADI18924.1| uncharacterized protein conserved in bacteria [uncultured SAR11
           cluster bacterium HF0010_09O16]
          Length = 105

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 35/107 (32%), Positives = 62/107 (57%), Gaps = 2/107 (1%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M++  K++ + KE++ KM++ +E+I  L  EG +G   V V ++G+ ++  ++I   +L 
Sbjct: 1   MTDFTKILDKAKELEAKMKESQENIKKLRVEGVSGANSVKVILDGEGIVQKIEISDEILK 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           E N  +LEDLIIAA + A  K++D    +  +   G  I  G K+P 
Sbjct: 61  E-NKSVLEDLIIAAFNQAKTKLKDKTTEEISKTAGGFGI-DGFKWPL 105


>gi|221195019|ref|ZP_03568075.1| conserved hypothetical protein [Atopobium rimae ATCC 49626]
 gi|221184922|gb|EEE17313.1| conserved hypothetical protein [Atopobium rimae ATCC 49626]
          Length = 112

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 34/98 (34%), Positives = 56/98 (57%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           N  +M+ Q +++Q ++   +E         +AGGG V V ++G   LT +KID  +L  +
Sbjct: 12  NRNQMMAQARKMQEQLLAAQEKAALTLHTASAGGGAVKVTVSGDLRLTDLKIDPEVLDPE 71

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           +VE+L+D+IIAA +DA +  E   +     +T GL IP
Sbjct: 72  DVEMLQDMIIAATNDALESAEKAASQAMSSVTGGLNIP 109


>gi|52783878|ref|YP_089707.1| hypothetical protein BLi00029 [Bacillus licheniformis ATCC 14580]
 gi|163119174|ref|YP_077306.2| hypothetical protein BL02358 [Bacillus licheniformis ATCC 14580]
 gi|81386400|sp|Q65PK0|Y2358_BACLD RecName: Full=UPF0133 protein BLi00029/BL02358
 gi|52346380|gb|AAU39014.1| YaaK [Bacillus licheniformis ATCC 14580]
 gi|145902677|gb|AAU21668.2| conserved hypothetical YaaK [Bacillus licheniformis ATCC 14580]
          Length = 107

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/70 (38%), Positives = 49/70 (70%)

Query: 31  EGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKKIEDLVATKT 90
           EG AGGGMV+V++NG+  +  V I   ++  ++VE+L+DL++AA +DA KK++++     
Sbjct: 35  EGTAGGGMVTVKVNGQKEVIDVIIKEEVVDPEDVEMLQDLVLAATNDALKKVDEVTNETM 94

Query: 91  QEITEGLPIP 100
            + T+G+ +P
Sbjct: 95  GKFTKGMNMP 104


>gi|297582361|ref|YP_003698141.1| hypothetical protein Bsel_0024 [Bacillus selenitireducens MLS10]
 gi|297140818|gb|ADH97575.1| conserved hypothetical protein [Bacillus selenitireducens MLS10]
          Length = 100

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 52/83 (62%)

Query: 18  MEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSD 77
           M K +E +     E  AGGGMV V  +G+  +  ++I+   +  D+VE+LEDL++AA ++
Sbjct: 15  MAKAQEQLKDETVEATAGGGMVKVIASGEKRILDIQINEEAVDPDDVEMLEDLVLAATNE 74

Query: 78  AHKKIEDLVATKTQEITEGLPIP 100
           A  K++++V  K  + T+G+ IP
Sbjct: 75  ALNKVDEVVNEKMGKFTKGMNIP 97


>gi|326441840|ref|ZP_08216574.1| hypothetical protein SclaA2_12289 [Streptomyces clavuligerus ATCC
           27064]
          Length = 102

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 55/102 (53%)

Query: 4   IMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDN 63
           + +++ Q +++Q  + + +E +   E EG AGGG+V+  + G   L  + ID   +  ++
Sbjct: 1   MQQLLQQAQKMQQDLARAQEELARTEVEGQAGGGLVTATVTGSGELRALVIDPRAVDPED 60

Query: 64  VEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKF 105
            E L DL++AA   A++  + L   K   + +GL   PGL F
Sbjct: 61  TETLADLVVAAVQAANENAQQLQQNKLGPLAQGLGGMPGLPF 102


>gi|289807517|ref|ZP_06538146.1| hypothetical protein Salmonellaentericaenterica_25162 [Salmonella
          enterica subsp. enterica serovar Typhi str. AG3]
          Length = 72

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 34/70 (48%), Positives = 47/70 (67%), Gaps = 4/70 (5%)

Query: 1  MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
          + N+MK   Q +++Q KM+KM+E I  LE  G +G G+V V ING +    V+ID SLL 
Sbjct: 7  LGNLMK---QAQQMQEKMQKMQEEIAQLEVTGESGAGLVKVTINGAHNCRRVEIDPSLL- 62

Query: 61 EDNVEILEDL 70
          ED+ E+LEDL
Sbjct: 63 EDDKEMLEDL 72


>gi|225020183|ref|ZP_03709375.1| hypothetical protein CORMATOL_00185 [Corynebacterium matruchotii
          ATCC 33806]
 gi|224946927|gb|EEG28136.1| hypothetical protein CORMATOL_00185 [Corynebacterium matruchotii
          ATCC 33806]
          Length = 105

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 53/89 (59%), Gaps = 3/89 (3%)

Query: 1  MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
          MS+I+    Q +E+Q K++  +E I S    G AG G+VSV + G   +T V ID  ++ 
Sbjct: 7  MSDILA---QAQEMQAKLQAAQEEIMSSIVIGQAGNGLVSVSMQGSGTVTSVNIDPKVID 63

Query: 61 EDNVEILEDLIIAAHSDAHKKIEDLVATK 89
           ++ + L+DL++ A++DAH ++  +   K
Sbjct: 64 PEDPDTLQDLLVGAYNDAHGQLAKIAQDK 92


>gi|227506003|ref|ZP_03936052.1| conserved hypothetical protein [Corynebacterium striatum ATCC
          6940]
 gi|227197285|gb|EEI77333.1| conserved hypothetical protein [Corynebacterium striatum ATCC
          6940]
          Length = 116

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 47/73 (64%)

Query: 7  MVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEI 66
          ++ Q   +Q +++K +E I + + EG AG G+V V + G   L  ++ID+S++  +NV+ 
Sbjct: 14 LLAQAARVQAELQKAQEEILAAQVEGTAGNGLVKVVMTGGAELVDLQIDKSVVDPENVDT 73

Query: 67 LEDLIIAAHSDAH 79
          L+DL+I A  +AH
Sbjct: 74 LQDLVIGAFKEAH 86


>gi|255284259|ref|ZP_05348814.1| putative cytoplasmic protein [Bryantella formatexigens DSM 14469]
 gi|255265212|gb|EET58417.1| putative cytoplasmic protein [Bryantella formatexigens DSM 14469]
          Length = 114

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 62/97 (63%), Gaps = 3/97 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M+N+MK   Q +++Q +ME+ ++++   E    AGGG V V I+GK  +  V +   ++ 
Sbjct: 15  MNNLMK---QAQKMQKQMEENQKALEEKEFTAAAGGGAVEVTISGKREVLKVSLKEEVVD 71

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGL 97
            D++E+LEDLI+AA ++A +K+E+  +    ++T GL
Sbjct: 72  PDDIEMLEDLIMAATNEALRKVEEESSAVMSKLTGGL 108


>gi|15612598|ref|NP_240901.1| hypothetical protein BH0035 [Bacillus halodurans C-125]
 gi|12585382|sp|Q9JWQ5|Y035_BACHD RecName: Full=UPF0133 protein BH0035
 gi|7007420|dbj|BAA90837.1| YaaK [Bacillus halodurans]
 gi|10172647|dbj|BAB03754.1| BH0035 [Bacillus halodurans C-125]
          Length = 103

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 47/70 (67%)

Query: 31  EGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKKIEDLVATKT 90
           E  AGGGMV+V  +G   +  V+I   ++  D+VE+L+DLI+AA ++A KK+++LV    
Sbjct: 31  EATAGGGMVTVVASGDKRILDVRISEDVVDPDDVEMLQDLILAATNEALKKVDELVEQDM 90

Query: 91  QEITEGLPIP 100
            + T+GL +P
Sbjct: 91  GKFTKGLNMP 100


>gi|58584690|ref|YP_198263.1| hypothetical protein Wbm0433 [Wolbachia endosymbiont strain TRS of
           Brugia malayi]
 gi|58419006|gb|AAW71021.1| Uncharacterized protein conserved in bacteria, YbaB family
           [Wolbachia endosymbiont strain TRS of Brugia malayi]
          Length = 110

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 60/111 (54%), Gaps = 7/111 (6%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRIN----GKNMLTGVKIDR 56
            + IMK   Q +E+Q K+ + +E     E +G +GGG VSV +     G      V ID 
Sbjct: 3   FNQIMK---QAQEMQKKLTEAQEKYIGKEFQGISGGGKVSVLVGIIKIGSYKAKKVSIDL 59

Query: 57  SLLFEDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            L+  +  +I+EDL+ AA +DA KK E+ +A  T ++   + + PG K PF
Sbjct: 60  ELMRNEEKDIVEDLVTAAFNDAIKKAEEDMANVTSDLAGMMGLLPGFKLPF 110


>gi|257783926|ref|YP_003179143.1| hypothetical protein Apar_0116 [Atopobium parvulum DSM 20469]
 gi|257472433|gb|ACV50552.1| conserved hypothetical protein [Atopobium parvulum DSM 20469]
          Length = 112

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 59/98 (60%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           N  +M+ Q +++Q ++ + ++  + ++A  +AGGG V V  +G   LT + ID   +  +
Sbjct: 12  NRNQMMAQARKMQEQLLEAQQKASLMQATASAGGGAVKVTASGDLRLTNITIDPEAIDPE 71

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           ++E+L+D+I+AA +DA +  E   + +   +T GL IP
Sbjct: 72  DIEMLQDMILAAVNDALESAESQASAQMSAVTGGLNIP 109


>gi|307719902|ref|YP_003875434.1| hypothetical protein STHERM_c22340 [Spirochaeta thermophila DSM
          6192]
 gi|306533627|gb|ADN03161.1| hypothetical protein STHERM_c22340 [Spirochaeta thermophila DSM
          6192]
          Length = 101

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 54/89 (60%)

Query: 3  NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
          N   ++ Q +++  +M++++E++T L   G+AGGGMV V + G   +  VKID   +  +
Sbjct: 2  NPFDVLKQLQDLPERMQRIQETLTELRVTGSAGGGMVEVEVGGDFSVHRVKIDPEAVDPN 61

Query: 63 NVEILEDLIIAAHSDAHKKIEDLVATKTQ 91
          +V +LEDL+ AA ++A  K+   +  K Q
Sbjct: 62 DVALLEDLVKAALTNALGKLRTELVGKLQ 90


>gi|298244236|ref|ZP_06968042.1| conserved hypothetical protein [Ktedonobacter racemifer DSM 44963]
 gi|297551717|gb|EFH85582.1| conserved hypothetical protein [Ktedonobacter racemifer DSM 44963]
          Length = 98

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 52/91 (57%)

Query: 10  QFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILED 69
           + +++Q ++ KM+E +   +  G AGGG V++ ++GK  +TGVKID      +++E LE 
Sbjct: 5   ELQKMQQRLVKMQEDLEKNQFTGTAGGGAVTIEMSGKYEVTGVKIDPEAFNAEDIEELEV 64

Query: 70  LIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           ++ AA  DA  K+ D         T G+ IP
Sbjct: 65  MVRAAAKDAFDKVTDAQQKLVNNATGGMRIP 95


>gi|111035802|emb|CAL29429.1| Conserved hypothetical protein [Wolbachia endosymbiont of
           Onchocerca volvulus]
          Length = 110

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 58/111 (52%), Gaps = 7/111 (6%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRIN----GKNMLTGVKIDR 56
            S IMK   Q +E+Q K+ + +E     E +G +GGG VSV +     G      + ID 
Sbjct: 3   FSQIMK---QAQEMQKKLIEAQEKYVGKEFQGISGGGKVSVLVEVVKIGSYKAKKINIDL 59

Query: 57  SLLFEDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
             +  +  +I+EDL++AA +DA KK E  +   T ++   + +P G K PF
Sbjct: 60  EFIRNEEKDIVEDLVVAAFNDAIKKAEAEMTNATSDLASMIGLPSGFKLPF 110


>gi|313906299|ref|ZP_07839642.1| conserved hypothetical protein [Eubacterium cellulosolvens 6]
 gi|313468855|gb|EFR64214.1| conserved hypothetical protein [Eubacterium cellulosolvens 6]
          Length = 115

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 62/94 (65%), Gaps = 3/94 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M+N+MK   Q + +Q +ME+ ++ +   E   +AGGG++ V ++GK  +T VKID   + 
Sbjct: 14  MNNLMK---QAQRMQRQMEEQQKELEEKEFTASAGGGVIEVTVSGKREVTKVKIDPEAVD 70

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEIT 94
            D+VE+L+DLI+AA ++A K++E+  A    ++T
Sbjct: 71  PDDVEMLQDLIVAATNEALKQVEEAQAENMSKMT 104


>gi|93005629|ref|YP_580066.1| hypothetical protein Pcryo_0799 [Psychrobacter cryohalolentis K5]
 gi|122415702|sp|Q1QCM1|Y799_PSYCK RecName: Full=UPF0133 protein Pcryo_0799
 gi|92393307|gb|ABE74582.1| conserved hypothetical protein 103 [Psychrobacter cryohalolentis
           K5]
          Length = 109

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 57/96 (59%), Gaps = 1/96 (1%)

Query: 12  KEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLI 71
           K+++  +E  K+ + + E    AG G+V V + G++++  + ID SLL ED  +++EDLI
Sbjct: 15  KKVEANVENAKKELGNKEVHAEAGSGLVKVTMTGRHVVKRLTIDPSLL-EDEPDMIEDLI 73

Query: 72  IAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            AA +DA ++ + L        T G+ +PPG++  F
Sbjct: 74  AAAINDAVRQADALYEETMAGATSGMGLPPGMQGMF 109


>gi|315187317|gb|EFU21073.1| uncharacterized protein family UPF0133 [Spirochaeta thermophila
          DSM 6578]
          Length = 101

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 54/89 (60%)

Query: 3  NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
          N   ++ Q +++  +M++++E++T L   G+AGGGMV V + G   +  VKID   +  +
Sbjct: 2  NPFDVLKQLQDLPERMQRIQETLTELRVTGSAGGGMVEVEVGGDFSVHRVKIDPEAVDPN 61

Query: 63 NVEILEDLIIAAHSDAHKKIEDLVATKTQ 91
          +V +LEDL+ AA ++A  K+   +  K Q
Sbjct: 62 DVALLEDLVKAALTNALGKLRTELVGKLQ 90


>gi|312137877|ref|YP_004005213.1| hypothetical protein REQ_03880 [Rhodococcus equi 103S]
 gi|325673356|ref|ZP_08153048.1| hypothetical protein HMPREF0724_10830 [Rhodococcus equi ATCC 33707]
 gi|311887216|emb|CBH46525.1| conserved hypothetical protein [Rhodococcus equi 103S]
 gi|325555946|gb|EGD25616.1| hypothetical protein HMPREF0724_10830 [Rhodococcus equi ATCC 33707]
          Length = 107

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 48/81 (59%), Gaps = 3/81 (3%)

Query: 25  ITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKKIED 84
           ++  E  G AGGG+V+  + G   + G+ ID  ++  +++E L+DL+I A +DA  K ++
Sbjct: 30  MSQAEVTGQAGGGLVTATVKGTGEVVGLTIDPKVVDPEDIETLQDLVIGAIADASNKAQE 89

Query: 85  LVATKTQEITEGLPIPPGLKF 105
           + A+K   +  GL   PGL F
Sbjct: 90  IAASKLGPLAGGL---PGLPF 107


>gi|295100448|emb|CBK97993.1| conserved hypothetical protein TIGR00103 [Faecalibacterium
           prausnitzii L2-6]
          Length = 112

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/91 (32%), Positives = 56/91 (61%)

Query: 10  QFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILED 69
           Q +++Q  M+  +  + + E  G+A G MV+VR+NGK+ + G+ I    +  D++E+LED
Sbjct: 20  QAQKMQDDMKAKQAELEAAEYTGSASGEMVTVRMNGKHEILGITIKPEAVDPDDIEMLED 79

Query: 70  LIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           L+ AA +   K++++    +  ++T GL IP
Sbjct: 80  LVAAAVNATVKQVDETAEAEMGKLTGGLNIP 110


>gi|256828010|ref|YP_003156738.1| hypothetical protein Dbac_0195 [Desulfomicrobium baculatum DSM
           4028]
 gi|256577186|gb|ACU88322.1| conserved hypothetical protein [Desulfomicrobium baculatum DSM
           4028]
          Length = 98

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/95 (34%), Positives = 61/95 (64%), Gaps = 2/95 (2%)

Query: 6   KMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVE 65
           +++ Q + +Q KM + +E I   E E + GGGMV+V+      +  V ID ++L  ++VE
Sbjct: 3   ELIRQAQMMQKKMLRTQEEIGKKEVETSVGGGMVTVKATCSGEILSVVIDPAVL--EDVE 60

Query: 66  ILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           +L+D+++AA ++A KK +D++  +  +IT G+ IP
Sbjct: 61  MLQDMVLAAVNEALKKGKDMMQGEMAQITGGMKIP 95


>gi|305680093|ref|ZP_07402903.1| DNA-binding protein, YbaB/EbfC family [Corynebacterium matruchotii
           ATCC 14266]
 gi|305660713|gb|EFM50210.1| DNA-binding protein, YbaB/EbfC family [Corynebacterium matruchotii
           ATCC 14266]
          Length = 115

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 53/89 (59%), Gaps = 3/89 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           MS+I+    Q +E+Q K++  +E I S    G AG G+VSV + G   +T V ID  ++ 
Sbjct: 17  MSDILA---QAQEMQAKLQAAQEEIMSSIVIGQAGNGLVSVSMQGSGTVTSVNIDPKVID 73

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATK 89
            ++ + L+DL++ A++DAH ++  +   K
Sbjct: 74  PEDPDTLQDLLVGAYNDAHGQLAKIAQDK 102


>gi|227832005|ref|YP_002833712.1| hypothetical protein cauri_0175 [Corynebacterium aurimucosum ATCC
           700975]
 gi|262184139|ref|ZP_06043560.1| hypothetical protein CaurA7_09120 [Corynebacterium aurimucosum ATCC
           700975]
 gi|227453021|gb|ACP31774.1| hypothetical protein cauri_0175 [Corynebacterium aurimucosum ATCC
           700975]
          Length = 126

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 57/96 (59%)

Query: 2   SNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFE 61
           +++ +++ Q   +Q ++EK ++ I +   EG+AG G+V V + G   L  V ID+S++  
Sbjct: 11  NDMNEILAQAARVQAELEKAQKEILAATVEGSAGNGLVKVTMTGGAELQSVSIDKSVVDP 70

Query: 62  DNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGL 97
           ++++ L+DLI+ A  +AH     L   K   +++G+
Sbjct: 71  EDIDTLQDLIVGAFKEAHAAAGRLAQEKIGPLSQGM 106


>gi|160946875|ref|ZP_02094078.1| hypothetical protein PEPMIC_00836 [Parvimonas micra ATCC 33270]
 gi|158447259|gb|EDP24254.1| hypothetical protein PEPMIC_00836 [Parvimonas micra ATCC 33270]
          Length = 113

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 58/91 (63%)

Query: 10  QFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILED 69
           Q +++Q ++E  ++ +   E    +GGG V V +NGK  +  +K+D  ++  D++E+L+D
Sbjct: 21  QMQKMQRELENTQKMLDEEEVSATSGGGAVEVTVNGKKEVLSIKLDPEVVDPDDIEMLQD 80

Query: 70  LIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           LI+ A ++A++K ++   ++  +IT G+ IP
Sbjct: 81  LIMTAINEANRKAQEKHDSEINKITGGINIP 111


>gi|153854737|ref|ZP_01995971.1| hypothetical protein DORLON_01969 [Dorea longicatena DSM 13814]
 gi|149752644|gb|EDM62575.1| hypothetical protein DORLON_01969 [Dorea longicatena DSM 13814]
          Length = 117

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 55/83 (66%), Gaps = 3/83 (3%)

Query: 1  MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
          M+N+MK   Q +++Q +ME+  + + + E    AGGG V V ++G   +  VK+D  ++ 
Sbjct: 16 MANLMK---QAQKMQRQMEEQAKEMETKEFSATAGGGAVEVTVSGSKKILKVKLDEEVVD 72

Query: 61 EDNVEILEDLIIAAHSDAHKKIE 83
           D+VE+LEDL++AA ++A +K++
Sbjct: 73 PDDVEMLEDLLVAAVNEALEKVD 95


>gi|221233208|ref|YP_002515644.1| hypothetical protein CCNA_00269 [Caulobacter crescentus NA1000]
 gi|21264121|sp|Q9ABF9|Y268_CAUCR RecName: Full=UPF0133 protein CC_0268
 gi|254801442|sp|B8GYD9|Y269_CAUCN RecName: Full=UPF0133 protein CCNA_00269
 gi|220962380|gb|ACL93736.1| hypothetical transcriptional regulatory protein [Caulobacter
           crescentus NA1000]
          Length = 109

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 59/111 (53%), Gaps = 8/111 (7%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M ++  ++ Q + +Q K+   +  +     +G +GGGMV+V + G   L  V +D SL+ 
Sbjct: 1   MKDLGGLMKQAQAMQQKLADAQARLAETTVDGTSGGGMVTVTLMGNGELVRVLMDESLVQ 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP------PGLKF 105
               E++ DLIIAAH+DA KK++   A   Q+     P+       PG+KF
Sbjct: 61  PGEGEVIADLIIAAHADAKKKLDAKQAQMMQDAAG--PMAGLMGGLPGMKF 109


>gi|213580000|ref|ZP_03361826.1| hypothetical protein SentesTyph_01823 [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-0664]
          Length = 62

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 41/63 (65%), Gaps = 1/63 (1%)

Query: 45  GKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLK 104
           G +    V+ID SLL ED+ E+LEDL+ AA +DA ++IE+    K   ++ G+ +PPG K
Sbjct: 1   GAHNCRRVEIDPSLL-EDDKEMLEDLVAAAFNDAARRIEETQKEKMASVSSGMQLPPGFK 59

Query: 105 FPF 107
            PF
Sbjct: 60  MPF 62


>gi|163846114|ref|YP_001634158.1| hypothetical protein Caur_0522 [Chloroflexus aurantiacus J-10-fl]
 gi|222523850|ref|YP_002568320.1| hypothetical protein Chy400_0558 [Chloroflexus sp. Y-400-fl]
 gi|189040235|sp|A9WEA9|Y522_CHLAA RecName: Full=UPF0133 protein Caur_0522
 gi|254806495|sp|B9LJ33|Y558_CHLSY RecName: Full=UPF0133 protein Chy400_0558
 gi|163667403|gb|ABY33769.1| conserved hypothetical protein [Chloroflexus aurantiacus J-10-fl]
 gi|222447729|gb|ACM51995.1| conserved hypothetical protein [Chloroflexus sp. Y-400-fl]
          Length = 100

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 49/78 (62%)

Query: 20 KMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAH 79
          K++E + +   EG AGGG ++V++NG   +  + I   ++  D+VE+L+DL++ A +DA 
Sbjct: 19 KVQEELAATIVEGTAGGGAITVKMNGHREVQSITISPEVVDPDDVEMLQDLLLVAINDAS 78

Query: 80 KKIEDLVATKTQEITEGL 97
          +K + L   + Q +T GL
Sbjct: 79 RKAQQLAEERMQPLTGGL 96


>gi|295094179|emb|CBK83270.1| conserved hypothetical protein TIGR00103 [Coprococcus sp. ART55/1]
          Length = 116

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 66/105 (62%), Gaps = 4/105 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M+N+MK   Q +++Q +ME+  +++     E + GGG+V+ +++GK  L  +K+D  ++ 
Sbjct: 16  MNNLMK---QAQKMQKQMEETTKTLEDKVYESSVGGGVVTAKVSGKKELMEIKLDPEVVD 72

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKF 105
            D++E LEDLII+A ++A +  ED   +   +I+ G+ +  GL F
Sbjct: 73  PDDIETLEDLIISAVNEALRAQEDDYNSSMGKISGGMGL-GGLPF 116


>gi|254302878|ref|ZP_04970236.1| hypothetical protein FNP_0512 [Fusobacterium nucleatum subsp.
           polymorphum ATCC 10953]
 gi|148323070|gb|EDK88320.1| hypothetical protein FNP_0512 [Fusobacterium nucleatum subsp.
           polymorphum ATCC 10953]
          Length = 116

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 60/100 (60%), Gaps = 2/100 (2%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFE- 61
           N   +V Q + +Q +M +++E + S E   + GGG VSV++NG+  L  VK+   +L + 
Sbjct: 14  NQADIVKQAQVMQQQMLEVQEQLKSKEVSSSVGGGAVSVKVNGQKELIEVKLSDEVLKDA 73

Query: 62  -DNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
            ++ E+LEDLI+ A  DA  K ++L   +  ++T G+ IP
Sbjct: 74  ANDKEMLEDLILTAVKDAMAKADELAEGEMAKVTGGINIP 113


>gi|320527138|ref|ZP_08028325.1| conserved hypothetical protein TIGR00103 [Solobacterium moorei
           F0204]
 gi|320132466|gb|EFW25009.1| conserved hypothetical protein TIGR00103 [Solobacterium moorei
           F0204]
          Length = 101

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 34/98 (34%), Positives = 58/98 (59%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           +I K++ Q +++Q  + K++E + + E EG AGG  V V +NG+N +  V+I   L+  D
Sbjct: 2   DIQKLMEQARQMQDNLGKIEEELNATEYEGKAGGNGVKVVVNGRNEVQSVEIADDLMSVD 61

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           N E+L+DLI+ A ++A +K      +K    T GL + 
Sbjct: 62  NKEMLQDLILIAVNEAVEKAFQDRESKLGSATSGLNLS 99


>gi|224475612|ref|YP_002633218.1| hypothetical protein Sca_0120 [Staphylococcus carnosus subsp.
           carnosus TM300]
 gi|254799983|sp|B9DLF6|Y120_STACT RecName: Full=UPF0133 protein Sca_0120
 gi|222420219|emb|CAL27033.1| conserved hypothetical protein [Staphylococcus carnosus subsp.
           carnosus TM300]
          Length = 105

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/79 (37%), Positives = 50/79 (63%)

Query: 22  KESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKK 81
           +E +   + EG+AGGGMV V + G   +  V ID   +  D+VE+L+DL++AA ++A  K
Sbjct: 25  QEKLKDEKVEGSAGGGMVKVVVTGHKEVVDVVIDEEAVDPDDVEMLQDLVLAATNEAMNK 84

Query: 82  IEDLVATKTQEITEGLPIP 100
            ++L + +  + T+GL IP
Sbjct: 85  ADELTSERLGKHTKGLNIP 103


>gi|238899120|ref|YP_002924802.1| hypothetical protein HDEF_2088 [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
 gi|229466880|gb|ACQ68654.1| conserved hypothetical protein [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
          Length = 108

 Score = 55.5 bits (132), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 34/101 (33%), Positives = 58/101 (57%), Gaps = 4/101 (3%)

Query: 11  FKE---IQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF-EDNVEI 66
           FKE   +Q KM++++  I  L+  G +G G+V + ING      VKID SLL  E + ++
Sbjct: 8   FKEAQKMQDKMQEIQAEIDKLKITGKSGNGLVEIVINGACNCIEVKIDSSLLVKETDKKV 67

Query: 67  LEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           +E+L+ AA +   K++ +    K Q +++ + +   LK PF
Sbjct: 68  VEELVAAAFNHGVKQLSEQKTKKIQLLSKNISLTSDLKLPF 108


>gi|163784537|ref|ZP_02179396.1| hypothetical protein HG1285_04963 [Hydrogenivirga sp. 128-5-R1-1]
 gi|159880192|gb|EDP73837.1| hypothetical protein HG1285_04963 [Hydrogenivirga sp. 128-5-R1-1]
          Length = 110

 Score = 55.5 bits (132), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 67/108 (62%), Gaps = 5/108 (4%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           + N+MKM    K++Q  ++  KE + + E     GGGMV V  NG   +  ++ID+SLL 
Sbjct: 7   LGNMMKM---LKDMQENIKTAKEELKNEEIIVEVGGGMVKVIENGLGEILDIQIDKSLLN 63

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP-PGLKFPF 107
           E+N E+L+DL+I+A ++A+ + +++++ K  + + GLP   PGL   F
Sbjct: 64  EENAEVLKDLLISALNEANVRSKEVMSEKMAKAS-GLPSNIPGLGNLF 110


>gi|303256851|ref|ZP_07342865.1| conserved hypothetical protein [Burkholderiales bacterium 1_1_47]
 gi|330998902|ref|ZP_08322629.1| DNA-binding protein, YbaB/EbfC family [Parasutterella
           excrementihominis YIT 11859]
 gi|302860342|gb|EFL83419.1| conserved hypothetical protein [Burkholderiales bacterium 1_1_47]
 gi|329576116|gb|EGG57635.1| DNA-binding protein, YbaB/EbfC family [Parasutterella
           excrementihominis YIT 11859]
          Length = 108

 Score = 55.5 bits (132), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 51/84 (60%), Gaps = 1/84 (1%)

Query: 18  MEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED-NVEILEDLIIAAHS 76
           ++K ++ + ++E  G AG GMV V +  KN+   V ID SL+  D + E+LEDL++ A +
Sbjct: 24  IQKAQKELETIEVTGEAGNGMVKVTMTCKNVCRRVMIDDSLVGADADREMLEDLLLTAIN 83

Query: 77  DAHKKIEDLVATKTQEITEGLPIP 100
           DA KK+E     K  + T G+ +P
Sbjct: 84  DASKKVEAETNAKISKATGGMKLP 107


>gi|325264934|ref|ZP_08131662.1| transcriptional regulatory protein [Clostridium sp. D5]
 gi|324029923|gb|EGB91210.1| transcriptional regulatory protein [Clostridium sp. D5]
          Length = 117

 Score = 55.5 bits (132), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 57/84 (67%), Gaps = 3/84 (3%)

Query: 1  MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
          M+N+MK   Q +++Q +ME+  + + + E    AGGG V V I+GK  +  VK++  ++ 
Sbjct: 16 MANLMK---QAQKMQRQMEEQAKELETKEYTATAGGGAVEVAISGKREVLRVKLEEEVVD 72

Query: 61 EDNVEILEDLIIAAHSDAHKKIED 84
           +++E+L+DLI+AA ++A +K+++
Sbjct: 73 PEDIEMLQDLIVAATNEALRKVDE 96


>gi|16124523|ref|NP_419087.1| hypothetical protein CC_0268 [Caulobacter crescentus CB15]
 gi|25302530|pir||C87282 conserved hypothetical protein CC0268 [imported] - Caulobacter
           crescentus
 gi|13421403|gb|AAK22255.1| conserved hypothetical protein [Caulobacter crescentus CB15]
          Length = 102

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 54/102 (52%), Gaps = 8/102 (7%)

Query: 10  QFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILED 69
           Q + +Q K+   +  +     +G +GGGMV+V + G   L  V +D SL+     E++ D
Sbjct: 3   QAQAMQQKLADAQARLAETTVDGTSGGGMVTVTLMGNGELVRVLMDESLVQPGEGEVIAD 62

Query: 70  LIIAAHSDAHKKIEDLVATKTQEITEGLPIP------PGLKF 105
           LIIAAH+DA KK++   A   Q+     P+       PG+KF
Sbjct: 63  LIIAAHADAKKKLDAKQAQMMQDAAG--PMAGLMGGLPGMKF 102


>gi|288554627|ref|YP_003426562.1| hypothetical protein BpOF4_08060 [Bacillus pseudofirmus OF4]
 gi|288545787|gb|ADC49670.1| hypothetical protein BpOF4_08060 [Bacillus pseudofirmus OF4]
          Length = 103

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 50/79 (63%)

Query: 22  KESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKK 81
           +E +     E  AGGGMV+V  +G   +  V+I   ++  D++++L+DLI+AA ++A KK
Sbjct: 22  QEELKEKTVEATAGGGMVTVIASGDKRIVDVQISEDVVDPDDIDMLQDLILAATNEALKK 81

Query: 82  IEDLVATKTQEITEGLPIP 100
           +++LV     + T+G+ IP
Sbjct: 82  VDELVEQDMGKFTKGMNIP 100


>gi|167772015|ref|ZP_02444068.1| hypothetical protein ANACOL_03389 [Anaerotruncus colihominis DSM
           17241]
 gi|167665813|gb|EDS09943.1| hypothetical protein ANACOL_03389 [Anaerotruncus colihominis DSM
           17241]
          Length = 118

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 60/99 (60%)

Query: 2   SNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFE 61
            N+  M+ Q +++Q  M+  +E +  L  +  +GGGMV V I+GK  +  + +   ++  
Sbjct: 17  QNMNAMIRQAQKMQEDMKAKQEELEQLTFKTTSGGGMVEVTISGKKEVQSIVLKPEIVDP 76

Query: 62  DNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           +++E+L+DLI+AA ++A + +E+    + ++IT  L IP
Sbjct: 77  EDIEMLQDLIVAAVNEAIRTVEETTNAEMEKITGSLQIP 115


>gi|329849470|ref|ZP_08264316.1| hypothetical protein ABI_23630 [Asticcacaulis biprosthecum C19]
 gi|328841381|gb|EGF90951.1| hypothetical protein ABI_23630 [Asticcacaulis biprosthecum C19]
          Length = 109

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 52/90 (57%)

Query: 3  NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
          +  +M+ Q + +Q K+ +     +   A G++GGG+V++ + G   +T + ID SLL   
Sbjct: 2  DFAQMMKQAQIVQQKLHEADAKTSESTATGSSGGGLVTLELKGSGEMTVLNIDESLLAPG 61

Query: 63 NVEILEDLIIAAHSDAHKKIEDLVATKTQE 92
            E+L DLI AA+ +A +K+E+L     QE
Sbjct: 62 EGEVLSDLIRAAYGEARRKLEELNRQYLQE 91


>gi|58699393|ref|ZP_00374155.1| conserved hypothetical protein TIGR00103 [Wolbachia endosymbiont of
           Drosophila ananassae]
 gi|58699589|ref|ZP_00374290.1| conserved hypothetical protein TIGR00103 [Wolbachia endosymbiont of
           Drosophila ananassae]
 gi|58533893|gb|EAL58191.1| conserved hypothetical protein TIGR00103 [Wolbachia endosymbiont of
           Drosophila ananassae]
 gi|58534091|gb|EAL58328.1| conserved hypothetical protein TIGR00103 [Wolbachia endosymbiont of
           Drosophila ananassae]
          Length = 98

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 34/98 (34%), Positives = 53/98 (54%), Gaps = 4/98 (4%)

Query: 14  IQGKMEKMKESITSLEAEGNAGGGMVSVRIN----GKNMLTGVKIDRSLLFEDNVEILED 69
           +Q K+ + +E     E +G +GGG VSV +     G      V ID  L+  +  +I+ED
Sbjct: 1   MQKKLAEAQEKYVGKEFQGISGGGKVSVLVEVIKIGSYKAKKVNIDLELMRNEEKDIVED 60

Query: 70  LIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           L+ AA +DA KK E+ +A  T ++   + +P G K PF
Sbjct: 61  LVTAAFNDAVKKAEEDMANATSDLAGMMGLPSGFKLPF 98


>gi|222152177|ref|YP_002561337.1| hypothetical protein MCCL_1934 [Macrococcus caseolyticus JCSC5402]
 gi|254800664|sp|B9E8X3|Y1934_MACCJ RecName: Full=UPF0133 protein MCCL_1934
 gi|222121306|dbj|BAH18641.1| conserved hypothetical protein [Macrococcus caseolyticus JCSC5402]
          Length = 106

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 52/82 (63%), Gaps = 4/82 (4%)

Query: 19  EKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDA 78
           EK+KE       EG AGGGMV+V ++G   +  V I   ++  +++E+L+DL++AA +DA
Sbjct: 26  EKLKEE----RIEGTAGGGMVTVVVSGHKEVLDVIIKEEVVDPEDIEMLQDLVLAATNDA 81

Query: 79  HKKIEDLVATKTQEITEGLPIP 100
             K +D+ A +  + T+GL IP
Sbjct: 82  LTKADDVTAQRLGQHTKGLNIP 103


>gi|296113065|ref|YP_003627003.1| hypothetical protein MCR_0845 [Moraxella catarrhalis RH4]
 gi|295920759|gb|ADG61110.1| conserved hypothetical protein [Moraxella catarrhalis RH4]
 gi|326560441|gb|EGE10823.1| hypothetical protein E9G_05807 [Moraxella catarrhalis 7169]
 gi|326561645|gb|EGE11982.1| hypothetical protein E9K_08539 [Moraxella catarrhalis 103P14B1]
 gi|326562608|gb|EGE12919.1| hypothetical protein E9M_04901 [Moraxella catarrhalis 46P47B1]
 gi|326563582|gb|EGE13836.1| hypothetical protein E9O_08039 [Moraxella catarrhalis 12P80B1]
 gi|326565824|gb|EGE15986.1| hypothetical protein E9Q_09625 [Moraxella catarrhalis BC1]
 gi|326570479|gb|EGE20519.1| hypothetical protein E9U_03793 [Moraxella catarrhalis BC8]
 gi|326571163|gb|EGE21187.1| hypothetical protein E9S_05562 [Moraxella catarrhalis BC7]
 gi|326573453|gb|EGE23421.1| hypothetical protein E9Y_09411 [Moraxella catarrhalis 101P30B1]
 gi|326575649|gb|EGE25572.1| hypothetical protein E9W_01705 [Moraxella catarrhalis CO72]
 gi|326577113|gb|EGE27007.1| hypothetical protein EA1_04155 [Moraxella catarrhalis O35E]
          Length = 110

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 57/94 (60%), Gaps = 1/94 (1%)

Query: 14  IQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIA 73
           ++  +E  K S+ + E +G AG G+V V + G++++  + ID SL+ +D  +++EDL+ A
Sbjct: 17  VEKNVEAAKASLATKEVQGEAGNGLVKVTMTGRHVVKRLAIDPSLM-DDEPDMIEDLVAA 75

Query: 74  AHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           A +DA ++ ++L        T G+ +PP +K  F
Sbjct: 76  AINDAVRQADELYEEVMAGATTGMGLPPSMKGLF 109


>gi|291482390|dbj|BAI83465.1| hypothetical protein BSNT_00040 [Bacillus subtilis subsp. natto
           BEST195]
          Length = 100

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 53/83 (63%)

Query: 18  MEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSD 77
           M K +E +     EG AGGGMV+V+ NG+  +  V I   ++  +++++L+DL++AA ++
Sbjct: 15  MAKAQEELAEKVVEGTAGGGMVTVKANGQKEILDVIIKEEVVDPEDIDMLQDLVLAATNE 74

Query: 78  AHKKIEDLVATKTQEITEGLPIP 100
           A KK++++      + T+G+ +P
Sbjct: 75  ALKKVDEITNETMGQFTKGMNMP 97


>gi|16077088|ref|NP_387901.1| hypothetical protein BSU00200 [Bacillus subtilis subsp. subtilis
           str. 168]
 gi|221307829|ref|ZP_03589676.1| hypothetical protein Bsubs1_00100 [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|221312151|ref|ZP_03593956.1| hypothetical protein BsubsN3_00100 [Bacillus subtilis subsp.
           subtilis str. NCIB 3610]
 gi|221317084|ref|ZP_03598378.1| hypothetical protein BsubsJ_00100 [Bacillus subtilis subsp.
           subtilis str. JH642]
 gi|221321347|ref|ZP_03602641.1| hypothetical protein BsubsS_00100 [Bacillus subtilis subsp.
           subtilis str. SMY]
 gi|296332939|ref|ZP_06875397.1| hypothetical protein BSU6633_17691 [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|305672718|ref|YP_003864389.1| hypothetical protein BSUW23_00105 [Bacillus subtilis subsp.
           spizizenii str. W23]
 gi|321313688|ref|YP_004205975.1| hypothetical protein BSn5_11660 [Bacillus subtilis BSn5]
 gi|141372|sp|P24281|YAAK_BACSU RecName: Full=UPF0133 protein yaaK
 gi|40073|emb|CAA34878.1| unnamed protein product [Bacillus subtilis]
 gi|467410|dbj|BAA05256.1| unknown [Bacillus subtilis]
 gi|2632287|emb|CAB11796.1| DNA binding protein [Bacillus subtilis subsp. subtilis str. 168]
 gi|296149903|gb|EFG90794.1| hypothetical protein BSU6633_17691 [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|305410961|gb|ADM36079.1| hypothetical protein BSUW23_00105 [Bacillus subtilis subsp.
           spizizenii str. W23]
 gi|320019962|gb|ADV94948.1| hypothetical protein BSn5_11660 [Bacillus subtilis BSn5]
          Length = 107

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 53/83 (63%)

Query: 18  MEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSD 77
           M K +E +     EG AGGGMV+V+ NG+  +  V I   ++  +++++L+DL++AA ++
Sbjct: 22  MAKAQEELAEKVVEGTAGGGMVTVKANGQKEILDVIIKEEVVDPEDIDMLQDLVLAATNE 81

Query: 78  AHKKIEDLVATKTQEITEGLPIP 100
           A KK++++      + T+G+ +P
Sbjct: 82  ALKKVDEITNETMGQFTKGMNMP 104


>gi|148244579|ref|YP_001219273.1| hypothetical protein COSY_0430 [Candidatus Vesicomyosocius okutanii
           HA]
 gi|146326406|dbj|BAF61549.1| conserved hypothetical protein [Candidatus Vesicomyosocius okutanii
           HA]
          Length = 101

 Score = 55.1 bits (131), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 58/94 (61%), Gaps = 2/94 (2%)

Query: 7   MVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEI 66
           M+ + ++IQ  M++ +  I +L A G A GG V + +NG++++T + I   ++ +   E+
Sbjct: 9   MMKKAQQIQNNMKQAQSEIKNLSATGKAAGGCVEIILNGEHIVTNITILDEVMSDK--EL 66

Query: 67  LEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           LEDLI+ A +DA K+I +  + K + IT  + +P
Sbjct: 67  LEDLILNAMNDAVKQIANASSAKMKTITGDMNLP 100


>gi|320106730|ref|YP_004182320.1| hypothetical protein AciPR4_1503 [Terriglobus saanensis SP1PR4]
 gi|319925251|gb|ADV82326.1| Uncharacterized protein family UPF0133 [Terriglobus saanensis
          SP1PR4]
          Length = 109

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 57/87 (65%), Gaps = 6/87 (6%)

Query: 1  MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
          +S +  M+GQ K++Q +ME  K S T +EA  + GGGMV+ R+NG+  L  +KID + L 
Sbjct: 6  LSKMKDMMGQAKQMQDEMEH-KLSATVVEA--STGGGMVTARMNGRKELLRLKIDPAALT 62

Query: 61 ED---NVEILEDLIIAAHSDAHKKIED 84
               ++E+LEDLI AA ++A +K ++
Sbjct: 63 ASAPGDIEMLEDLITAAVNEAGRKADE 89


>gi|300857563|ref|YP_003782546.1| hypothetical protein cpfrc_00146 [Corynebacterium
           pseudotuberculosis FRC41]
 gi|300685017|gb|ADK27939.1| hypothetical protein cpfrc_00146 [Corynebacterium
           pseudotuberculosis FRC41]
 gi|308275543|gb|ADO25442.1| Conserved hypothetical protein [Corynebacterium pseudotuberculosis
           I19]
          Length = 118

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 43/66 (65%)

Query: 32  GNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKKIEDLVATKTQ 91
           G AG G+VS+ I G  M++ V ID  ++  ++VE L+DLI+ A ++AH+K+ +L   K  
Sbjct: 46  GTAGNGLVSIDIQGNGMVSSVTIDPKVVDPEDVETLQDLIVGAFAEAHQKLSELADQKMG 105

Query: 92  EITEGL 97
            +++G 
Sbjct: 106 PLSQGF 111


>gi|332299031|ref|YP_004440953.1| UPF0133 protein ybaB [Treponema brennaborense DSM 12168]
 gi|332182134|gb|AEE17822.1| UPF0133 protein ybaB [Treponema brennaborense DSM 12168]
          Length = 105

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 56/98 (57%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           N  +++   + ++ +  K++E +  +E  G+AGGG+V V +NG+     V++D   +   
Sbjct: 4   NPFELLKNAQSMKEQFAKIQEELKLIEVTGSAGGGIVKVTVNGQFETQRVELDPIAVDPR 63

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           ++ +L+DLI AA  DA  +++D V  K   +  GL IP
Sbjct: 64  DIPMLQDLITAASRDAVSRVQDAVKDKLGPLANGLNIP 101


>gi|304380493|ref|ZP_07363171.1| transcriptional regulatory protein [Staphylococcus aureus subsp.
           aureus ATCC BAA-39]
 gi|304341011|gb|EFM06933.1| transcriptional regulatory protein [Staphylococcus aureus subsp.
           aureus ATCC BAA-39]
          Length = 89

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 52/87 (59%)

Query: 14  IQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIA 73
           +Q KM + +E +      G AGGGMV+V + G   +  V+I    +  D++E+L+DL++A
Sbjct: 1   MQKKMAQEQEKLKEERIVGTAGGGMVAVTVTGHKEVVDVEIKEEAVDPDDIEMLQDLVLA 60

Query: 74  AHSDAHKKIEDLVATKTQEITEGLPIP 100
           A ++A  K ++L   +  + T+GL IP
Sbjct: 61  ATNEAMNKADELTQERLGKHTQGLNIP 87


>gi|283796873|ref|ZP_06346026.1| putative cytoplasmic protein [Clostridium sp. M62/1]
 gi|291075279|gb|EFE12643.1| putative cytoplasmic protein [Clostridium sp. M62/1]
          Length = 152

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 60/94 (63%), Gaps = 3/94 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M+N+MK   Q + +Q +ME+  + +   E   +AGGG V+V ++GK  +  VK+   ++ 
Sbjct: 46  MTNLMK---QAQRMQRQMEETTKELEEKEYTASAGGGAVTVTVSGKKEVLSVKLSPEVVD 102

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEIT 94
            D++E+LEDLI+AA ++A +++ED  +    ++T
Sbjct: 103 PDDIEMLEDLIVAATNEAFRQMEDASSQAMAKLT 136


>gi|328950357|ref|YP_004367692.1| UPF0133 protein ybaB [Marinithermus hydrothermalis DSM 14884]
 gi|328450681|gb|AEB11582.1| UPF0133 protein ybaB [Marinithermus hydrothermalis DSM 14884]
          Length = 104

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 49/83 (59%)

Query: 3  NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
          N  K++ + ++ Q K  +++E +  +   G+AGGG+V V   G+  + GVK+D   +  +
Sbjct: 2  NFQKLIKEAQKAQRKAAEVQEKLAQMTVVGSAGGGLVEVTATGQGQIVGVKLDPRAVDPE 61

Query: 63 NVEILEDLIIAAHSDAHKKIEDL 85
          +VE LEDL++ A  DA +K   L
Sbjct: 62 DVEALEDLVLVAIKDAQEKAHAL 84


>gi|302205303|gb|ADL09645.1| Conserved hypothetical protein [Corynebacterium
          pseudotuberculosis C231]
 gi|302329857|gb|ADL20051.1| Conserved hypothetical protein [Corynebacterium
          pseudotuberculosis 1002]
          Length = 106

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 43/66 (65%)

Query: 32 GNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKKIEDLVATKTQ 91
          G AG G+VS+ I G  M++ V ID  ++  ++VE L+DLI+ A ++AH+K+ +L   K  
Sbjct: 34 GTAGNGLVSIDIQGNGMVSSVTIDPKVVDPEDVETLQDLIVGAFAEAHQKLSELADQKMG 93

Query: 92 EITEGL 97
           +++G 
Sbjct: 94 PLSQGF 99


>gi|332686115|ref|YP_004455889.1| hypothetical protein MPTP_0612 [Melissococcus plutonius ATCC 35311]
 gi|332370124|dbj|BAK21080.1| hypothetical protein co-occurring with RecR [Melissococcus
           plutonius ATCC 35311]
          Length = 104

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 32/98 (32%), Positives = 55/98 (56%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+  M+ Q +++Q +M K +E + + E  G A   +V     G   L  V I++ ++ 
Sbjct: 5   MGNMQGMMKQVQKMQKEMAKAQEELNAKEFVGEATNALVKTTFTGDRKLKDVSINKEVVD 64

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLP 98
            D++E+LEDL+  A +DA +KIE    +   + T+GLP
Sbjct: 65  PDDIEMLEDLVTMAVNDALEKIETETESTMGKYTKGLP 102


>gi|226309652|ref|YP_002769546.1| hypothetical protein BBR47_00650 [Brevibacillus brevis NBRC 100599]
 gi|226092600|dbj|BAH41042.1| conserved hypothetical protein [Brevibacillus brevis NBRC 100599]
          Length = 106

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 54/84 (64%)

Query: 17  KMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHS 76
           +M+K +E +     EG+AGGG ++V+I+G   +  + I   ++  ++VE+L+DL++ A +
Sbjct: 20  EMQKAQEGLKDRIVEGSAGGGAITVKIDGHKQIKDIVIKPEVVDPEDVEMLQDLVLTAVN 79

Query: 77  DAHKKIEDLVATKTQEITEGLPIP 100
           DA +K +++V  +  + T G+ IP
Sbjct: 80  DALRKADEMVGKEMGKFTGGMNIP 103


>gi|295837977|ref|ZP_06824910.1| conserved hypothetical protein [Streptomyces sp. SPB74]
 gi|197699472|gb|EDY46405.1| conserved hypothetical protein [Streptomyces sp. SPB74]
          Length = 113

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 50/87 (57%)

Query: 3  NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
          N+ +++ Q +++Q  + K +E + + E +G AGGG+V   +NG   L G+ ID   +  +
Sbjct: 9  NMQQLLQQAQKMQQDLAKAQEELAATEVDGQAGGGLVKATVNGSGELRGLVIDPKAVDPE 68

Query: 63 NVEILEDLIIAAHSDAHKKIEDLVATK 89
          + E L DL++AA   A++  + L   K
Sbjct: 69 DTETLADLVVAAVQAANENAQQLQQQK 95


>gi|189500124|ref|YP_001959594.1| hypothetical protein Cphamn1_1179 [Chlorobium phaeobacteroides
          BS1]
 gi|238692301|sp|B3EQT2|Y1179_CHLPB RecName: Full=UPF0133 protein Cphamn1_1179
 gi|189495565|gb|ACE04113.1| conserved hypothetical protein [Chlorobium phaeobacteroides BS1]
          Length = 111

 Score = 54.7 bits (130), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 53/86 (61%), Gaps = 2/86 (2%)

Query: 1  MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
          M N   M+ Q ++   KM+ +++ +  + A G+AGGGMV   ++GK  +  + ID  +L 
Sbjct: 3  MPNFNDMMKQLQQAGAKMQDVQKQLEKITAVGDAGGGMVKATVSGKQKVLSIAIDPEIL- 61

Query: 61 EDNVEILEDLIIAAHSDAHKKIEDLV 86
           D++E+++DL++AA + A +K  DL 
Sbjct: 62 -DDIEMVQDLVVAAVNAALEKAADLA 86


>gi|15805235|ref|NP_293923.1| hypothetical protein DR_0199 [Deinococcus radiodurans R1]
 gi|12644602|sp|Q9RXV7|Y199_DEIRA RecName: Full=UPF0133 protein DR_0199
 gi|6457869|gb|AAF09786.1|AE001882_4 conserved hypothetical protein [Deinococcus radiodurans R1]
          Length = 96

 Score = 54.3 bits (129), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 35/98 (35%), Positives = 59/98 (60%), Gaps = 5/98 (5%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           ++ K++ Q ++ Q    K+++ + +   EG A G +V+V++NG   +T +KI    +  D
Sbjct: 2   DMKKLMKQMQQAQVAAGKIQDELAAQSVEGTASG-LVTVQMNGHGKVTSLKIKPEAVDGD 60

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           +VE LEDLI+AA +DA +K E L     +E T GL +P
Sbjct: 61  DVEALEDLILAAINDAAEKAEGL----QREATAGLGLP 94


>gi|229542242|ref|ZP_04431302.1| conserved hypothetical protein [Bacillus coagulans 36D1]
 gi|229326662|gb|EEN92337.1| conserved hypothetical protein [Bacillus coagulans 36D1]
          Length = 108

 Score = 54.3 bits (129), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 29/79 (36%), Positives = 47/79 (59%)

Query: 22  KESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKK 81
           +E +   + EG AGGGMV+V ++G   +  V+I+   +  D+VE+L+D+I+ A +DA  K
Sbjct: 28  QEQLGEQKVEGTAGGGMVTVVVSGHKKVLEVRINEEAVDPDDVEMLQDMILVATNDALDK 87

Query: 82  IEDLVATKTQEITEGLPIP 100
            E L      + T+G  IP
Sbjct: 88  AEQLTEQTMGKYTKGFNIP 106


>gi|268608025|ref|ZP_06141755.1| hypothetical protein RflaF_00824 [Ruminococcus flavefaciens FD-1]
          Length = 116

 Score = 54.3 bits (129), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 31/98 (31%), Positives = 58/98 (59%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           N+ +M+ Q +++Q ++ +++E I + E    AGGG V V + GK  +  + I    +  +
Sbjct: 16  NMNQMIKQAQKMQDQITELQEDIEAREFSATAGGGAVEVVLTGKKTIKSLNIKPEAVDPE 75

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           +VE+L+DLII+A ++A   IE     +  +IT G+ +P
Sbjct: 76  DVEMLQDLIISAINEAVNNIETTTEAEMGKITGGVSLP 113


>gi|210634536|ref|ZP_03298153.1| hypothetical protein COLSTE_02075 [Collinsella stercoris DSM 13279]
 gi|210158788|gb|EEA89759.1| hypothetical protein COLSTE_02075 [Collinsella stercoris DSM 13279]
          Length = 108

 Score = 54.3 bits (129), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 52/85 (61%), Gaps = 1/85 (1%)

Query: 22  KESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKK 81
           +ES++ +  + +AGGGMV V ++G   L  V ID   L  ++VE+L+D+I+AA ++A + 
Sbjct: 24  QESMSEVTVDASAGGGMVKVTVDGAMQLKSVTIDPDALDPEDVEMLQDMIVAAVNEACRG 83

Query: 82  IEDLVATKTQEITEGLPIP-PGLKF 105
           + ++   +   +T G+    PG+ F
Sbjct: 84  VAEIANKRMSAVTGGMGAGIPGMPF 108


>gi|220927701|ref|YP_002504610.1| hypothetical protein Ccel_0243 [Clostridium cellulolyticum H10]
 gi|254801332|sp|B8I550|Y243_CLOCE RecName: Full=UPF0133 protein Ccel_0243
 gi|219998029|gb|ACL74630.1| conserved hypothetical protein [Clostridium cellulolyticum H10]
          Length = 115

 Score = 54.3 bits (129), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 64/103 (62%), Gaps = 3/103 (2%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M+N+MK   Q +++Q  MEK ++ + +   E + GGG +++   GK  +  + I   ++ 
Sbjct: 15  MNNLMK---QAQKMQKDMEKAQQDLENKTIEVSVGGGAINIVATGKKEIKEITIKPEVVD 71

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGL 103
            D+VE+L+DLI++A ++A +K ++L  ++  +IT GL   PG+
Sbjct: 72  PDDVEMLQDLILSAVNEALRKADELANSEMSKITGGLGGLPGM 114


>gi|332654602|ref|ZP_08420345.1| transcriptional regulatory protein [Ruminococcaceae bacterium D16]
 gi|332516566|gb|EGJ46172.1| transcriptional regulatory protein [Ruminococcaceae bacterium D16]
          Length = 115

 Score = 54.3 bits (129), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 47/67 (70%)

Query: 34  AGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKKIEDLVATKTQEI 93
           AGGG+V+  +NGK+ L  ++ID   +  D+VE+L+DLI+AA ++A +  ++  ++  Q++
Sbjct: 48  AGGGVVTATVNGKHELKNLEIDPEAVDPDDVEMLQDLIVAAVNEAMRSADNDASSSMQKL 107

Query: 94  TEGLPIP 100
           T GL +P
Sbjct: 108 TGGLGLP 114


>gi|212704318|ref|ZP_03312446.1| hypothetical protein DESPIG_02373 [Desulfovibrio piger ATCC 29098]
 gi|212672280|gb|EEB32763.1| hypothetical protein DESPIG_02373 [Desulfovibrio piger ATCC 29098]
          Length = 103

 Score = 54.3 bits (129), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 58/100 (58%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+  ++ Q + +Q K+ K++  +     E ++GGGMV   ++GK  L G+ ID   L 
Sbjct: 1   MRNMNDILRQAQVMQNKLAKLQNELNERTYEASSGGGMVKAVVSGKQELRGLTIDPKALE 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
             +VE+L+DLI+AA ++A +   + +  +   I+ G+ +P
Sbjct: 61  GGDVEMLQDLIMAAVNEAGRIARETLDREMSAISGGIRLP 100


>gi|295112124|emb|CBL28874.1| conserved hypothetical protein TIGR00103 [Synergistetes bacterium
          SGP1]
          Length = 103

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 32/97 (32%), Positives = 56/97 (57%), Gaps = 3/97 (3%)

Query: 1  MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
          ++NIMK   Q +++Q +M +++E +     E + GGGMV     G   L G+ ID  ++ 
Sbjct: 3  LNNIMK---QAQKMQAQMMQIQEKLAEETVEASVGGGMVKAVFTGSGDLVGIHIDPEVIK 59

Query: 61 EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGL 97
           D+ E+LEDL+ AA ++  K+ ++L A +   +T  L
Sbjct: 60 PDDREMLEDLVTAAVNEGLKQSKELAAQRMGSVTGAL 96


>gi|94985612|ref|YP_604976.1| hypothetical protein Dgeo_1512 [Deinococcus geothermalis DSM 11300]
 gi|94555893|gb|ABF45807.1| hypothetical protein 103 [Deinococcus geothermalis DSM 11300]
          Length = 171

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 33/81 (40%), Positives = 49/81 (60%), Gaps = 5/81 (6%)

Query: 20  KMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAH 79
           K++E++ +   EG A G +V+V +NG   +TG+KI    +  D+VE LEDL++ A  DA+
Sbjct: 94  KIQENLAAQTVEGTASG-LVTVTMNGHGKVTGLKIKPEAVDPDDVEALEDLLLVALQDAN 152

Query: 80  KKIEDLVATKTQEITEGLPIP 100
            K E L     QE T GL +P
Sbjct: 153 AKAEAL----QQEATRGLGLP 169


>gi|163814835|ref|ZP_02206223.1| hypothetical protein COPEUT_00985 [Coprococcus eutactus ATCC 27759]
 gi|158449774|gb|EDP26769.1| hypothetical protein COPEUT_00985 [Coprococcus eutactus ATCC 27759]
          Length = 116

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 65/105 (61%), Gaps = 4/105 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M+N+MK   Q +++Q +ME+  +++     E + GGG+V+ +++GK  L  +K+D  ++ 
Sbjct: 16  MNNLMK---QAQKMQKQMEETTKNLEDKVYESSVGGGVVTAKVSGKKELMEIKLDSEVVD 72

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKF 105
            D++E LEDLII+A ++A +  E+       +I+ G+ +  GL F
Sbjct: 73  PDDIETLEDLIISAVNEALRAQEEDYNNNMSKISGGMGL-GGLPF 116


>gi|327398753|ref|YP_004339622.1| hypothetical protein Hipma_0593 [Hippea maritima DSM 10411]
 gi|327181382|gb|AEA33563.1| UPF0133 protein ybaB [Hippea maritima DSM 10411]
          Length = 109

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 55/94 (58%)

Query: 7   MVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEI 66
           ++ Q K+IQ ++ K +E       E + GGGMVSV  NG   +  +KI + ++  +++E 
Sbjct: 13  LMAQAKKIQKQIAKAQEEAAKETVEVSVGGGMVSVSANGLGEIVDIKISKEIVDPEDIET 72

Query: 67  LEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           LEDL+++  ++A +K +  +  K   +T GL IP
Sbjct: 73  LEDLVLSGVNEAIRKAKQQMDEKIAALTGGLNIP 106


>gi|118468755|ref|YP_890499.1| hypothetical protein MSMEG_6280 [Mycobacterium smegmatis str. MC2
          155]
 gi|118170042|gb|ABK70938.1| conserved hypothetical protein [Mycobacterium smegmatis str. MC2
          155]
          Length = 102

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 40/61 (65%)

Query: 22 KESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKK 81
          +E++ + E  G AGGG+V V + G   +  V+ID  ++  D+VE L+DLI+ A SDA K+
Sbjct: 19 QEALANAEVHGQAGGGLVQVTVKGSGEVVSVQIDPKVVDPDDVETLQDLIVGALSDASKQ 78

Query: 82 I 82
          +
Sbjct: 79 V 79


>gi|56961820|ref|YP_173542.1| hypothetical protein ABC0038 [Bacillus clausii KSM-K16]
 gi|81367504|sp|Q5WLZ4|Y038_BACSK RecName: Full=UPF0133 protein ABC0038
 gi|56908054|dbj|BAD62581.1| conserved hypothetical protein [Bacillus clausii KSM-K16]
          Length = 105

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 30/79 (37%), Positives = 48/79 (60%)

Query: 22  KESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKK 81
           +E +     E   GGGMV+V  +G   +  V I   ++  D+VE+L+DLIIAA ++A KK
Sbjct: 24  QEELKEKTVEATVGGGMVTVIASGDKRILEVNISEDVVDPDDVEMLQDLIIAATNEALKK 83

Query: 82  IEDLVATKTQEITEGLPIP 100
           +++LV     + T+GL +P
Sbjct: 84  VDELVEQDLGKFTKGLNMP 102


>gi|258645512|ref|ZP_05732981.1| putative cytoplasmic protein [Dialister invisus DSM 15470]
 gi|260402866|gb|EEW96413.1| putative cytoplasmic protein [Dialister invisus DSM 15470]
          Length = 108

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 62/102 (60%)

Query: 2   SNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFE 61
           + +  M+ + +++Q  M+K++E +     + + GGG V++ +NG+  +  +KI +  +  
Sbjct: 6   AQMQNMLKKARKMQEDMQKIQEELKQQTVDVSVGGGAVALIMNGEKKIVSLKIAKDAIDP 65

Query: 62  DNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGL 103
           ++ E+LEDLI  A ++A KK +++V     ++T GL +P G+
Sbjct: 66  EDPEMLEDLITTAVNEAGKKADEMVQKGMSKVTGGLGLPGGM 107


>gi|291546691|emb|CBL19799.1| conserved hypothetical protein TIGR00103 [Ruminococcus sp. SR1/5]
          Length = 118

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 29/83 (34%), Positives = 54/83 (65%), Gaps = 3/83 (3%)

Query: 1  MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
          M+N+MK   Q +++Q +ME+ ++++   E     GGG VSV ++GK  +T V +    + 
Sbjct: 16 MNNLMK---QAQKMQRQMEENQKALEEKEFTATVGGGAVSVTVSGKREITKVTLSEEAVD 72

Query: 61 EDNVEILEDLIIAAHSDAHKKIE 83
           D++E+LED+I AA ++A +++E
Sbjct: 73 PDDIEMLEDMIAAATNEALRQVE 95


>gi|83588902|ref|YP_428911.1| hypothetical protein Moth_0028 [Moorella thermoacetica ATCC 39073]
 gi|123525296|sp|Q2RMH1|Y028_MOOTA RecName: Full=UPF0133 protein Moth_0028
 gi|83571816|gb|ABC18368.1| conserved hypothetical protein [Moorella thermoacetica ATCC 39073]
          Length = 104

 Score = 53.9 bits (128), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 54/85 (63%)

Query: 16  GKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAH 75
            ++ +++E +     E +AGGG+V V  NG+  L  +KID + +  ++VE+L+DLI+AA 
Sbjct: 18  AQVARLQEELGERTVEASAGGGVVKVTANGRQELVNIKIDPAAVDPEDVEMLQDLILAAV 77

Query: 76  SDAHKKIEDLVATKTQEITEGLPIP 100
           ++A  + +++V  +  +IT  + +P
Sbjct: 78  NEALHQSQEMVTREMAKITGNIRLP 102


>gi|317055947|ref|YP_004104414.1| hypothetical protein Rumal_1264 [Ruminococcus albus 7]
 gi|315448216|gb|ADU21780.1| Uncharacterized protein family UPF0133 [Ruminococcus albus 7]
          Length = 116

 Score = 53.9 bits (128), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 60/99 (60%)

Query: 2   SNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFE 61
           +N+ +M+ Q +++Q ++  ++  +   E +G AGGG+V V INGK  +  +KI   ++  
Sbjct: 15  NNMNQMLKQAQKMQDQITALQADLEQREFKGTAGGGVVEVTINGKRNVLDLKIAPEIVNP 74

Query: 62  DNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           + +E L+DL+ AA + A   ++++   + Q++T G+  P
Sbjct: 75  EEIEDLQDLVKAAFNAAVDNLDEISDAEMQKLTGGVSFP 113


>gi|302520197|ref|ZP_07272539.1| conserved hypothetical protein [Streptomyces sp. SPB78]
 gi|302429092|gb|EFL00908.1| conserved hypothetical protein [Streptomyces sp. SPB78]
          Length = 114

 Score = 53.9 bits (128), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 50/87 (57%)

Query: 3  NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
          N+ +++ Q +++Q  + + +E + + E +G AGGG+V   +NG   L G+ ID   +  +
Sbjct: 11 NMQQLLQQAQKMQQDLARAQEELAATEVDGQAGGGLVKATVNGSGELKGLVIDPKAVDPE 70

Query: 63 NVEILEDLIIAAHSDAHKKIEDLVATK 89
          + E L DL++AA   A++  + L   K
Sbjct: 71 DTETLADLVVAAVQAANENAQQLQQQK 97


>gi|297158534|gb|ADI08246.1| hypothetical protein SBI_05126 [Streptomyces bingchenggensis BCW-1]
          Length = 111

 Score = 53.9 bits (128), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 55/103 (53%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           N+ +++ Q +++Q  +   +E +     EG+AGGG+V   + G   L G+ ID   +  +
Sbjct: 9   NMQQLLQQAQKMQQDLAAAQEELARTPVEGSAGGGLVKATVTGAGELQGLVIDPKAVDPE 68

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKF 105
           + E L DL++AA  DA+   + L   K   + +GL   PGL F
Sbjct: 69  DTETLADLVVAAVRDANNAAQQLQQQKLGPLAQGLGGMPGLPF 111


>gi|171912029|ref|ZP_02927499.1| hypothetical protein VspiD_12655 [Verrucomicrobium spinosum DSM
           4136]
          Length = 104

 Score = 53.9 bits (128), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 50/75 (66%)

Query: 31  EGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKKIEDLVATKT 90
           E ++GGG V+V + G   +T +KI++ ++  ++V++LE L++ A   A  K +++ A + 
Sbjct: 30  EVSSGGGRVTVTVTGAQEITAIKINKEIVDPEDVDMLETLVLTAVQQALAKSKEMAAGEM 89

Query: 91  QEITEGLPIPPGLKF 105
            ++T+G+ +PPG+ F
Sbjct: 90  GKLTQGMGLPPGMGF 104


>gi|297621643|ref|YP_003709780.1| putative YbaB family protein [Waddlia chondrophila WSU 86-1044]
 gi|297376944|gb|ADI38774.1| putative YbaB family protein [Waddlia chondrophila WSU 86-1044]
          Length = 104

 Score = 53.5 bits (127), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 56/96 (58%), Gaps = 4/96 (4%)

Query: 12  KEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLI 71
           +++Q +  +++E + ++EAEG AG G+V++++NG   +  ++I    +  D+VE LE LI
Sbjct: 13  RQMQEQFAQLQEQMQNVEAEGQAGNGLVTIKLNGDFEIKSLRIKPDCVDPDDVEGLETLI 72

Query: 72  IAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            AAH DA + +   + +    +  G+P    L F F
Sbjct: 73  KAAHKDAMENVRKTMPS----MGGGMPDLGSLGFGF 104


>gi|168333588|ref|ZP_02691853.1| hypothetical protein Epulo_01821 [Epulopiscium sp. 'N.t. morphotype
           B']
          Length = 113

 Score = 53.5 bits (127), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 59/103 (57%), Gaps = 1/103 (0%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+ +++ Q +++Q +ME+ +E +  L      GGG+V V  +    +  V I    + 
Sbjct: 8   MPNMGQLMKQAQKMQKQMEEAQEKLADLTVTATVGGGIVEVVASANKEIRNVTIKEEAVD 67

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGL 103
            D++E LEDL++ A ++A ++ E+L   +  +IT G  +PPG+
Sbjct: 68  PDDIETLEDLVMTAVNEALRQAEELSQKEMAKITGG-NLPPGM 109


>gi|295317502|gb|ADF97879.1| conserved hypothetical protein TIGR00103 [Clostridium botulinum F
           str. 230613]
          Length = 79

 Score = 53.5 bits (127), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 47/72 (65%)

Query: 29  EAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKKIEDLVAT 88
           E     GGG V+   NGK  +  +KI+  ++ ED++E+LEDLI++A ++A KK E+  ++
Sbjct: 5   EFSATVGGGAVTAVANGKKQIVDIKIEPEVVDEDDIEMLEDLIMSACNEALKKAEEDTSS 64

Query: 89  KTQEITEGLPIP 100
           + + +T G+ +P
Sbjct: 65  EVKRLTGGMNLP 76


>gi|119356988|ref|YP_911632.1| hypothetical protein Cpha266_1171 [Chlorobium phaeobacteroides DSM
           266]
 gi|166228902|sp|A1BFN1|Y1171_CHLPD RecName: Full=UPF0133 protein Cpha266_1171
 gi|119354337|gb|ABL65208.1| conserved hypothetical protein 103 [Chlorobium phaeobacteroides DSM
           266]
          Length = 111

 Score = 53.5 bits (127), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 59/100 (59%), Gaps = 2/100 (2%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+  M+ Q ++   KM+ +++ +  + A G AGGGMV V +NGK  L  ++ID  ++ 
Sbjct: 3   MPNLGDMMKQIQQAGEKMQDVQKQLEKIVAYGEAGGGMVKVSVNGKQKLLTLQIDPDIM- 61

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
            D+ E+++DL+IAA + A  +   +   +  ++T G+  P
Sbjct: 62  -DDAEMVQDLVIAAVNSALDEAAKVAQEELVKVTGGMMNP 100


>gi|259048076|ref|ZP_05738477.1| cytoplasmic protein [Granulicatella adiacens ATCC 49175]
 gi|259035137|gb|EEW36392.1| cytoplasmic protein [Granulicatella adiacens ATCC 49175]
          Length = 118

 Score = 53.5 bits (127), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 55/100 (55%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+  M+ Q +++Q +M + +E +   E  G +   +V V +NGK  +  V+I    + 
Sbjct: 17  MGNMQGMMKQMQKLQKQMAQAQEELNQTEYTGTSQSDLVKVTVNGKRQVLNVEIKPEAVD 76

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
            ++VE+L+DL++ A +DA  + E        + T+GL IP
Sbjct: 77  PEDVELLQDLVLMATNDALTQAEKANDQTMGQFTKGLNIP 116


>gi|223043333|ref|ZP_03613379.1| conserved hypothetical protein [Staphylococcus capitis SK14]
 gi|242372722|ref|ZP_04818296.1| conserved hypothetical protein [Staphylococcus epidermidis
           M23864:W1]
 gi|314935109|ref|ZP_07842468.1| transcriptional regulatory protein [Staphylococcus caprae C87]
 gi|222443122|gb|EEE49221.1| conserved hypothetical protein [Staphylococcus capitis SK14]
 gi|242349639|gb|EES41240.1| conserved hypothetical protein [Staphylococcus epidermidis
           M23864:W1]
 gi|313653039|gb|EFS16802.1| transcriptional regulatory protein [Staphylococcus caprae C87]
          Length = 105

 Score = 53.5 bits (127), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 31/84 (36%), Positives = 51/84 (60%), Gaps = 4/84 (4%)

Query: 17  KMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHS 76
           + EK+KE   +    G AGGGMV+V + G   +  V+I    +  D+VE+L+DL++AA +
Sbjct: 24  EQEKLKEERVA----GTAGGGMVTVTVTGHKEVVDVEIKEEAVDPDDVEMLQDLVLAATN 79

Query: 77  DAHKKIEDLVATKTQEITEGLPIP 100
           +A  K ++L   +  + T+GL IP
Sbjct: 80  EAMNKADELTQERLGKHTQGLNIP 103


>gi|293374916|ref|ZP_06621214.1| DNA-binding protein, YbaB/EbfC family [Turicibacter sanguinis
           PC909]
 gi|325844370|ref|ZP_08168125.1| DNA-binding protein, YbaB/EbfC family [Turicibacter sp. HGF1]
 gi|292646465|gb|EFF64477.1| DNA-binding protein, YbaB/EbfC family [Turicibacter sanguinis
           PC909]
 gi|325489175|gb|EGC91558.1| DNA-binding protein, YbaB/EbfC family [Turicibacter sp. HGF1]
          Length = 103

 Score = 53.5 bits (127), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 58/94 (61%)

Query: 7   MVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEI 66
           M+ + +++Q  M K ++ I      G+A GGMV++ + G   +  V I+ S++  ++VE+
Sbjct: 7   MMKKIQKMQKDMLKAQKDIEESVFTGSAAGGMVTIEVKGTKEINKVNINPSVVDPEDVEM 66

Query: 67  LEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           LED+I+ A +DA +++++   +   + T+G+ IP
Sbjct: 67  LEDVILLALNDAFRQVDEKTESTMGQFTKGMNIP 100


>gi|89100952|ref|ZP_01173798.1| hypothetical protein B14911_15486 [Bacillus sp. NRRL B-14911]
 gi|89084323|gb|EAR63478.1| hypothetical protein B14911_15486 [Bacillus sp. NRRL B-14911]
          Length = 103

 Score = 53.5 bits (127), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 49/79 (62%)

Query: 22  KESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKK 81
           +E +     EG AGGGMV+V ++G   +  V I   ++  +++++L+DL++AA +DA KK
Sbjct: 22  QEELGEKRIEGTAGGGMVTVIVSGHKQVLEVNIKEEVVDPEDIDMLQDLVLAATNDALKK 81

Query: 82  IEDLVATKTQEITEGLPIP 100
            +DL      + T+G+ +P
Sbjct: 82  ADDLTNDTMGQFTKGMNLP 100


>gi|319655049|ref|ZP_08009119.1| hypothetical protein HMPREF1013_05741 [Bacillus sp. 2_A_57_CT2]
 gi|317393273|gb|EFV74041.1| hypothetical protein HMPREF1013_05741 [Bacillus sp. 2_A_57_CT2]
          Length = 107

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 46/70 (65%)

Query: 31  EGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKKIEDLVATKT 90
           EG AGGGMV+V ++G   +  V I   ++  +++++L+DL++AA +DA KK +DL     
Sbjct: 35  EGTAGGGMVTVIVSGHKQVLEVNIKEEVVDPEDIDMLQDLVLAATNDALKKADDLTNDTM 94

Query: 91  QEITEGLPIP 100
            + T+G+ +P
Sbjct: 95  GQFTKGMNLP 104


>gi|323488473|ref|ZP_08093719.1| hypothetical protein GPDM_04012 [Planococcus donghaensis MPA1U2]
 gi|323397865|gb|EGA90665.1| hypothetical protein GPDM_04012 [Planococcus donghaensis MPA1U2]
          Length = 106

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 53/79 (67%)

Query: 22  KESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKK 81
           +E + +L+ EG+AGGGMV V ++G   +  + +D +++  ++VE+L+DL++ A ++A KK
Sbjct: 25  QEELGTLKFEGSAGGGMVKVTVSGHKEVLDIVLDPTVVDPEDVEMLQDLLVVATNEAFKK 84

Query: 82  IEDLVATKTQEITEGLPIP 100
            ++   +   + T+GL +P
Sbjct: 85  ADEHANSTMGKFTKGLNLP 103


>gi|237784775|ref|YP_002905480.1| hypothetical protein ckrop_0143 [Corynebacterium kroppenstedtii
          DSM 44385]
 gi|259646389|sp|C4LG87|Y143_CORK4 RecName: Full=UPF0133 protein ckrop_0143
 gi|237757687|gb|ACR16937.1| conserved hypothetical protein [Corynebacterium kroppenstedtii
          DSM 44385]
          Length = 100

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 55/92 (59%)

Query: 6  KMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVE 65
          +++ Q +++Q ++++++  I   E  G+AG G+V V + G   +T V ID+S++  D+V+
Sbjct: 8  EIMAQAQQMQEELQRVQGEIAQSEISGSAGNGLVKVTMKGTGEVTNVTIDKSVVDPDDVD 67

Query: 66 ILEDLIIAAHSDAHKKIEDLVATKTQEITEGL 97
           L+DL++ A  DA+  ++     K    ++ L
Sbjct: 68 TLQDLVLGALQDANTALQSYAQEKMGPFSQAL 99


>gi|257790372|ref|YP_003180978.1| hypothetical protein Elen_0604 [Eggerthella lenta DSM 2243]
 gi|317488826|ref|ZP_07947358.1| hypothetical protein HMPREF1023_01057 [Eggerthella sp. 1_3_56FAA]
 gi|325833725|ref|ZP_08166140.1| DNA-binding protein, YbaB/EbfC family [Eggerthella sp. HGA1]
 gi|257474269|gb|ACV54589.1| conserved hypothetical protein [Eggerthella lenta DSM 2243]
 gi|316912080|gb|EFV33657.1| hypothetical protein HMPREF1023_01057 [Eggerthella sp. 1_3_56FAA]
 gi|325485265|gb|EGC87735.1| DNA-binding protein, YbaB/EbfC family [Eggerthella sp. HGA1]
          Length = 113

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 53/91 (58%)

Query: 10  QFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILED 69
           Q +++Q ++ + +E I  +  E  AGGGMV V  NG   +  + ID   +  ++VE+L+D
Sbjct: 20  QAQKMQAELARAQEEIKDMTFEATAGGGMVKVVANGDMTVDSIVIDPEAVDPEDVEMLQD 79

Query: 70  LIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           ++ AA ++A + + ++ + +    T GL IP
Sbjct: 80  MVAAAVNEALRGVSEISSQRLNAATGGLNIP 110


>gi|239637704|ref|ZP_04678674.1| conserved hypothetical protein [Staphylococcus warneri L37603]
 gi|239596729|gb|EEQ79256.1| conserved hypothetical protein [Staphylococcus warneri L37603]
          Length = 105

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 44/70 (62%)

Query: 31  EGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKKIEDLVATKT 90
           EG AGGGMV+V + G   +  V+I    +  D+VE+L+DL++AA ++A  K + L   + 
Sbjct: 34  EGTAGGGMVTVTVTGHKEVVDVQIKEDAVDPDDVEMLQDLVLAATNEAMNKADKLTQERL 93

Query: 91  QEITEGLPIP 100
            + T+GL IP
Sbjct: 94  GKHTQGLNIP 103


>gi|254422595|ref|ZP_05036313.1| conserved hypothetical protein TIGR00103 [Synechococcus sp. PCC
           7335]
 gi|196190084|gb|EDX85048.1| conserved hypothetical protein TIGR00103 [Synechococcus sp. PCC
           7335]
          Length = 114

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 51/89 (57%), Gaps = 1/89 (1%)

Query: 12  KEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLI 71
           +++Q   ++++E +  +E EG AGGG+V V ++G     GV I    L E   E+L DL+
Sbjct: 25  QQVQEGAKRLQEELEQMEIEGTAGGGLVKVIMSGNQEPRGVAISEEALGE-GAEVLSDLV 83

Query: 72  IAAHSDAHKKIEDLVATKTQEITEGLPIP 100
            AA  DA+ K    +  + +E+T GL +P
Sbjct: 84  KAAMLDAYNKSTATMREQMEELTGGLSLP 112


>gi|148655672|ref|YP_001275877.1| hypothetical protein RoseRS_1534 [Roseiflexus sp. RS-1]
 gi|166979768|sp|A5UTH4|Y1534_ROSS1 RecName: Full=UPF0133 protein RoseRS_1534
 gi|148567782|gb|ABQ89927.1| conserved hypothetical protein 103 [Roseiflexus sp. RS-1]
          Length = 100

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 54/89 (60%), Gaps = 1/89 (1%)

Query: 12  KEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLI 71
           +++Q +M +++E + +   EG AG   V+V +NG   +  +K+   ++  D+VE L+DLI
Sbjct: 11  RQMQKEMMRIQEELANTTVEGTAGS-YVTVTMNGHREIKSIKLAPEVVDPDDVETLQDLI 69

Query: 72  IAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           +AA +DA KK ++L   +   +  G+ +P
Sbjct: 70  VAAIADASKKAQELAEQRLGPLAGGMKLP 98


>gi|254818508|ref|ZP_05223509.1| hypothetical protein MintA_01219 [Mycobacterium intracellulare
          ATCC 13950]
          Length = 108

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 40/61 (65%)

Query: 22 KESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKK 81
          ++ + + E  G AGGG+VSV + G   +  VKID S++   +VE L+DLI+ A +DA K+
Sbjct: 19 QQQLANAEVHGQAGGGLVSVVVKGSGEVVAVKIDPSVVDPSDVETLQDLIVGAMADASKQ 78

Query: 82 I 82
          +
Sbjct: 79 V 79


>gi|291562956|emb|CBL41772.1| conserved hypothetical protein TIGR00103 [butyrate-producing
          bacterium SS3/4]
          Length = 116

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/83 (38%), Positives = 51/83 (61%), Gaps = 3/83 (3%)

Query: 1  MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
          M+N+MK   Q + +Q +ME+  + +   +    AGGG VSV ++GK  +  VKI    + 
Sbjct: 15 MTNLMK---QAQRMQRQMEEKTKELEEKQYTATAGGGAVSVTVSGKKEVVAVKISPEAVD 71

Query: 61 EDNVEILEDLIIAAHSDAHKKIE 83
           D+VE+LEDLI+AA + A  ++E
Sbjct: 72 PDDVEMLEDLIVAATNAAFHQME 94


>gi|328478592|gb|EGF48259.1| hypothetical protein AAULR_18321 [Lactobacillus rhamnosus MTCC
          5462]
          Length = 99

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 57/99 (57%)

Query: 1  MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
          M N+  M+ Q +++Q +M+  ++ + + E EG +   MV+V+ +G+ ++  ++I    + 
Sbjct: 1  MGNMQSMMRQMQKMQKEMQAAQKELYATEFEGKSASDMVTVKFSGEKVMKDIQIKPEAID 60

Query: 61 EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPI 99
           D+ ++L+DLII A + A   I+     K  + T GLP+
Sbjct: 61 PDDPDMLQDLIIEAVNQAMADIDKQTQDKLGKYTRGLPM 99


>gi|154505548|ref|ZP_02042286.1| hypothetical protein RUMGNA_03085 [Ruminococcus gnavus ATCC 29149]
 gi|153794206|gb|EDN76626.1| hypothetical protein RUMGNA_03085 [Ruminococcus gnavus ATCC 29149]
          Length = 117

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 60/94 (63%), Gaps = 3/94 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M+N+MK   Q +++Q +ME+  + + + E    AGG  V V ++GK  +  VK+   ++ 
Sbjct: 16  MANLMK---QAQKMQRQMEEQAKELEAKEFTATAGGEAVEVTVSGKREVLKVKLAEEVVD 72

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEIT 94
            D++E+LEDLI+AA ++A +K+++  ++   ++T
Sbjct: 73  PDDIEMLEDLIVAATNEALRKVDEESSSAMSKLT 106


>gi|78224611|ref|YP_386358.1| hypothetical protein Gmet_3421 [Geobacter metallireducens GS-15]
 gi|78195866|gb|ABB33633.1| conserved hypothetical protein [Geobacter metallireducens GS-15]
          Length = 104

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 60/100 (60%), Gaps = 3/100 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           ++ IMK   Q + +Q KM K++E      AE  AGGG V+  + GKN L  + I    + 
Sbjct: 5   LAGIMK---QAQMMQQKMAKLQEEAAQQTAEATAGGGAVTAVVTGKNQLVSLTIKPEAVD 61

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
            ++VE+L+DLI+AA ++A KK++   + +  +IT GL IP
Sbjct: 62  PNDVEMLQDLIVAAVNEALKKVQSKFSEEMGKITGGLNIP 101


>gi|303325568|ref|ZP_07356011.1| valyl-tRNA synthetase, class Ia [Desulfovibrio sp. 3_1_syn3]
 gi|302863484|gb|EFL86415.1| valyl-tRNA synthetase, class Ia [Desulfovibrio sp. 3_1_syn3]
          Length = 103

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 57/100 (57%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+  ++ Q + +Q K+ K+++ +     E  +GGGMV   ++GK  L  + ID   L 
Sbjct: 1   MRNMNDILRQAQVMQSKLSKLQQEMAERSYEAASGGGMVKAEVSGKQELRKLTIDPKALE 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
             +VE+L+DLI+AA ++A +   + +  +   I+ G+ +P
Sbjct: 61  GGDVEMLQDLILAAVNEAGRIARETMEREMNNISGGIKLP 100


>gi|118619461|ref|YP_907793.1| hypothetical protein MUL_4307 [Mycobacterium ulcerans Agy99]
 gi|183985201|ref|YP_001853492.1| hypothetical protein MMAR_5232 [Mycobacterium marinum M]
 gi|118571571|gb|ABL06322.1| conserved protein [Mycobacterium ulcerans Agy99]
 gi|183178527|gb|ACC43637.1| conserved protein [Mycobacterium marinum M]
          Length = 147

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 38/61 (62%)

Query: 22 KESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKK 81
          ++ + + E  G AGGG+V V + G   L GV ID  ++  D++E L+DLI+ A  DA ++
Sbjct: 25 QQQLANSEVHGQAGGGLVQVAVRGSGELVGVTIDPKVVDRDDIETLQDLIVGAMRDASQQ 84

Query: 82 I 82
          +
Sbjct: 85 V 85


>gi|199599028|ref|ZP_03212435.1| hypothetical protein LRH_08558 [Lactobacillus rhamnosus HN001]
 gi|229552945|ref|ZP_04441670.1| conserved hypothetical protein [Lactobacillus rhamnosus LMS2-1]
 gi|258509260|ref|YP_003172011.1| hypothetical protein LGG_02265 [Lactobacillus rhamnosus GG]
 gi|258540444|ref|YP_003174943.1| hypothetical protein LC705_02253 [Lactobacillus rhamnosus Lc 705]
 gi|199590064|gb|EDY98163.1| hypothetical protein LRH_08558 [Lactobacillus rhamnosus HN001]
 gi|229313689|gb|EEN79662.1| conserved hypothetical protein [Lactobacillus rhamnosus LMS2-1]
 gi|257149187|emb|CAR88160.1| Conserved protein [Lactobacillus rhamnosus GG]
 gi|257152120|emb|CAR91092.1| Conserved protein [Lactobacillus rhamnosus Lc 705]
 gi|259650542|dbj|BAI42704.1| conserved hypothetical protein [Lactobacillus rhamnosus GG]
          Length = 102

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 57/99 (57%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+  M+ Q +++Q +M+  ++ + + E EG +   MV+V+ +G+ ++  ++I    + 
Sbjct: 4   MGNMQSMMRQMQKMQKEMQAAQKELYATEFEGKSASDMVTVKFSGEKVMKDIQIKPEAID 63

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPI 99
            D+ ++L+DLII A + A   I+     K  + T GLP+
Sbjct: 64  PDDPDMLQDLIIEAVNQAMADIDKQTQDKLGKYTRGLPM 102


>gi|325680611|ref|ZP_08160153.1| DNA-binding protein, YbaB/EbfC family [Ruminococcus albus 8]
 gi|324107681|gb|EGC01955.1| DNA-binding protein, YbaB/EbfC family [Ruminococcus albus 8]
          Length = 116

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 59/99 (59%)

Query: 2   SNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFE 61
           +N+ +M+ Q +++Q ++  ++  +   E  G AGGG+V V INGK  +  +K+   ++  
Sbjct: 15  NNMNQMLKQAQKMQDQITALQADLEQREFNGTAGGGVVEVTINGKRNVLDLKLAPEIVNP 74

Query: 62  DNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           + +E L+DLI AA + A   ++++   + Q++T G+  P
Sbjct: 75  EEIEDLQDLIKAAFNAAVDNLDEVSDAEMQKLTGGVSFP 113


>gi|226363547|ref|YP_002781329.1| hypothetical protein ROP_41370 [Rhodococcus opacus B4]
 gi|254803870|sp|C1B9N1|Y4137_RHOOB RecName: Full=UPF0133 protein ROP_41370
 gi|226242036|dbj|BAH52384.1| hypothetical protein [Rhodococcus opacus B4]
          Length = 113

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 38/61 (62%)

Query: 29 EAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKKIEDLVAT 88
          E  G AGGG+V+  + G   + G+KID  ++  D+VE L+DL+I A  DA  K +++ A 
Sbjct: 34 EVTGQAGGGLVTATVKGTGEVVGLKIDPKVVDPDDVETLQDLVIGAIEDASSKAQEIAAQ 93

Query: 89 K 89
          K
Sbjct: 94 K 94


>gi|156742264|ref|YP_001432393.1| hypothetical protein Rcas_2292 [Roseiflexus castenholzii DSM 13941]
 gi|189039723|sp|A7NFA1|Y2292_ROSCS RecName: Full=UPF0133 protein Rcas_2292
 gi|156233592|gb|ABU58375.1| conserved hypothetical protein [Roseiflexus castenholzii DSM 13941]
          Length = 100

 Score = 52.8 bits (125), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 54/89 (60%), Gaps = 1/89 (1%)

Query: 12  KEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLI 71
           +++Q +M +++E + +   EG AG   ++V +NG   +  +KI   ++  D++E L+DLI
Sbjct: 11  RQMQKEMMRIQEELANATVEGTAGS-YITVTMNGHREIKSIKIAPEVVDPDDIETLQDLI 69

Query: 72  IAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           +AA +DA KK ++L   +   +  G+ +P
Sbjct: 70  VAAITDASKKAQELAEQRLGPLAGGMKLP 98


>gi|194336272|ref|YP_002018066.1| hypothetical protein Ppha_1174 [Pelodictyon phaeoclathratiforme
           BU-1]
 gi|238693419|sp|B4SGN6|Y1174_PELPB RecName: Full=UPF0133 protein Ppha_1174
 gi|194308749|gb|ACF43449.1| conserved hypothetical protein [Pelodictyon phaeoclathratiforme
           BU-1]
          Length = 111

 Score = 52.8 bits (125), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 59/100 (59%), Gaps = 2/100 (2%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+  M+ Q ++   KM+ +++ +  + A G AGGGMV V ++GK  L  + ID  ++ 
Sbjct: 3   MPNLGDMMKQIQQAGEKMQDVQKQLEKIVAHGEAGGGMVKVSVSGKQKLLSLTIDPDIM- 61

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
            D+ E+++DL++AA ++A  +   L   +  ++T G+  P
Sbjct: 62  -DDAEMVQDLVLAAVNNALDESARLAQEEISKVTGGMMNP 100


>gi|19704605|ref|NP_604167.1| putative cytoplasmic protein [Fusobacterium nucleatum subsp.
           nucleatum ATCC 25586]
 gi|19714901|gb|AAL95466.1| Hypothetical cytosolic protein [Fusobacterium nucleatum subsp.
           nucleatum ATCC 25586]
          Length = 88

 Score = 52.8 bits (125), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/85 (37%), Positives = 52/85 (61%), Gaps = 2/85 (2%)

Query: 18  MEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFE--DNVEILEDLIIAAH 75
           M +++E + S E   + GGG VSV++NG+  L  VK+   +L +  ++ E+LEDLI+ A 
Sbjct: 1   MLEVQEQLKSKEVSSSVGGGAVSVKVNGQKELMEVKLSDEILKDAANDKEMLEDLILTAV 60

Query: 76  SDAHKKIEDLVATKTQEITEGLPIP 100
            DA  K E+L   +  ++T G+ IP
Sbjct: 61  KDAMAKAEELAEGEMAKVTGGINIP 85


>gi|218887360|ref|YP_002436681.1| hypothetical protein DvMF_2270 [Desulfovibrio vulgaris str.
           'Miyazaki F']
 gi|218758314|gb|ACL09213.1| conserved hypothetical protein [Desulfovibrio vulgaris str.
           'Miyazaki F']
          Length = 103

 Score = 52.8 bits (125), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 58/100 (58%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M  +  ++ Q + +Q KM K++  +     E  +GGGMV V ++GK  +  + ID   + 
Sbjct: 1   MRGMNDLLRQAQVMQTKMSKLQAEMADRTLEATSGGGMVKVTVSGKQEVKAIVIDPKAVD 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
            ++VE+L+DL++ A ++  ++ +D++  +   +T GL +P
Sbjct: 61  PNDVEMLQDLVLTAVNEGLRQAKDMMEKEMGALTGGLKMP 100


>gi|148543564|ref|YP_001270934.1| hypothetical protein Lreu_0327 [Lactobacillus reuteri DSM 20016]
 gi|194468111|ref|ZP_03074097.1| conserved hypothetical protein [Lactobacillus reuteri 100-23]
 gi|148530598|gb|ABQ82597.1| conserved hypothetical protein 103 [Lactobacillus reuteri DSM
           20016]
 gi|194452964|gb|EDX41862.1| conserved hypothetical protein [Lactobacillus reuteri 100-23]
          Length = 102

 Score = 52.8 bits (125), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 51/95 (53%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           N+ +M+ Q K +Q KM    E +   E  G A   MV+   +G N L  +KI    +  D
Sbjct: 6   NMQQMMKQAKAMQKKMMAEHEELAKQEFVGKAPDDMVTATFSGDNQLIDLKIKPEAVDPD 65

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGL 97
           ++++L+DL+IAA  D  K++ D    K  + T+G+
Sbjct: 66  DIDMLQDLVIAAVKDGMKQVNDATQQKLGKYTQGM 100


>gi|330684663|gb|EGG96365.1| DNA-binding protein, YbaB/EbfC family [Staphylococcus epidermidis
           VCU121]
          Length = 105

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 44/70 (62%)

Query: 31  EGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKKIEDLVATKT 90
           EG AGGGMV+V + G   +  V+I    +  D+VE+L+DL++AA ++A  K + L   + 
Sbjct: 34  EGTAGGGMVTVTVTGHKEVIDVQIKEDAVDPDDVEMLQDLVLAATNEAMNKADKLTQERL 93

Query: 91  QEITEGLPIP 100
            + T+GL IP
Sbjct: 94  GKHTQGLNIP 103


>gi|193214869|ref|YP_001996068.1| hypothetical protein Ctha_1157 [Chloroherpeton thalassium ATCC
          35110]
 gi|238692723|sp|B3QYJ3|Y1157_CHLT3 RecName: Full=UPF0133 protein Ctha_1157
 gi|193088346|gb|ACF13621.1| conserved hypothetical protein [Chloroherpeton thalassium ATCC
          35110]
          Length = 111

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/97 (32%), Positives = 60/97 (61%), Gaps = 5/97 (5%)

Query: 1  MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
          MS ++K V Q  E   KM++ ++ + S+ A G +GGG+V    NGK+ +  ++ID+ +L 
Sbjct: 6  MSAMLKQVQQMSE---KMQEAQKQLESMTAIGESGGGLVKAMANGKHEIISIQIDKDVL- 61

Query: 61 EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGL 97
           D+V++L+DLI+AA + A  +   +   +  ++T G+
Sbjct: 62 -DDVDMLQDLIVAAVNQALTEATKMAQEEMSKVTGGM 97


>gi|172041591|ref|YP_001801305.1| hypothetical protein cur_1912 [Corynebacterium urealyticum DSM
           7109]
 gi|238058581|sp|B1VIS5|Y1912_CORU7 RecName: Full=UPF0133 protein cu1912
 gi|171852895|emb|CAQ05871.1| conserved hypothetical protein [Corynebacterium urealyticum DSM
           7109]
          Length = 105

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 59/100 (59%), Gaps = 4/100 (4%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           N+  ++ Q + +Q ++++ +  I +    G AG G V++ ++G   +  +KID+ ++  +
Sbjct: 5   NMNDIMAQAQRMQKQLQEAQAEIVASSIVGEAGNGKVTLVLSGGGEVQDLKIDQEVVDPE 64

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITE----GLP 98
           +VE L+DLII A  DA++K++DL   K   + +    GLP
Sbjct: 65  DVETLQDLIIGAFQDANQKLQDLAQEKMGPLADLGGGGLP 104


>gi|188997276|ref|YP_001931527.1| conserved hypothetical protein [Sulfurihydrogenibium sp. YO3AOP1]
 gi|229557845|sp|B2V5M9|Y1366_SULSY RecName: Full=UPF0133 protein SYO3AOP1_1366
 gi|188932343|gb|ACD66973.1| conserved hypothetical protein [Sulfurihydrogenibium sp. YO3AOP1]
          Length = 110

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 61/97 (62%), Gaps = 1/97 (1%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           N+ +++ Q + I+  +EK KE + + +     GGGMV V  +G   +  ++ID+SLL E+
Sbjct: 6   NLAELMKQAQSIKENVEKAKEELKNEKIVVEVGGGMVKVVSDGLGTVLDLEIDKSLLNEN 65

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPI 99
              +L+DL+IAA ++  ++ +++VA K  + T GLP+
Sbjct: 66  EYPVLKDLLIAAINEVSERSKEVVADKISQAT-GLPM 101


>gi|237742265|ref|ZP_04572746.1| conserved hypothetical protein [Fusobacterium sp. 4_1_13]
 gi|237744194|ref|ZP_04574675.1| conserved hypothetical protein [Fusobacterium sp. 7_1]
 gi|229429913|gb|EEO40125.1| conserved hypothetical protein [Fusobacterium sp. 4_1_13]
 gi|229431423|gb|EEO41635.1| conserved hypothetical protein [Fusobacterium sp. 7_1]
          Length = 88

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/85 (37%), Positives = 52/85 (61%), Gaps = 2/85 (2%)

Query: 18  MEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFE--DNVEILEDLIIAAH 75
           M +++E + S E   + GGG VSV++NG+  L  VK+   +L +  ++ E+LEDLI+ A 
Sbjct: 1   MLEVQEQLKSKEVSSSVGGGAVSVKVNGQKELIEVKLSDEVLKDAANDKEMLEDLILTAV 60

Query: 76  SDAHKKIEDLVATKTQEITEGLPIP 100
            DA  K E+L   +  ++T G+ IP
Sbjct: 61  KDAMAKAEELAEGEMAKVTGGINIP 85


>gi|226355494|ref|YP_002785234.1| hypothetical protein Deide_06350 [Deinococcus deserti VCD115]
 gi|226317484|gb|ACO45480.1| conserved hypothetical protein [Deinococcus deserti VCD115]
          Length = 94

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/95 (35%), Positives = 54/95 (56%), Gaps = 5/95 (5%)

Query: 6   KMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVE 65
           K++ Q ++ Q    +++E++ +   EG+A G +V+V +NG   + G+KI    +   +VE
Sbjct: 3   KLMKQMQQAQVAANRIQENLAAQTVEGSASG-LVTVTMNGHGKVQGLKIKPEAVDASDVE 61

Query: 66  ILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
            LEDLI+ A  DA  K + L     QE T GL IP
Sbjct: 62  ALEDLILVALQDAGAKADAL----QQEATRGLGIP 92


>gi|184152971|ref|YP_001841312.1| hypothetical protein LAR_0316 [Lactobacillus reuteri JCM 1112]
 gi|227363476|ref|ZP_03847598.1| conserved hypothetical protein [Lactobacillus reuteri MM2-3]
 gi|227545160|ref|ZP_03975209.1| conserved hypothetical protein [Lactobacillus reuteri CF48-3A]
 gi|300909167|ref|ZP_07126628.1| conserved hypothetical protein [Lactobacillus reuteri SD2112]
 gi|325681914|ref|ZP_08161432.1| hypothetical protein HMPREF0536_10352 [Lactobacillus reuteri
           MM4-1A]
 gi|183224315|dbj|BAG24832.1| conserved hypothetical protein [Lactobacillus reuteri JCM 1112]
 gi|227071490|gb|EEI09791.1| conserved hypothetical protein [Lactobacillus reuteri MM2-3]
 gi|227184892|gb|EEI64963.1| conserved hypothetical protein [Lactobacillus reuteri CF48-3A]
 gi|300893032|gb|EFK86391.1| conserved hypothetical protein [Lactobacillus reuteri SD2112]
 gi|324978558|gb|EGC15507.1| hypothetical protein HMPREF0536_10352 [Lactobacillus reuteri
           MM4-1A]
          Length = 106

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 51/95 (53%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           N+ +M+ Q K +Q KM    E +   E  G A   MV+   +G N L  +KI    +  D
Sbjct: 10  NMQQMMKQAKAMQKKMMAEHEELAKQEFVGKAPDDMVTATFSGDNQLIDLKIKPEAVDPD 69

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGL 97
           ++++L+DL+IAA  D  K++ D    K  + T+G+
Sbjct: 70  DIDMLQDLVIAAVKDGMKQVNDATQQKLGKYTQGM 104


>gi|134096869|ref|YP_001102530.1| hypothetical protein SACE_0254 [Saccharopolyspora erythraea NRRL
          2338]
 gi|254765195|sp|A4F6D0|Y254_SACEN RecName: Full=UPF0133 protein SACE_0254
 gi|133909492|emb|CAL99604.1| hypothetical protein SACE_0254 [Saccharopolyspora erythraea NRRL
          2338]
          Length = 116

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 53/92 (57%)

Query: 3  NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
          N+ +++ Q +++Q ++   ++ +   E  G+AGGG+V+  ++G   L  V ID   +  D
Sbjct: 8  NMQQIMEQAQKMQQQLMTAQQELAEAEVSGSAGGGLVTAVVSGSGELKSVAIDPKAVDPD 67

Query: 63 NVEILEDLIIAAHSDAHKKIEDLVATKTQEIT 94
          + + L DL++AA  DA++  ++L   K   +T
Sbjct: 68 DTDTLSDLVVAAVRDANRAAQELQQEKMGPVT 99


>gi|257458484|ref|ZP_05623621.1| conserved hypothetical protein [Treponema vincentii ATCC 35580]
 gi|257444081|gb|EEV19187.1| conserved hypothetical protein [Treponema vincentii ATCC 35580]
          Length = 103

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 55/88 (62%)

Query: 3  NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
          N  +++   K++Q    KM+E I +L  +G +GGG+V V ++G   +  +++D   +   
Sbjct: 4  NPFELMKNAKDLQAHFGKMQEEIAALRVQGVSGGGLVKVTLSGTFDMIKIELDPIAVDNR 63

Query: 63 NVEILEDLIIAAHSDAHKKIEDLVATKT 90
          ++++L+DLI +AH+DA +KI++ +  K 
Sbjct: 64 DIQMLQDLIRSAHTDAVEKIKETLKEKV 91


>gi|167750680|ref|ZP_02422807.1| hypothetical protein EUBSIR_01657 [Eubacterium siraeum DSM 15702]
 gi|167656359|gb|EDS00489.1| hypothetical protein EUBSIR_01657 [Eubacterium siraeum DSM 15702]
 gi|291532023|emb|CBK97608.1| conserved hypothetical protein TIGR00103 [Eubacterium siraeum 70/3]
 gi|291558239|emb|CBL35356.1| conserved hypothetical protein TIGR00103 [Eubacterium siraeum
           V10Sc8a]
          Length = 116

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 63/99 (63%)

Query: 2   SNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFE 61
           +N+  M+ Q +++Q  +E+++  + + +   +A GGM+ V ++G  +L  VK++  ++ +
Sbjct: 15  NNMNSMIKQAQKMQEDIERVQAELEARDFTASAAGGMIEVTMSGAKVLKEVKLNPEVVDK 74

Query: 62  DNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           D +E L+D+I+A  +    +IE++ A + +++T G+ IP
Sbjct: 75  DAIEDLQDVIVAGVNAVITQIEEVSAAEMEKVTGGVNIP 113


>gi|319891431|ref|YP_004148306.1| hypothetical protein co-occurring with RecR [Staphylococcus
           pseudintermedius HKU10-03]
 gi|317161127|gb|ADV04670.1| hypothetical protein co-occurring with RecR [Staphylococcus
           pseudintermedius HKU10-03]
 gi|323465399|gb|ADX77552.1| conserved hypothetical protein [Staphylococcus pseudintermedius
           ED99]
          Length = 106

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 51/82 (62%), Gaps = 4/82 (4%)

Query: 19  EKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDA 78
           EK+KE       EG AGGGMV V ++G   +  V I+  ++  ++VE+L+DL++AA ++A
Sbjct: 26  EKLKEE----HVEGTAGGGMVKVVVSGHKEVVDVIINEEVVDPEDVEMLQDLVLAATNEA 81

Query: 79  HKKIEDLVATKTQEITEGLPIP 100
             K + L A +  + T+GL IP
Sbjct: 82  MNKADALTAERLGKHTKGLNIP 103


>gi|229917435|ref|YP_002886081.1| hypothetical protein EAT1b_1710 [Exiguobacterium sp. AT1b]
 gi|259646468|sp|C4KZX3|Y1710_EXISA RecName: Full=UPF0133 protein EAT1b_1710
 gi|229468864|gb|ACQ70636.1| conserved hypothetical protein [Exiguobacterium sp. AT1b]
          Length = 105

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/83 (38%), Positives = 51/83 (61%)

Query: 18  MEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSD 77
           M K +E +  L  EG AGGGMV V ++G   +  V I   ++  D+V++L+DL++AA +D
Sbjct: 21  MAKAQEELKELSVEGTAGGGMVKVVVSGHKEVLDVIIAEDVVDPDDVDMLQDLVLAAIND 80

Query: 78  AHKKIEDLVATKTQEITEGLPIP 100
           A K+ + LV  K    T+G+ +P
Sbjct: 81  AMKQADQLVNDKMGRFTQGMNLP 103


>gi|315639689|ref|ZP_07894829.1| conserved hypothetical protein [Enterococcus italicus DSM 15952]
 gi|315484650|gb|EFU75106.1| conserved hypothetical protein [Enterococcus italicus DSM 15952]
          Length = 104

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 56/98 (57%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+  M+ Q +++Q +M K +E++   E  G +  G V + I G   +  V ID +++ 
Sbjct: 5   MGNMQGMMKQVQKMQKEMVKAQEALNEREFTGESTNGYVKITITGDRKVKQVAIDPAIVD 64

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLP 98
            ++VE++EDL+  A +D  +K+E  +     + T+G+P
Sbjct: 65  PEDVEMMEDLVAMAMNDVIQKVEKEIEATMGKYTKGIP 102


>gi|73663586|ref|YP_302367.1| hypothetical protein SSP2277 [Staphylococcus saprophyticus subsp.
           saprophyticus ATCC 15305]
 gi|123641630|sp|Q49UY8|Y2277_STAS1 RecName: Full=UPF0133 protein SSP2277
 gi|72496101|dbj|BAE19422.1| conserved hypothetical protein [Staphylococcus saprophyticus subsp.
           saprophyticus ATCC 15305]
          Length = 105

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/70 (38%), Positives = 46/70 (65%)

Query: 31  EGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKKIEDLVATKT 90
           +G AGGGMV+V ++G   +  V+I    +  D++E+L+DL+IAA ++A  K ++L   + 
Sbjct: 34  QGTAGGGMVTVTVSGHKEVLDVEIKEEAVDPDDIEMLQDLVIAATNEAMNKADELTQERL 93

Query: 91  QEITEGLPIP 100
            + T+GL IP
Sbjct: 94  GKHTQGLNIP 103


>gi|111021187|ref|YP_704159.1| hypothetical protein RHA1_ro04210 [Rhodococcus jostii RHA1]
 gi|122955546|sp|Q0S8Y5|Y4210_RHOSR RecName: Full=UPF0133 protein RHA1_ro04210
 gi|110820717|gb|ABG96001.1| conserved hypothetical protein [Rhodococcus jostii RHA1]
          Length = 113

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 38/61 (62%)

Query: 29 EAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKKIEDLVAT 88
          E  G AGGG+V+  + G   + G+KID  ++  D+VE L+DL+I A  DA  K +++ A 
Sbjct: 34 EVTGQAGGGLVTATVKGTGEVVGLKIDPKVVDPDDVETLQDLVIGAIEDASNKAQEIAAQ 93

Query: 89 K 89
          K
Sbjct: 94 K 94


>gi|108801867|ref|YP_642064.1| hypothetical protein Mmcs_4904 [Mycobacterium sp. MCS]
 gi|119871020|ref|YP_940972.1| hypothetical protein Mkms_4993 [Mycobacterium sp. KMS]
 gi|126437835|ref|YP_001073526.1| hypothetical protein Mjls_5272 [Mycobacterium sp. JLS]
 gi|123368616|sp|Q1B276|Y4904_MYCSS RecName: Full=UPF0133 protein Mmcs_4904
 gi|166227301|sp|A1UMX4|Y4993_MYCSK RecName: Full=UPF0133 protein Mkms_4993
 gi|166227309|sp|A3Q7A8|Y5272_MYCSJ RecName: Full=UPF0133 protein Mjls_5272
 gi|108772286|gb|ABG11008.1| conserved hypothetical protein 103 [Mycobacterium sp. MCS]
 gi|119697109|gb|ABL94182.1| conserved hypothetical protein 103 [Mycobacterium sp. KMS]
 gi|126237635|gb|ABO01036.1| conserved hypothetical protein 103 [Mycobacterium sp. JLS]
          Length = 110

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 39/60 (65%)

Query: 23 ESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKKI 82
          ES+ + E  G AGGG+V V + G   +T V ID  ++  D+VE L+DL++ A +DA K++
Sbjct: 28 ESLANSEVHGQAGGGLVQVTMKGSGEVTSVAIDPKVVDPDDVETLQDLVVGAIADAAKQV 87


>gi|157826505|ref|YP_001495569.1| hypothetical protein A1I_00660 [Rickettsia bellii OSU 85-389]
 gi|166228810|sp|A8GU86|Y660_RICB8 RecName: Full=UPF0133 protein A1I_00660
 gi|157801809|gb|ABV78532.1| hypothetical protein A1I_00660 [Rickettsia bellii OSU 85-389]
          Length = 107

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 58/107 (54%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N  + + Q + +Q KM++ +E + +    G AGGG+V +   GK  +  V ID SLL 
Sbjct: 1   MVNFNQFLKQAQTMQKKMQEAQEQMANTRYTGKAGGGLVEIIATGKGEVEKVSIDASLLK 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           E+  E+LEDLI  A +DA +K +            G+ +PPG K PF
Sbjct: 61  EEEKEMLEDLIKVAFNDAKQKCDSDSQNSMSGALSGMSLPPGFKMPF 107


>gi|317131170|ref|YP_004090484.1| Uncharacterized protein family UPF0133 [Ethanoligenens harbinense
           YUAN-3]
 gi|315469149|gb|ADU25753.1| Uncharacterized protein family UPF0133 [Ethanoligenens harbinense
           YUAN-3]
          Length = 115

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 59/99 (59%)

Query: 2   SNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFE 61
           S++  M+ Q +++Q  + K++  +   E    +GGGMV V+I GK  +  + I    +  
Sbjct: 14  SDMNSMIKQAQKMQEAIGKVQAELDEREYTVTSGGGMVEVQITGKREIKQIHIKPEAVDP 73

Query: 62  DNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           D++E+L+DLI+A  ++A +K+++    +  ++T GL +P
Sbjct: 74  DDIEMLQDLIVAGVNEAIRKVDETAEQEMGKVTGGLNMP 112


>gi|21222035|ref|NP_627814.1| hypothetical protein SCO3619 [Streptomyces coelicolor A3(2)]
 gi|289770773|ref|ZP_06530151.1| conserved hypothetical protein [Streptomyces lividans TK24]
 gi|12644647|sp|Q9XAI3|Y3619_STRCO RecName: Full=UPF0133 protein SCO3619
 gi|5748804|gb|AAD34031.2|AF151381_1 unknown [Streptomyces coelicolor A3(2)]
 gi|5123894|emb|CAB45486.1| conserved hypothetical protein [Streptomyces coelicolor A3(2)]
 gi|289700972|gb|EFD68401.1| conserved hypothetical protein [Streptomyces lividans TK24]
          Length = 115

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 49/87 (56%)

Query: 3  NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
          N+ +++ Q +++Q  + K +E +   E +G AGGG+V   + G   L G+ ID   +  +
Sbjct: 9  NMQQLLQQAQKMQQDLAKAQEELARTEVDGQAGGGLVKATVTGSGELRGLVIDPKAVDPE 68

Query: 63 NVEILEDLIIAAHSDAHKKIEDLVATK 89
          + E L DL++AA   A++  ++L   K
Sbjct: 69 DTETLADLVVAAVQAANENAQNLQQQK 95


>gi|319790368|ref|YP_004152001.1| Uncharacterized protein family UPF0133 [Thermovibrio ammonificans
          HB-1]
 gi|317114870|gb|ADU97360.1| Uncharacterized protein family UPF0133 [Thermovibrio ammonificans
          HB-1]
          Length = 110

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 55/94 (58%)

Query: 1  MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
          M NI +++   K++Q +  K+KE +   E  G AGGG V V   G   L  V+I + L+ 
Sbjct: 6  MGNINQLMKMAKQLQAQAAKLKEEVEQREFVGTAGGGAVKVVAKGTGDLVSVEISQELID 65

Query: 61 EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEIT 94
            + E+++DL++AA + A ++  + +A + ++IT
Sbjct: 66 SGDREMIQDLVLAAANQALREARNTLAREMEKIT 99


>gi|256027689|ref|ZP_05441523.1| putative cytoplasmic protein [Fusobacterium sp. D11]
 gi|260494225|ref|ZP_05814356.1| conserved hypothetical protein [Fusobacterium sp. 3_1_33]
 gi|289765649|ref|ZP_06525027.1| conserved hypothetical protein [Fusobacterium sp. D11]
 gi|260198371|gb|EEW95887.1| conserved hypothetical protein [Fusobacterium sp. 3_1_33]
 gi|289717204|gb|EFD81216.1| conserved hypothetical protein [Fusobacterium sp. D11]
          Length = 117

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/82 (37%), Positives = 50/82 (60%), Gaps = 2/82 (2%)

Query: 21  MKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFE--DNVEILEDLIIAAHSDA 78
           ++E + S E   + GGG VSV++NG+  L  VK+   +L +  ++ E+LEDLI+ A  DA
Sbjct: 33  VQEQLKSKEVSSSVGGGAVSVKVNGQKELIEVKLSDEVLKDAANDKEMLEDLILTAVKDA 92

Query: 79  HKKIEDLVATKTQEITEGLPIP 100
             K E+L   +  ++T G+ IP
Sbjct: 93  MAKAEELAEGEMAKVTGGINIP 114


>gi|298368607|ref|ZP_06979925.1| conserved hypothetical protein [Neisseria sp. oral taxon 014 str.
           F0314]
 gi|298282610|gb|EFI24097.1| conserved hypothetical protein [Neisseria sp. oral taxon 014 str.
           F0314]
          Length = 111

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/95 (33%), Positives = 53/95 (55%), Gaps = 2/95 (2%)

Query: 10  QFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFE--DNVEIL 67
           Q +++Q  M+K +  +   E  G AG G+V V +   +++  ++I   L+ E  D+ E+L
Sbjct: 13  QAQQMQENMKKAQAKLADTEVGGEAGNGLVKVTMTCAHVVRKLEISEDLIKEAADDKEML 72

Query: 68  EDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPG 102
           EDL++AA +DA KK E+         T+GLP   G
Sbjct: 73  EDLVLAAINDASKKAEETANKTMGAFTQGLPAGMG 107


>gi|239929914|ref|ZP_04686867.1| hypothetical protein SghaA1_16929 [Streptomyces ghanaensis ATCC
          14672]
 gi|291438249|ref|ZP_06577639.1| conserved hypothetical protein [Streptomyces ghanaensis ATCC
          14672]
 gi|291341144|gb|EFE68100.1| conserved hypothetical protein [Streptomyces ghanaensis ATCC
          14672]
          Length = 113

 Score = 52.0 bits (123), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 48/87 (55%)

Query: 3  NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
          N+ +++ Q +++Q  + K +E +   E +G AGGG+V   + G   L  +KID   +  +
Sbjct: 9  NMQQLLQQAQKMQQDLAKAQEELARTEVDGQAGGGLVKATVTGSGELRALKIDPKAVDPE 68

Query: 63 NVEILEDLIIAAHSDAHKKIEDLVATK 89
          + E L DL++AA   A++  + L   K
Sbjct: 69 DTETLADLVVAAVQAANENAQTLQQQK 95


>gi|220905408|ref|YP_002480720.1| hypothetical protein Ddes_2146 [Desulfovibrio desulfuricans subsp.
           desulfuricans str. ATCC 27774]
 gi|219869707|gb|ACL50042.1| conserved hypothetical protein [Desulfovibrio desulfuricans subsp.
           desulfuricans str. ATCC 27774]
          Length = 103

 Score = 52.0 bits (123), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 57/100 (57%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+  ++ Q + +Q K+ K+++ +     E  +GGGMV   ++GK  L  + ID   L 
Sbjct: 1   MRNMNDILRQAQVMQNKIAKLQQEMGEHSYEATSGGGMVKAEVSGKQELRKITIDPKALE 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
             +VE+L+DLI+AA ++A +   + +  +   I+ G+ +P
Sbjct: 61  GGDVEMLQDLILAAVNEAGRIARETMDREMSNISGGIKLP 100


>gi|227487306|ref|ZP_03917622.1| conserved hypothetical protein [Corynebacterium glucuronolyticum
          ATCC 51867]
 gi|227542727|ref|ZP_03972776.1| conserved hypothetical protein [Corynebacterium glucuronolyticum
          ATCC 51866]
 gi|227092732|gb|EEI28044.1| conserved hypothetical protein [Corynebacterium glucuronolyticum
          ATCC 51867]
 gi|227181493|gb|EEI62465.1| conserved hypothetical protein [Corynebacterium glucuronolyticum
          ATCC 51866]
          Length = 109

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 46/75 (61%)

Query: 23 ESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKKI 82
          E I      G AGGG+V+V + G   ++ + +D  ++  ++++ L+DLII A +DAH+K+
Sbjct: 25 EEIVKSSVVGEAGGGLVTVTMRGSGQISDLTMDERVVDPEDIDGLKDLIIGAFADAHRKV 84

Query: 83 EDLVATKTQEITEGL 97
          + +   K   +T+GL
Sbjct: 85 QAMAQEKMGPLTQGL 99


>gi|260584503|ref|ZP_05852250.1| conserved hypothetical protein YaaK [Granulicatella elegans ATCC
           700633]
 gi|260158021|gb|EEW93090.1| conserved hypothetical protein YaaK [Granulicatella elegans ATCC
           700633]
          Length = 105

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 54/100 (54%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+  M+ Q +++Q +M + +E +   E  G++   +V V +NGK  +  V I    + 
Sbjct: 4   MGNMQGMMKQMQKLQKQMAQAQEELNQTEYVGSSQSDLVQVTVNGKRQVLSVSIKPEAVD 63

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
            D+VE+L+DL++ A + A ++ E        + T GL IP
Sbjct: 64  GDDVELLQDLVLMATNRALEQAEKANEQTMGQFTRGLNIP 103


>gi|257438604|ref|ZP_05614359.1| putative cytoplasmic protein [Faecalibacterium prausnitzii A2-165]
 gi|257198948|gb|EEU97232.1| putative cytoplasmic protein [Faecalibacterium prausnitzii A2-165]
          Length = 112

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 61/100 (61%), Gaps = 3/100 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M+++M+   Q +++Q  M+  +  + + E  G+A G MV+V++NGK+ +  + I    + 
Sbjct: 14  MNSLMR---QAQKMQEDMKAKQAELEAAEYTGSASGEMVTVKMNGKHEVLSITIKPEAVD 70

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
            D++E+LEDL+ AA +   K++++    +  ++T GL IP
Sbjct: 71  PDDIEMLEDLVAAAVNATVKQVDETAEAEMGKLTGGLNIP 110


>gi|259502692|ref|ZP_05745594.1| conserved hypothetical protein [Lactobacillus antri DSM 16041]
 gi|312869710|ref|ZP_07729857.1| DNA-binding protein, YbaB/EbfC family [Lactobacillus oris
           PB013-T2-3]
 gi|259169337|gb|EEW53832.1| conserved hypothetical protein [Lactobacillus antri DSM 16041]
 gi|311094759|gb|EFQ53056.1| DNA-binding protein, YbaB/EbfC family [Lactobacillus oris
           PB013-T2-3]
          Length = 102

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 50/95 (52%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           N+ +M+ Q K +Q KM    E +   E  G A   MV+    G N L  +KI    +  D
Sbjct: 6   NMQQMMKQAKAMQKKMMAEHEELAKQEFIGKAPDDMVTATFTGDNTLVDLKIKPEAVDPD 65

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGL 97
           +V++L+DL++AA +D  K++ D    K  + T G+
Sbjct: 66  DVDMLQDLVVAAINDGMKQVNDATQQKLGKYTRGM 100


>gi|242243366|ref|ZP_04797811.1| conserved hypothetical protein [Staphylococcus epidermidis W23144]
 gi|242233315|gb|EES35627.1| conserved hypothetical protein [Staphylococcus epidermidis W23144]
 gi|319399736|gb|EFV87984.1| conserved hypothetical protein [Staphylococcus epidermidis FRI909]
 gi|329727980|gb|EGG64427.1| DNA-binding protein, YbaB/EbfC family [Staphylococcus epidermidis
           VCU144]
          Length = 105

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 30/82 (36%), Positives = 50/82 (60%), Gaps = 4/82 (4%)

Query: 19  EKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDA 78
           EK+KE   +    G AGGGMV+V + G   +  V+I    +  ++VE+L+DL++AA ++A
Sbjct: 26  EKLKEERVA----GTAGGGMVTVTVTGHKEVVDVEIKEEAVDPEDVEMLQDLVLAATNEA 81

Query: 79  HKKIEDLVATKTQEITEGLPIP 100
             K ++L   +  + T+GL IP
Sbjct: 82  MNKADELTQQRLGKHTQGLNIP 103


>gi|313900970|ref|ZP_07834460.1| DNA-binding protein, YbaB/EbfC family [Clostridium sp. HGF2]
 gi|312954390|gb|EFR36068.1| DNA-binding protein, YbaB/EbfC family [Clostridium sp. HGF2]
          Length = 102

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 37/106 (34%), Positives = 55/106 (51%), Gaps = 11/106 (10%)

Query: 5   MKMVGQFKEIQGKMEKMKESITSLEAEGNA-------GGGMVSVRINGKNMLTGVKIDRS 57
           M M G  K+ Q    KM++ +T LE E N        GGG++ V + G   +  + ID S
Sbjct: 1   MNMQGLLKQAQ----KMQKELTKLEDELNEKVYETTMGGGVIKVEVKGSMSVESISIDES 56

Query: 58  LLFEDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGL 103
           LL +DN E LED++ +A +DA  K  +       +IT G+ +P G 
Sbjct: 57  LLEKDNKEDLEDMLKSALNDAFAKAVEDKEKNMNQITGGVKMPGGF 102


>gi|237755841|ref|ZP_04584439.1| conserved hypothetical protein [Sulfurihydrogenibium yellowstonense
           SS-5]
 gi|237692006|gb|EEP61016.1| conserved hypothetical protein [Sulfurihydrogenibium yellowstonense
           SS-5]
          Length = 110

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 32/97 (32%), Positives = 61/97 (62%), Gaps = 1/97 (1%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           ++ +++ Q + I+  +EK KE + + +     GGGMV V  +G   +  V+ID+SLL E+
Sbjct: 6   DLAELMKQAQSIKENIEKAKEELKNEKIVVEVGGGMVKVVSDGLGTMLDVEIDKSLLNEN 65

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPI 99
              +L+DL+IAA ++  ++ ++++A K  + T GLP+
Sbjct: 66  EYPVLKDLLIAAINEVSERSKEVIADKISQAT-GLPM 101


>gi|294630547|ref|ZP_06709107.1| conserved hypothetical protein [Streptomyces sp. e14]
 gi|292833880|gb|EFF92229.1| conserved hypothetical protein [Streptomyces sp. e14]
          Length = 114

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 48/87 (55%)

Query: 3  NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
          N+ +++ Q +++Q  + + +E +   E +G AGGG+V   + G   L  +KID   +  +
Sbjct: 9  NMQQLLQQAQKMQQDLARAQEELAQTEVDGQAGGGLVKATVTGAGELRALKIDPKAVDPE 68

Query: 63 NVEILEDLIIAAHSDAHKKIEDLVATK 89
          + E L DLI+AA   A++  + L   K
Sbjct: 69 DTETLADLIVAAVQAANENAQTLQQQK 95


>gi|184154760|ref|YP_001843100.1| hypothetical protein LAF_0284 [Lactobacillus fermentum IFO 3956]
 gi|227514027|ref|ZP_03944076.1| conserved hypothetical protein [Lactobacillus fermentum ATCC 14931]
 gi|260663211|ref|ZP_05864103.1| conserved hypothetical protein [Lactobacillus fermentum 28-3-CHN]
 gi|183226104|dbj|BAG26620.1| conserved hypothetical protein [Lactobacillus fermentum IFO 3956]
 gi|227087613|gb|EEI22925.1| conserved hypothetical protein [Lactobacillus fermentum ATCC 14931]
 gi|260552403|gb|EEX25454.1| conserved hypothetical protein [Lactobacillus fermentum 28-3-CHN]
          Length = 102

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 53/95 (55%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           N+ KM+ Q +++Q +M   +E + ++E  G A   MV+  + G   L  +KI+   +  D
Sbjct: 6   NMQKMMKQAQKMQKQMMAEQEELAAMEFVGQAPDEMVTATLTGDKKLKDLKINPEAVDPD 65

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGL 97
           +V++L DLI+AA +D   K+E     K  + T GL
Sbjct: 66  DVDMLSDLIVAAVNDGLDKVEQATQAKMGKYTRGL 100


>gi|290958617|ref|YP_003489799.1| hypothetical protein SCAB_41791 [Streptomyces scabiei 87.22]
 gi|260648143|emb|CBG71251.1| conserved hypothetical protein [Streptomyces scabiei 87.22]
          Length = 115

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 48/87 (55%)

Query: 3  NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
          N+ +++ Q +++Q  + K +E +   E +G AGGG+V   + G   L  +KID   +  +
Sbjct: 9  NMQQLLQQAQKMQQDLAKAQEELARTEVDGQAGGGLVRATVTGSGELRALKIDPKAVDPE 68

Query: 63 NVEILEDLIIAAHSDAHKKIEDLVATK 89
          + E L DL++AA   A++  + L   K
Sbjct: 69 DTETLADLVVAAVQAANENAQTLQQQK 95


>gi|149182696|ref|ZP_01861163.1| hypothetical protein BSG1_10683 [Bacillus sp. SG-1]
 gi|148849606|gb|EDL63789.1| hypothetical protein BSG1_10683 [Bacillus sp. SG-1]
          Length = 106

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 47/70 (67%)

Query: 31  EGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKKIEDLVATKT 90
           EG AGGGMV+V ++G   +  V I   ++  +++E+L+DL++AA +DA K+ ++L  +  
Sbjct: 34  EGTAGGGMVTVIVSGHKEVLEVNIKEEVVDPEDIEMLQDLVLAATNDALKQADELTNSTM 93

Query: 91  QEITEGLPIP 100
            + T+G+ +P
Sbjct: 94  GQFTKGMNLP 103


>gi|94264277|ref|ZP_01288071.1| conserved hypothetical protein [delta proteobacterium MLMS-1]
 gi|94270247|ref|ZP_01291689.1| conserved hypothetical protein [delta proteobacterium MLMS-1]
 gi|93450882|gb|EAT01897.1| conserved hypothetical protein [delta proteobacterium MLMS-1]
 gi|93455322|gb|EAT05529.1| conserved hypothetical protein [delta proteobacterium MLMS-1]
          Length = 102

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 51/84 (60%)

Query: 17  KMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHS 76
           K+  ++  +       + GGGMV   +NG++ L  ++I+++++  ++ E+L DLI AA +
Sbjct: 16  KLSGLQNELAERTVTSSVGGGMVQATVNGRHQLVDLRIEKAVINPEDPEMLRDLITAAVN 75

Query: 77  DAHKKIEDLVATKTQEITEGLPIP 100
           DA  K ++++  +  ++T G+ IP
Sbjct: 76  DAMAKAQEMIQAEMGKLTGGMNIP 99


>gi|241889558|ref|ZP_04776856.1| conserved hypothetical protein [Gemella haemolysans ATCC 10379]
 gi|241863180|gb|EER67564.1| conserved hypothetical protein [Gemella haemolysans ATCC 10379]
          Length = 105

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 55/100 (55%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+ +M+ + +++Q  M + +E +     EG   GGMV+   NG   +  +KI   ++ 
Sbjct: 4   MGNMQQMMRKMQKMQKDMLEAQEGLKDQTVEGTVSGGMVTAIANGDGKILDIKIKEEVVD 63

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
            +++E+L+DL++ A +DA +K   L      + T GL IP
Sbjct: 64  PEDIEMLQDLVLTAVNDALEKSTKLKEETLGKFTNGLSIP 103


>gi|91204863|ref|YP_537218.1| hypothetical protein RBE_0048 [Rickettsia bellii RML369-C]
 gi|122426128|sp|Q1RKI5|Y048_RICBR RecName: Full=UPF0133 protein RBE_0048
 gi|91068407|gb|ABE04129.1| unknown [Rickettsia bellii RML369-C]
          Length = 107

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 58/107 (54%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N  + + Q + +Q KM++ +E + +    G AGGG+V +   GK  +  V ID SLL 
Sbjct: 1   MVNFNQFLKQAQTMQKKMQEAQEQMANTRYTGKAGGGLVEIIATGKGEVEKVSIDASLLK 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           E+  E+LEDLI  A +DA +K +            G+ +PPG K PF
Sbjct: 61  EEEKEMLEDLIKVAFNDAKQKCDADSQNSMSGALSGMSLPPGFKMPF 107


>gi|205371942|ref|ZP_03224761.1| hypothetical protein Bcoam_00220 [Bacillus coahuilensis m4-4]
 gi|205372024|ref|ZP_03224842.1| hypothetical protein Bcoam_00671 [Bacillus coahuilensis m4-4]
          Length = 106

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 48/70 (68%)

Query: 31  EGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKKIEDLVATKT 90
           EG AGGGMV+V ++G   +  V I   ++  +++++L+DL++AA ++A KK ++L ++  
Sbjct: 35  EGTAGGGMVTVIVSGHKEVLEVNIKEEVVDPEDIDMLQDLVLAATNEALKKADELTSSTM 94

Query: 91  QEITEGLPIP 100
            + T+G+ IP
Sbjct: 95  GKFTQGMNIP 104


>gi|330470588|ref|YP_004408331.1| hypothetical protein VAB18032_03235 [Verrucosispora maris
          AB-18-032]
 gi|328813559|gb|AEB47731.1| hypothetical protein VAB18032_03235 [Verrucosispora maris
          AB-18-032]
          Length = 102

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 49/86 (56%)

Query: 4  IMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDN 63
          + +M+ Q +++Q ++ K +  +   E  G AGGG+V+  ++G   +  +KID   +  ++
Sbjct: 1  MQQMLKQAQKMQQQIAKAQAELAEAEVTGTAGGGLVTATVSGAGEIKSIKIDPKAVDPED 60

Query: 64 VEILEDLIIAAHSDAHKKIEDLVATK 89
          VE LEDL++AA  +A +    L   K
Sbjct: 61 VETLEDLVVAALHNASEAARQLTEQK 86


>gi|300790714|ref|YP_003771005.1| hypothetical protein AMED_8912 [Amycolatopsis mediterranei U32]
 gi|299800228|gb|ADJ50603.1| conserved hypothetical protein [Amycolatopsis mediterranei U32]
          Length = 119

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 43/73 (58%)

Query: 17 KMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHS 76
          K+ + +E + + E  G AGGG+V+  ++G + L  ++ID  ++  D+VE L DLI+AA  
Sbjct: 23 KLVEAQEELANTEVTGTAGGGLVTATVSGDSQLKSLQIDPKVVDPDDVETLSDLIVAAVR 82

Query: 77 DAHKKIEDLVATK 89
          DA    + L   K
Sbjct: 83 DASASAQKLTEQK 95


>gi|284023488|ref|ZP_06377886.1| hypothetical protein Saura13_02744 [Staphylococcus aureus subsp.
           aureus 132]
          Length = 105

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 44/69 (63%)

Query: 32  GNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKKIEDLVATKTQ 91
           G AGGGMV+V + G   +  V+I    +  D++E+L+DL++AA ++A  K ++L   +  
Sbjct: 35  GTAGGGMVTVTVTGHKEVVDVEIKEEAVDPDDIEMLQDLVLAATNEAMNKADELTQERLG 94

Query: 92  EITEGLPIP 100
           + T+GL IP
Sbjct: 95  KHTQGLNIP 103


>gi|259508097|ref|ZP_05750997.1| conserved hypothetical protein [Corynebacterium efficiens YS-314]
 gi|30316232|sp|Q8FU11|Y210_COREF RecName: Full=UPF0133 protein CE0210
 gi|259164320|gb|EEW48874.1| conserved hypothetical protein [Corynebacterium efficiens YS-314]
          Length = 107

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 41/66 (62%)

Query: 32 GNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKKIEDLVATKTQ 91
          G+A  G+V+V ++G   +T V ID  ++  ++VE L+DL+  A  DAHKK+ DL   K  
Sbjct: 34 GDAANGLVTVTMSGSGEVTAVNIDPKVVDPEDVETLQDLVQGAFLDAHKKVADLAQEKMG 93

Query: 92 EITEGL 97
           +++G 
Sbjct: 94 PLSQGF 99


>gi|326203227|ref|ZP_08193092.1| Uncharacterized protein family UPF0133 [Clostridium papyrosolvens
           DSM 2782]
 gi|325986485|gb|EGD47316.1| Uncharacterized protein family UPF0133 [Clostridium papyrosolvens
           DSM 2782]
          Length = 119

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 58/94 (61%)

Query: 10  QFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILED 69
           Q +++Q  MEK ++ + +   E + GGG +++   GK  +  + I   ++  D+VE+L+D
Sbjct: 25  QAQKMQKDMEKAQQDLENKTIEVSVGGGAINIVATGKKEIKEITIKPEVVDPDDVEMLQD 84

Query: 70  LIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGL 103
           LI++A ++A +K E+L  ++  +IT GL   PG+
Sbjct: 85  LILSAVNEAIRKAEELANSEMSKITGGLGGLPGM 118


>gi|25026766|ref|NP_736820.1| hypothetical protein CE0210 [Corynebacterium efficiens YS-314]
 gi|23492045|dbj|BAC17020.1| conserved hypothetical protein [Corynebacterium efficiens YS-314]
          Length = 120

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 41/66 (62%)

Query: 32  GNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKKIEDLVATKTQ 91
           G+A  G+V+V ++G   +T V ID  ++  ++VE L+DL+  A  DAHKK+ DL   K  
Sbjct: 47  GDAANGLVTVTMSGSGEVTAVNIDPKVVDPEDVETLQDLVQGAFLDAHKKVADLAQEKMG 106

Query: 92  EITEGL 97
            +++G 
Sbjct: 107 PLSQGF 112


>gi|269213472|ref|ZP_05982030.2| conserved hypothetical protein [Neisseria cinerea ATCC 14685]
 gi|269146185|gb|EEZ72603.1| conserved hypothetical protein [Neisseria cinerea ATCC 14685]
          Length = 135

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 30/91 (32%), Positives = 51/91 (56%), Gaps = 2/91 (2%)

Query: 10  QFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFE--DNVEIL 67
           Q +++Q  M+K +  +   E EG AG G+V V +   +++  + I   L+ E  D+ E+L
Sbjct: 37  QAQQMQENMKKAQAKLAETEVEGEAGNGLVKVVMTCSHVVRKIDISPELIQEAADDKEML 96

Query: 68  EDLIIAAHSDAHKKIEDLVATKTQEITEGLP 98
           EDL++AA + A  K E+  +      T+GLP
Sbjct: 97  EDLVLAAFNAASDKAEETTSKTMGAFTQGLP 127


>gi|15923469|ref|NP_371003.1| hypothetical protein SAV0479 [Staphylococcus aureus subsp. aureus
           Mu50]
 gi|15926156|ref|NP_373689.1| hypothetical protein SA0437 [Staphylococcus aureus subsp. aureus
           N315]
 gi|21282163|ref|NP_645251.1| hypothetical protein MW0434 [Staphylococcus aureus subsp. aureus
           MW2]
 gi|49482704|ref|YP_039928.1| hypothetical protein SAR0478 [Staphylococcus aureus subsp. aureus
           MRSA252]
 gi|49485343|ref|YP_042564.1| hypothetical protein SAS0436 [Staphylococcus aureus subsp. aureus
           MSSA476]
 gi|57651360|ref|YP_185409.1| hypothetical protein SACOL0521 [Staphylococcus aureus subsp. aureus
           COL]
 gi|70727532|ref|YP_254448.1| hypothetical protein SH2533 [Staphylococcus haemolyticus JCSC1435]
 gi|82750186|ref|YP_415927.1| hypothetical protein SAB0428 [Staphylococcus aureus RF122]
 gi|87160949|ref|YP_493165.1| hypothetical protein SAUSA300_0453 [Staphylococcus aureus subsp.
           aureus USA300_FPR3757]
 gi|88194234|ref|YP_499026.1| hypothetical protein SAOUHSC_00444 [Staphylococcus aureus subsp.
           aureus NCTC 8325]
 gi|151220655|ref|YP_001331477.1| hypothetical protein NWMN_0443 [Staphylococcus aureus subsp. aureus
           str. Newman]
 gi|156978807|ref|YP_001441066.1| hypothetical protein SAHV_0476 [Staphylococcus aureus subsp. aureus
           Mu3]
 gi|161508724|ref|YP_001574383.1| hypothetical protein USA300HOU_0478 [Staphylococcus aureus subsp.
           aureus USA300_TCH1516]
 gi|221142546|ref|ZP_03567039.1| hypothetical protein SauraJ_13057 [Staphylococcus aureus subsp.
           aureus str. JKD6009]
 gi|253315725|ref|ZP_04838938.1| hypothetical protein SauraC_06196 [Staphylococcus aureus subsp.
           aureus str. CF-Marseille]
 gi|253730827|ref|ZP_04864992.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           USA300_TCH959]
 gi|253735211|ref|ZP_04869376.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           TCH130]
 gi|255005272|ref|ZP_05143873.2| hypothetical protein SauraM_02355 [Staphylococcus aureus subsp.
           aureus Mu50-omega]
 gi|257424589|ref|ZP_05601018.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           55/2053]
 gi|257427255|ref|ZP_05603657.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           65-1322]
 gi|257429891|ref|ZP_05606278.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           68-397]
 gi|257432594|ref|ZP_05608957.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           E1410]
 gi|257435499|ref|ZP_05611550.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           M876]
 gi|257795400|ref|ZP_05644379.1| conserved hypothetical protein [Staphylococcus aureus A9781]
 gi|258413426|ref|ZP_05681701.1| conserved hypothetical protein [Staphylococcus aureus A9763]
 gi|258421452|ref|ZP_05684379.1| conserved hypothetical protein [Staphylococcus aureus A9719]
 gi|258424488|ref|ZP_05687365.1| conserved hypothetical protein [Staphylococcus aureus A9635]
 gi|258436849|ref|ZP_05689189.1| conserved hypothetical protein [Staphylococcus aureus A9299]
 gi|258444432|ref|ZP_05692766.1| conserved hypothetical protein [Staphylococcus aureus A8115]
 gi|258445644|ref|ZP_05693824.1| UPF0133 protein [Staphylococcus aureus A6300]
 gi|258448176|ref|ZP_05696305.1| hypothetical protein SAHG_01774 [Staphylococcus aureus A6224]
 gi|258452485|ref|ZP_05700493.1| conserved hypothetical protein [Staphylococcus aureus A5948]
 gi|258456010|ref|ZP_05703965.1| conserved hypothetical protein [Staphylococcus aureus A5937]
 gi|262049733|ref|ZP_06022599.1| hypothetical protein SAD30_1342 [Staphylococcus aureus D30]
 gi|269202098|ref|YP_003281367.1| hypothetical protein SAAV_0423 [Staphylococcus aureus subsp. aureus
           ED98]
 gi|282893618|ref|ZP_06301851.1| conserved hypothetical protein [Staphylococcus aureus A8117]
 gi|282903062|ref|ZP_06310955.1| transcriptional regulatory protein [Staphylococcus aureus subsp.
           aureus C160]
 gi|282907451|ref|ZP_06315299.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           Btn1260]
 gi|282907799|ref|ZP_06315639.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           WW2703/97]
 gi|282912684|ref|ZP_06320480.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           WBG10049]
 gi|282913304|ref|ZP_06321096.1| transcriptional regulatory protein [Staphylococcus aureus subsp.
           aureus M899]
 gi|282915795|ref|ZP_06323564.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           D139]
 gi|282918258|ref|ZP_06325999.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           C427]
 gi|282922932|ref|ZP_06330622.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           C101]
 gi|282924529|ref|ZP_06332199.1| conserved hypothetical protein [Staphylococcus aureus A9765]
 gi|282927512|ref|ZP_06335130.1| conserved hypothetical protein [Staphylococcus aureus A10102]
 gi|283768195|ref|ZP_06341109.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           H19]
 gi|283959907|ref|ZP_06377348.1| transcriptional regulatory protein [Staphylococcus aureus subsp.
           aureus A017934/97]
 gi|293498351|ref|ZP_06666205.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           58-424]
 gi|293509292|ref|ZP_06668009.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           M809]
 gi|293550559|ref|ZP_06673231.1| transcriptional regulatory protein [Staphylococcus aureus subsp.
           aureus M1015]
 gi|294850659|ref|ZP_06791382.1| hypothetical protein SKAG_02756 [Staphylococcus aureus A9754]
 gi|295405727|ref|ZP_06815537.1| hypothetical protein SMAG_00883 [Staphylococcus aureus A8819]
 gi|295427010|ref|ZP_06819649.1| hypothetical protein SIAG_01168 [Staphylococcus aureus subsp.
           aureus EMRSA16]
 gi|296276914|ref|ZP_06859421.1| hypothetical protein SauraMR_11224 [Staphylococcus aureus subsp.
           aureus MR1]
 gi|297209024|ref|ZP_06925424.1| transcriptional regulatory protein [Staphylococcus aureus subsp.
           aureus ATCC 51811]
 gi|297245636|ref|ZP_06929504.1| hypothetical protein SLAG_01733 [Staphylococcus aureus A8796]
 gi|297588778|ref|ZP_06947419.1| transcriptional regulatory protein [Staphylococcus aureus subsp.
           aureus MN8]
 gi|300911027|ref|ZP_07128476.1| transcriptional regulatory protein [Staphylococcus aureus subsp.
           aureus TCH70]
 gi|54039952|sp|P67263|Y434_STAAW RecName: Full=UPF0133 protein MW0434
 gi|54039960|sp|P99126|Y437_STAAN RecName: Full=UPF0133 protein SA0437
 gi|54042686|sp|P67262|Y479_STAAM RecName: Full=UPF0133 protein SAV0479
 gi|56749724|sp|Q6GC09|Y436_STAAS RecName: Full=UPF0133 protein SAS0436
 gi|56749753|sp|Q6GJJ4|Y478_STAAR RecName: Full=UPF0133 protein SAR0478
 gi|71153466|sp|Q5HIJ8|Y521_STAAC RecName: Full=UPF0133 protein SACOL0521
 gi|122540161|sp|Q2G0T4|Y444_STAA8 RecName: Full=UPF0133 protein SAOUHSC_00444
 gi|123487164|sp|Q2FJG3|Y453_STAA3 RecName: Full=UPF0133 protein SAUSA300_0453
 gi|123548603|sp|Q2YVW6|Y428_STAAB RecName: Full=UPF0133 protein SAB0428
 gi|123659168|sp|Q4L3D5|Y2533_STAHJ RecName: Full=UPF0133 protein SH2533
 gi|166227282|sp|A7WYL7|Y476_STAA1 RecName: Full=UPF0133 protein SAHV_0476
 gi|189040215|sp|A8Z0X3|Y478_STAAT RecName: Full=UPF0133 protein USA300HOU_0478
 gi|205829319|sp|A6QED3|Y443_STAAE RecName: Full=UPF0133 protein NWMN_0443
 gi|13700369|dbj|BAB41667.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           N315]
 gi|14246247|dbj|BAB56641.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           Mu50]
 gi|21203599|dbj|BAB94299.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           MW2]
 gi|49240833|emb|CAG39500.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           MRSA252]
 gi|49243786|emb|CAG42211.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           MSSA476]
 gi|57285546|gb|AAW37640.1| conserved hypothetical protein TIGR00103 [Staphylococcus aureus
           subsp. aureus COL]
 gi|68448258|dbj|BAE05842.1| unnamed protein product [Staphylococcus haemolyticus JCSC1435]
 gi|82655717|emb|CAI80116.1| conserved hypothetical protein [Staphylococcus aureus RF122]
 gi|87126923|gb|ABD21437.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           USA300_FPR3757]
 gi|87201792|gb|ABD29602.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           NCTC 8325]
 gi|150373455|dbj|BAF66715.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           str. Newman]
 gi|156720942|dbj|BAF77359.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           Mu3]
 gi|160367533|gb|ABX28504.1| hypothetical protein USA300HOU_0478 [Staphylococcus aureus subsp.
           aureus USA300_TCH1516]
 gi|253725439|gb|EES94168.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           USA300_TCH959]
 gi|253726875|gb|EES95604.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           TCH130]
 gi|257273607|gb|EEV05709.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           55/2053]
 gi|257276886|gb|EEV08337.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           65-1322]
 gi|257280372|gb|EEV10959.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           68-397]
 gi|257283473|gb|EEV13605.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           E1410]
 gi|257286095|gb|EEV16211.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           M876]
 gi|257789372|gb|EEV27712.1| conserved hypothetical protein [Staphylococcus aureus A9781]
 gi|257839673|gb|EEV64142.1| conserved hypothetical protein [Staphylococcus aureus A9763]
 gi|257842876|gb|EEV67298.1| conserved hypothetical protein [Staphylococcus aureus A9719]
 gi|257845083|gb|EEV69120.1| conserved hypothetical protein [Staphylococcus aureus A9635]
 gi|257848640|gb|EEV72627.1| conserved hypothetical protein [Staphylococcus aureus A9299]
 gi|257850691|gb|EEV74639.1| conserved hypothetical protein [Staphylococcus aureus A8115]
 gi|257855594|gb|EEV78529.1| UPF0133 protein [Staphylococcus aureus A6300]
 gi|257858691|gb|EEV81565.1| hypothetical protein SAHG_01774 [Staphylococcus aureus A6224]
 gi|257859885|gb|EEV82725.1| conserved hypothetical protein [Staphylococcus aureus A5948]
 gi|257862222|gb|EEV84995.1| conserved hypothetical protein [Staphylococcus aureus A5937]
 gi|259162195|gb|EEW46771.1| hypothetical protein SAD30_1342 [Staphylococcus aureus D30]
 gi|262074388|gb|ACY10361.1| hypothetical protein SAAV_0423 [Staphylococcus aureus subsp. aureus
           ED98]
 gi|269940050|emb|CBI48426.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           TW20]
 gi|282315153|gb|EFB45539.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           C101]
 gi|282317955|gb|EFB48323.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           C427]
 gi|282320333|gb|EFB50674.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           D139]
 gi|282323404|gb|EFB53723.1| transcriptional regulatory protein [Staphylococcus aureus subsp.
           aureus M899]
 gi|282324380|gb|EFB54696.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           WBG10049]
 gi|282328363|gb|EFB58636.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           WW2703/97]
 gi|282330350|gb|EFB59871.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           Btn1260]
 gi|282590836|gb|EFB95912.1| conserved hypothetical protein [Staphylococcus aureus A10102]
 gi|282592838|gb|EFB97843.1| conserved hypothetical protein [Staphylococcus aureus A9765]
 gi|282597521|gb|EFC02480.1| transcriptional regulatory protein [Staphylococcus aureus subsp.
           aureus C160]
 gi|282764304|gb|EFC04431.1| conserved hypothetical protein [Staphylococcus aureus A8117]
 gi|283461140|gb|EFC08225.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           H19]
 gi|283469771|emb|CAQ48982.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           ST398]
 gi|283789499|gb|EFC28326.1| transcriptional regulatory protein [Staphylococcus aureus subsp.
           aureus A017934/97]
 gi|285816178|gb|ADC36665.1| Conserved protein UPF0133 likely to be involved in DNA repair
           [Staphylococcus aureus 04-02981]
 gi|290919606|gb|EFD96682.1| transcriptional regulatory protein [Staphylococcus aureus subsp.
           aureus M1015]
 gi|291097282|gb|EFE27540.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           58-424]
 gi|291467931|gb|EFF10440.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           M809]
 gi|294822496|gb|EFG38942.1| hypothetical protein SKAG_02756 [Staphylococcus aureus A9754]
 gi|294969802|gb|EFG45821.1| hypothetical protein SMAG_00883 [Staphylococcus aureus A8819]
 gi|295129462|gb|EFG59089.1| hypothetical protein SIAG_01168 [Staphylococcus aureus subsp.
           aureus EMRSA16]
 gi|296886295|gb|EFH25228.1| transcriptional regulatory protein [Staphylococcus aureus subsp.
           aureus ATCC 51811]
 gi|297177622|gb|EFH36873.1| hypothetical protein SLAG_01733 [Staphylococcus aureus A8796]
 gi|297577289|gb|EFH96002.1| transcriptional regulatory protein [Staphylococcus aureus subsp.
           aureus MN8]
 gi|298693808|gb|ADI97030.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           ED133]
 gi|300887206|gb|EFK82402.1| transcriptional regulatory protein [Staphylococcus aureus subsp.
           aureus TCH70]
 gi|302332192|gb|ADL22385.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           JKD6159]
 gi|302750369|gb|ADL64546.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           str. JKD6008]
 gi|312436434|gb|ADQ75505.1| transcriptional regulatory protein [Staphylococcus aureus subsp.
           aureus TCH60]
 gi|312828974|emb|CBX33816.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           ECT-R 2]
 gi|315130109|gb|EFT86098.1| hypothetical protein CGSSa03_04557 [Staphylococcus aureus subsp.
           aureus CGS03]
 gi|315193217|gb|EFU23616.1| hypothetical protein CGSSa00_11148 [Staphylococcus aureus subsp.
           aureus CGS00]
 gi|315196725|gb|EFU27071.1| hypothetical protein CGSSa01_06897 [Staphylococcus aureus subsp.
           aureus CGS01]
 gi|320139232|gb|EFW31111.1| conserved hypothetical protein TIGR00103 [Staphylococcus aureus
           subsp. aureus MRSA131]
 gi|320142046|gb|EFW33871.1| conserved hypothetical protein TIGR00103 [Staphylococcus aureus
           subsp. aureus MRSA177]
 gi|323438496|gb|EGA96247.1| hypothetical protein SAO11_2657 [Staphylococcus aureus O11]
 gi|323441334|gb|EGA98997.1| hypothetical protein SAO46_2703 [Staphylococcus aureus O46]
 gi|329313197|gb|AEB87610.1| UPF0133 protein [Staphylococcus aureus subsp. aureus T0131]
 gi|329725114|gb|EGG61607.1| DNA-binding protein, YbaB/EbfC family [Staphylococcus aureus subsp.
           aureus 21189]
 gi|329725708|gb|EGG62187.1| DNA-binding protein, YbaB/EbfC family [Staphylococcus aureus subsp.
           aureus 21172]
 gi|329730669|gb|EGG67050.1| DNA-binding protein, YbaB/EbfC family [Staphylococcus aureus subsp.
           aureus 21193]
          Length = 105

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 44/69 (63%)

Query: 32  GNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKKIEDLVATKTQ 91
           G AGGGMV+V + G   +  V+I    +  D++E+L+DL++AA ++A  K ++L   +  
Sbjct: 35  GTAGGGMVAVTVTGHKEVVDVEIKEEAVDPDDIEMLQDLVLAATNEAMNKADELTQERLG 94

Query: 92  EITEGLPIP 100
           + T+GL IP
Sbjct: 95  KHTQGLNIP 103


>gi|148266937|ref|YP_001245880.1| hypothetical protein SaurJH9_0500 [Staphylococcus aureus subsp.
           aureus JH9]
 gi|150392983|ref|YP_001315658.1| hypothetical protein SaurJH1_0513 [Staphylococcus aureus subsp.
           aureus JH1]
 gi|189040225|sp|A5IQ31|Y500_STAA9 RecName: Full=UPF0133 protein SaurJH9_0500
 gi|189040234|sp|A6TYV3|Y513_STAA2 RecName: Full=UPF0133 protein SaurJH1_0513
 gi|147740006|gb|ABQ48304.1| conserved hypothetical protein 103 [Staphylococcus aureus subsp.
           aureus JH9]
 gi|149945435|gb|ABR51371.1| conserved hypothetical protein 103 [Staphylococcus aureus subsp.
           aureus JH1]
          Length = 105

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 44/69 (63%)

Query: 32  GNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKKIEDLVATKTQ 91
           G AGGGMV+V + G   +  V+I    +  D++E+L+DL++AA ++A  K ++L   +  
Sbjct: 35  GTAGGGMVAVTVTGHKEVVDVEIKEEAVDPDDIEMLQDLVLAATNEAMNKADELTQERLG 94

Query: 92  EITEGLPIP 100
           + T+GL IP
Sbjct: 95  KHTQGLNIP 103


>gi|323487366|ref|ZP_08092665.1| hypothetical protein HMPREF9474_04416 [Clostridium symbiosum
           WAL-14163]
 gi|323694199|ref|ZP_08108375.1| hypothetical protein HMPREF9475_03239 [Clostridium symbiosum
           WAL-14673]
 gi|323399327|gb|EGA91726.1| hypothetical protein HMPREF9474_04416 [Clostridium symbiosum
           WAL-14163]
 gi|323501672|gb|EGB17558.1| hypothetical protein HMPREF9475_03239 [Clostridium symbiosum
           WAL-14673]
          Length = 117

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 59/94 (62%), Gaps = 3/94 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M+N+MK   Q + +Q +ME+  + +   +   ++GGG V+V ++GK  +  VK+   ++ 
Sbjct: 15  MNNLMK---QAQRMQRQMEETTKELEEKQYTASSGGGAVAVTVSGKKEVVAVKLSEEVVD 71

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEIT 94
            D++E+L+DLI+AA ++A ++ E+  +    ++T
Sbjct: 72  PDDIEMLQDLIVAATNEAFRQAEEESSAAMAKLT 105


>gi|187735721|ref|YP_001877833.1| hypothetical protein Amuc_1227 [Akkermansia muciniphila ATCC
           BAA-835]
 gi|238691880|sp|B2URG7|Y1227_AKKM8 RecName: Full=UPF0133 protein Amuc_1227
 gi|187425773|gb|ACD05052.1| conserved hypothetical protein [Akkermansia muciniphila ATCC
           BAA-835]
          Length = 104

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 55/103 (53%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           NIMKM+ Q +++Q  +   +E + S        GG + V       LT + ID S++   
Sbjct: 2   NIMKMMKQVQQMQAGLAAAQEKLASQTVTTEGAGGKLKVTATCDGNLTELVIDPSIIDPS 61

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKF 105
           + E L++L++   + A  K ++  A + +++T GL +PPG+ F
Sbjct: 62  DSEFLQELLLQTINAAIAKGKETAAAEMKKLTGGLDLPPGMGF 104


>gi|41406415|ref|NP_959251.1| hypothetical protein MAP0317c [Mycobacterium avium subsp.
           paratuberculosis K-10]
 gi|81415002|sp|Q744M4|Y317_MYCPA RecName: Full=UPF0133 protein MAP_0317c
 gi|41394764|gb|AAS02634.1| hypothetical protein MAP_0317c [Mycobacterium avium subsp.
           paratuberculosis K-10]
          Length = 116

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 43/76 (56%)

Query: 22  KESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKK 81
           ++ + + E  G AGGG+V V + G   +  VKID S++   +VE L+DL++ A +DA K+
Sbjct: 27  QQQLANAEVHGQAGGGLVKVVVKGSGEVVAVKIDPSVVDPSDVETLQDLVVGAMADASKQ 86

Query: 82  IEDLVATKTQEITEGL 97
           +  +   +   +  G 
Sbjct: 87  VTRMAQERLGSLAGGF 102


>gi|325474110|gb|EGC77298.1| hypothetical protein HMPREF9353_01648 [Treponema denticola F0402]
          Length = 101

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 30/91 (32%), Positives = 51/91 (56%), Gaps = 3/91 (3%)

Query: 12  KEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLI 71
           KEIQ K+  +K  +     EG +GGG+V +R+ G   +  + +D   +   +V +L+DL+
Sbjct: 11  KEIQAKIANIKSDLDQEVVEGVSGGGLVKIRLKGSFEVESIFLDPIAVDNRDVPMLQDLV 70

Query: 72  IAAHSDAHKKIEDLVATKTQEITE---GLPI 99
            AAH+DA  K+++L+  K   +     GLP 
Sbjct: 71  RAAHNDAVAKLKELLQNKLGPLASLAGGLPF 101


>gi|302553015|ref|ZP_07305357.1| predicted protein [Streptomyces viridochromogenes DSM 40736]
 gi|302470633|gb|EFL33726.1| predicted protein [Streptomyces viridochromogenes DSM 40736]
          Length = 113

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 49/87 (56%)

Query: 3  NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
          N+ +++ Q +++Q  + + +E +   E +G AGGG+V+  + G   L  +KID   +  +
Sbjct: 9  NMQQLLQQAQKMQQDLAQAQEELAQTEVDGKAGGGLVTATVTGAGELRALKIDPKAVDPE 68

Query: 63 NVEILEDLIIAAHSDAHKKIEDLVATK 89
          + E L DL++AA   A++  + L   K
Sbjct: 69 DTETLADLVVAAVQAANENAQALQQQK 95


>gi|94271397|ref|ZP_01291949.1| conserved hypothetical protein [delta proteobacterium MLMS-1]
 gi|93450457|gb|EAT01637.1| conserved hypothetical protein [delta proteobacterium MLMS-1]
          Length = 102

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 51/84 (60%)

Query: 17  KMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHS 76
           K+  ++  +       + GGGMV   +NG++ L  ++I+++++  ++ E+L DLI AA +
Sbjct: 16  KLSGLQSELAERTVTSSVGGGMVQATVNGRHQLVDLQIEKAVINPEDPEMLRDLITAAIN 75

Query: 77  DAHKKIEDLVATKTQEITEGLPIP 100
           DA  K ++++  +  ++T G+ IP
Sbjct: 76  DAMAKAQEMIQAEMGKLTGGMNIP 99


>gi|315660107|ref|ZP_07912965.1| transcriptional regulatory protein [Staphylococcus lugdunensis
           M23590]
 gi|315495008|gb|EFU83345.1| transcriptional regulatory protein [Staphylococcus lugdunensis
           M23590]
          Length = 114

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 44/69 (63%)

Query: 32  GNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKKIEDLVATKTQ 91
           G AGGGMV+V + G   +  V+I    +  D++E+L+DL++AA ++A  K ++L   +  
Sbjct: 44  GTAGGGMVAVTVTGHKEVVDVEIKEEAVDPDDIEMLQDLVLAATNEAMNKADELTQERLG 103

Query: 92  EITEGLPIP 100
           + T+GL IP
Sbjct: 104 KHTQGLNIP 112


>gi|228474161|ref|ZP_04058898.1| conserved hypothetical protein [Staphylococcus hominis SK119]
 gi|314935126|ref|ZP_07842479.1| transcriptional regulatory protein [Staphylococcus hominis subsp.
           hominis C80]
 gi|228271856|gb|EEK13193.1| conserved hypothetical protein [Staphylococcus hominis SK119]
 gi|313656461|gb|EFS20200.1| transcriptional regulatory protein [Staphylococcus hominis subsp.
           hominis C80]
          Length = 105

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 44/69 (63%)

Query: 32  GNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKKIEDLVATKTQ 91
           G AGGGMV+V + G   +  V+I    +  D++E+L+DL++AA ++A  K ++L   +  
Sbjct: 35  GTAGGGMVAVTVTGHKEVVDVEIKEEAVDPDDIEMLQDLVLAATNEAMNKADNLTQERLG 94

Query: 92  EITEGLPIP 100
           + T+GL IP
Sbjct: 95  KHTQGLNIP 103


>gi|118445159|ref|YP_879266.1| hypothetical protein NT01CX_0824 [Clostridium novyi NT]
 gi|166228877|sp|A0Q3R4|Y824_CLONN RecName: Full=UPF0133 protein NT01CX_0824
 gi|118135615|gb|ABK62659.1| conserved hypothetical protein TIGR00103 [Clostridium novyi NT]
          Length = 114

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 45/67 (67%)

Query: 34  AGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKKIEDLVATKTQEI 93
           AGGG V+V+ NGK  +  + I+  ++  D+VE+L+DLI+AA + A K  ++  A + +++
Sbjct: 45  AGGGAVTVKANGKKEILSINIEPDVVDPDDVEMLQDLILAACNQALKTADEETANEMKKL 104

Query: 94  TEGLPIP 100
           T GL +P
Sbjct: 105 TGGLNMP 111


>gi|27469224|ref|NP_765861.1| hypothetical protein SE2306 [Staphylococcus epidermidis ATCC 12228]
 gi|57866111|ref|YP_187711.1| hypothetical protein SERP0115 [Staphylococcus epidermidis RP62A]
 gi|251811246|ref|ZP_04825719.1| conserved hypothetical protein [Staphylococcus epidermidis
           BCM-HMP0060]
 gi|282874602|ref|ZP_06283484.1| DNA-binding protein, YbaB/EbfC family [Staphylococcus epidermidis
           SK135]
 gi|293367696|ref|ZP_06614348.1| transcriptional regulatory protein [Staphylococcus epidermidis
           M23864:W2(grey)]
 gi|30316303|sp|Q8CQT5|Y2306_STAES RecName: Full=UPF0133 protein SE_2306
 gi|71153429|sp|Q5HRS8|Y115_STAEQ RecName: Full=UPF0133 protein SERP0115
 gi|27316773|gb|AAO05948.1|AE016751_243 conserved hypothetical protein [Staphylococcus epidermidis ATCC
           12228]
 gi|57636769|gb|AAW53557.1| conserved hypothetical protein TIGR00103 [Staphylococcus
           epidermidis RP62A]
 gi|251805207|gb|EES57864.1| conserved hypothetical protein [Staphylococcus epidermidis
           BCM-HMP0060]
 gi|281296526|gb|EFA89038.1| DNA-binding protein, YbaB/EbfC family [Staphylococcus epidermidis
           SK135]
 gi|291318266|gb|EFE58660.1| transcriptional regulatory protein [Staphylococcus epidermidis
           M23864:W2(grey)]
 gi|329734334|gb|EGG70648.1| DNA-binding protein, YbaB/EbfC family [Staphylococcus epidermidis
           VCU028]
 gi|329736074|gb|EGG72347.1| DNA-binding protein, YbaB/EbfC family [Staphylococcus epidermidis
           VCU045]
          Length = 105

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 50/82 (60%), Gaps = 4/82 (4%)

Query: 19  EKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDA 78
           EK+KE   +    G AGGGMV+V + G   +  V+I    +  +++E+L+DL++AA ++A
Sbjct: 26  EKLKEERVA----GTAGGGMVTVTVTGHKEVVDVEIKEEAVDPEDIEMLQDLVLAATNEA 81

Query: 79  HKKIEDLVATKTQEITEGLPIP 100
             K ++L   +  + T+GL IP
Sbjct: 82  MNKADELTQQRLGKHTQGLNIP 103


>gi|297250357|ref|ZP_06864157.2| hypothetical protein NEIPOLOT_01151 [Neisseria polysaccharea ATCC
           43768]
 gi|296839115|gb|EFH23053.1| hypothetical protein NEIPOLOT_01151 [Neisseria polysaccharea ATCC
           43768]
          Length = 135

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 50/91 (54%), Gaps = 2/91 (2%)

Query: 10  QFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFE--DNVEIL 67
           Q +++Q  M+K +  +   E EG AG G+V V +   +++  + I   L+ E  D+ E+L
Sbjct: 37  QAQQMQENMKKAQAKLAETEVEGEAGNGLVKVVMTCSHVVRKIDISPELIQEAADDKEML 96

Query: 68  EDLIIAAHSDAHKKIEDLVATKTQEITEGLP 98
           EDLI+AA + A  K E+         T+GLP
Sbjct: 97  EDLILAAFNAASDKAEETTGKTMGAFTQGLP 127


>gi|289551725|ref|YP_003472629.1| hypothetical protein SLGD_02436 [Staphylococcus lugdunensis
           HKU09-01]
 gi|289181256|gb|ADC88501.1| hypothetical protein SLGD_02436 [Staphylococcus lugdunensis
           HKU09-01]
          Length = 105

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 44/69 (63%)

Query: 32  GNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKKIEDLVATKTQ 91
           G AGGGMV+V + G   +  V+I    +  D++E+L+DL++AA ++A  K ++L   +  
Sbjct: 35  GTAGGGMVAVTVTGHKEVVDVEIKEEAVDPDDIEMLQDLVLAATNEAMNKADELTQERLG 94

Query: 92  EITEGLPIP 100
           + T+GL IP
Sbjct: 95  KHTQGLNIP 103


>gi|227824620|ref|ZP_03989452.1| conserved hypothetical protein [Acidaminococcus sp. D21]
 gi|226905119|gb|EEH91037.1| conserved hypothetical protein [Acidaminococcus sp. D21]
          Length = 110

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 54/91 (59%)

Query: 10  QFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILED 69
           + +++Q +M K+++ +     E  AGG  V V +NG   +  + I    +  D+VE+L+D
Sbjct: 17  KVQKMQSEMLKLQDELKERTVEATAGGEAVKVVVNGSKNVVSLAISPEAVDPDDVEMLQD 76

Query: 70  LIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           LI+ A ++A KK++++   +  ++T G+ +P
Sbjct: 77  LIVTAVNEAMKKVDEMTEKEMGKVTGGMKLP 107


>gi|297201257|ref|ZP_06918654.1| conserved hypothetical protein [Streptomyces sviceus ATCC 29083]
 gi|197712881|gb|EDY56915.1| conserved hypothetical protein [Streptomyces sviceus ATCC 29083]
          Length = 115

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 46/87 (52%)

Query: 3  NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
          N+ +++ Q +++Q  +   +E +   E +G AGGG+V   + G   L  +KID   +  D
Sbjct: 9  NMQQLLQQAQKMQQDLANAQEELARTEVDGQAGGGLVRATVTGAGELRALKIDPKAVDPD 68

Query: 63 NVEILEDLIIAAHSDAHKKIEDLVATK 89
          + E L DLI+AA   A +  + L   K
Sbjct: 69 DTETLADLIVAAVQAATENAQTLQQQK 95


>gi|284046733|ref|YP_003397073.1| hypothetical protein Cwoe_5292 [Conexibacter woesei DSM 14684]
 gi|283950954|gb|ADB53698.1| conserved hypothetical protein [Conexibacter woesei DSM 14684]
          Length = 113

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 49/83 (59%)

Query: 3  NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
          N+ KM+ Q + +Q  M   +E +     E  AGGGMV+V+I+G   +  + ID   +  +
Sbjct: 5  NMQKMLKQVQRMQADMMAAQERLKDEVVEATAGGGMVTVKISGDLEIKSIAIDPEAVDPE 64

Query: 63 NVEILEDLIIAAHSDAHKKIEDL 85
          +VE+L+D I+ A ++A +  ++L
Sbjct: 65 DVEMLQDTILVATNEAIRAAQEL 87


>gi|145221879|ref|YP_001132557.1| hypothetical protein Mflv_1287 [Mycobacterium gilvum PYR-GCK]
 gi|315446386|ref|YP_004079265.1| hypothetical protein Mspyr1_48940 [Mycobacterium sp. Spyr1]
 gi|189038652|sp|A4T623|Y1287_MYCGI RecName: Full=UPF0133 protein Mflv_1287
 gi|145214365|gb|ABP43769.1| conserved hypothetical protein 103 [Mycobacterium gilvum PYR-GCK]
 gi|315264689|gb|ADU01431.1| conserved hypothetical protein TIGR00103 [Mycobacterium sp.
          Spyr1]
          Length = 110

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 41/68 (60%)

Query: 22 KESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKK 81
          +E++ + E  G AGGG+V V + G   + GV ID  ++   +VE L+DLI+ A +DA K+
Sbjct: 27 QEALANAEVHGQAGGGLVQVTMKGSGEVVGVSIDPKVVDPSDVETLQDLIVGAIADAAKQ 86

Query: 82 IEDLVATK 89
          +  L   K
Sbjct: 87 VTILAHDK 94


>gi|219850061|ref|YP_002464494.1| hypothetical protein Cagg_3200 [Chloroflexus aggregans DSM 9485]
 gi|254801635|sp|B8G7M3|Y3200_CHLAD RecName: Full=UPF0133 protein Cagg_3200
 gi|219544320|gb|ACL26058.1| conserved hypothetical protein [Chloroflexus aggregans DSM 9485]
          Length = 100

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 48/78 (61%)

Query: 20 KMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAH 79
          K++E + +   EG AGGG + V++NG   +  + I   ++  ++V++L+DL++ A +DA 
Sbjct: 19 KVQEELAATIVEGTAGGGAIVVKMNGHREVQSITISPEVVDPNDVDMLQDLLLVAINDAS 78

Query: 80 KKIEDLVATKTQEITEGL 97
          +K + L   + Q +T GL
Sbjct: 79 RKAQQLAEERMQPLTGGL 96


>gi|255591756|ref|XP_002535585.1| DNA polymerase I, putative [Ricinus communis]
 gi|223522595|gb|EEF26798.1| DNA polymerase I, putative [Ricinus communis]
          Length = 409

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 29/100 (29%), Positives = 52/100 (52%), Gaps = 2/100 (2%)

Query: 7   MVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEI 66
           ++    E+Q ++   ++ I++   EG A  G+V V+ +G   +  V  D  L  ED +E 
Sbjct: 309 VLSNITELQKRINSAQKEISATTFEGKAANGLVKVQTDGNGQVKRVTFDEGLKGED-LET 367

Query: 67  LEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFP 106
           L DL++ A +DA+ + E    +K   +  GL +P G+  P
Sbjct: 368 LADLVVVAMNDANTQKEAFAKSKLAGMATGL-LPLGMSIP 406


>gi|302535334|ref|ZP_07287676.1| conserved hypothetical protein [Streptomyces sp. C]
 gi|302444229|gb|EFL16045.1| conserved hypothetical protein [Streptomyces sp. C]
          Length = 114

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 57/107 (53%), Gaps = 5/107 (4%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           ++ +++ Q +++Q  +   +E ++S E EG AGGG+V   + G   L  + ID   +  +
Sbjct: 9   DMQQLLQQAQKMQQDLAAAQEELSSAEVEGQAGGGLVKATVTGSGELRALVIDPKAVDPE 68

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATK----TQEITEGLPIPPGLKF 105
           + E L DL++AA   A++  + L   K    TQ +  G  I PGL F
Sbjct: 69  DTETLADLVVAAVQAANENAQALQQQKLGPLTQVLGGGSGI-PGLPF 114


>gi|160893579|ref|ZP_02074363.1| hypothetical protein CLOL250_01133 [Clostridium sp. L2-50]
 gi|156864564|gb|EDO57995.1| hypothetical protein CLOL250_01133 [Clostridium sp. L2-50]
          Length = 116

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 62/105 (59%), Gaps = 4/105 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M+N+MK   Q + +Q +ME   + +     E + GGG+V+ +++GK  L  +K+D  ++ 
Sbjct: 16  MNNLMK---QAQRMQKQMETTTKELEDKIYESSVGGGVVTAKVSGKKELMEIKLDPEVVD 72

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKF 105
            D++E LEDLII+A ++A +  ++       +I+ G+ +  GL F
Sbjct: 73  PDDIETLEDLIISAVNEAFRMQDEDYQENMNKISGGMGL-GGLPF 116


>gi|213022744|ref|ZP_03337191.1| hypothetical protein Salmonelentericaenterica_08993 [Salmonella
           enterica subsp. enterica serovar Typhi str. 404ty]
          Length = 49

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 33/49 (67%)

Query: 59  LFEDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           + ED+ E+LEDL+ AA +DA ++IE+    K   ++ G+ +PPG K PF
Sbjct: 1   MLEDDKEMLEDLVAAAFNDAARRIEETQKEKMASVSSGMQLPPGFKMPF 49


>gi|325288353|ref|YP_004264534.1| UPF0133 protein ybaB [Syntrophobotulus glycolicus DSM 8271]
 gi|324963754|gb|ADY54533.1| UPF0133 protein ybaB [Syntrophobotulus glycolicus DSM 8271]
          Length = 111

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 57/100 (57%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+ +M+ Q +++Q  M K KE +     + ++GGG V V ++G   +  +KI    + 
Sbjct: 9   MGNMNQMLKQAQKLQQDMLKAKEELGDKTVQASSGGGAVEVVVSGDLEVKELKIKPEAVD 68

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
            D+VE+LEDLI AA +   +  +++   +  ++T GL IP
Sbjct: 69  PDDVEMLEDLIKAAVNQGIRNAQNMAEQEMGKLTGGLNIP 108


>gi|223939212|ref|ZP_03631094.1| conserved hypothetical protein [bacterium Ellin514]
 gi|223892165|gb|EEF58644.1| conserved hypothetical protein [bacterium Ellin514]
          Length = 103

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 54/100 (54%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           MS+I K++ Q   +Q +ME+++  + +   E  +GGG V V       L  +K+D   L 
Sbjct: 1   MSSIGKLMKQAARMQQQMEEIQAQLAARTVEATSGGGAVKVVARCDGTLASIKVDPQALN 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
             + +++ED+I+ A + A  + +D+   +  ++T G  +P
Sbjct: 61  PADAQLVEDMILTATNQALAQAKDISNKEMGKVTSGFNLP 100


>gi|318061708|ref|ZP_07980429.1| hypothetical protein SSA3_27468 [Streptomyces sp. SA3_actG]
 gi|318081870|ref|ZP_07989179.1| hypothetical protein SSA3_35400 [Streptomyces sp. SA3_actF]
          Length = 104

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 49/86 (56%)

Query: 4  IMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDN 63
          + +++ Q +++Q  + + +E + + E +G AGGG+V   +NG   L G+ ID   +  ++
Sbjct: 1  MQQLLQQAQKMQQDLARAQEELAATEVDGQAGGGLVKATVNGSGELKGLVIDPKAVDPED 60

Query: 64 VEILEDLIIAAHSDAHKKIEDLVATK 89
           E L DL++AA   A++  + L   K
Sbjct: 61 TETLADLVVAAVQAANENAQQLQQQK 86


>gi|333026054|ref|ZP_08454118.1| hypothetical protein STTU_3558 [Streptomyces sp. Tu6071]
 gi|332745906|gb|EGJ76347.1| hypothetical protein STTU_3558 [Streptomyces sp. Tu6071]
          Length = 103

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 49/86 (56%)

Query: 4  IMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDN 63
          + +++ Q +++Q  + + +E + + E +G AGGG+V   +NG   L G+ ID   +  ++
Sbjct: 1  MQQLLQQAQKMQQDLARAQEELAATEVDGQAGGGLVKATVNGSGELKGLVIDPKAVDPED 60

Query: 64 VEILEDLIIAAHSDAHKKIEDLVATK 89
           E L DL++AA   A++  + L   K
Sbjct: 61 TETLADLVVAAVQAANENAQQLQQQK 86


>gi|320009949|gb|ADW04799.1| Uncharacterized protein family UPF0133 [Streptomyces flavogriseus
          ATCC 33331]
          Length = 112

 Score = 50.8 bits (120), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 47/87 (54%)

Query: 3  NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
          N+ +++ Q +++Q  +   +E +   E EG AGGG+V   + G   L  + ID S +  +
Sbjct: 9  NMQQLLQQAQKMQQDLAAAQEELARTEVEGQAGGGLVKATVTGSGELRALVIDPSAVDPE 68

Query: 63 NVEILEDLIIAAHSDAHKKIEDLVATK 89
          + E L DL++AA   A++  + L   K
Sbjct: 69 DTETLADLVVAAVQAANENAQQLQQQK 95


>gi|42527056|ref|NP_972154.1| hypothetical protein TDE1548 [Treponema denticola ATCC 35405]
 gi|41817480|gb|AAS12065.1| conserved hypothetical protein TIGR00103 [Treponema denticola
          ATCC 35405]
          Length = 95

 Score = 50.8 bits (120), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 51/90 (56%), Gaps = 3/90 (3%)

Query: 12 KEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLI 71
          KEIQ K+  +K  +     EG +GGG+V +R+ G   +  + +D   +   +V +L+DL+
Sbjct: 5  KEIQAKIANIKSDLDQEVVEGVSGGGLVKIRLKGSFEVESIFLDPIAVDNRDVPMLQDLV 64

Query: 72 IAAHSDAHKKIEDLVATK---TQEITEGLP 98
           AAH+DA  K+++L+  K      +  GLP
Sbjct: 65 RAAHNDAVAKLKELLQNKLGPLASLAGGLP 94


>gi|302530933|ref|ZP_07283275.1| predicted protein [Streptomyces sp. AA4]
 gi|302439828|gb|EFL11644.1| predicted protein [Streptomyces sp. AA4]
          Length = 118

 Score = 50.8 bits (120), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 42/73 (57%)

Query: 17 KMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHS 76
          K+ + +E + S E  G AGGG+V+  ++G + L  + ID  ++  D+VE L DL++AA  
Sbjct: 24 KLVEAQEELASTEVTGTAGGGLVTATVSGDSQLKSLVIDPKVVDPDDVETLADLVVAAVR 83

Query: 77 DAHKKIEDLVATK 89
          DA    + L   K
Sbjct: 84 DASASAQKLTEQK 96


>gi|253996277|ref|YP_003048341.1| hypothetical protein Mmol_0905 [Methylotenera mobilis JLW8]
 gi|253982956|gb|ACT47814.1| conserved hypothetical protein [Methylotenera mobilis JLW8]
          Length = 102

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 52/88 (59%), Gaps = 7/88 (7%)

Query: 20  KMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAH 79
           K +E + +++ EG A  G+V V+++ KN +  V +D S++  D+ E LEDL++ A  DA 
Sbjct: 22  KAQEELANIDVEGIAANGLVKVQMSCKNEVKRVTLDDSVM--DDKETLEDLLVIALKDAT 79

Query: 80  KKIEDLVATKTQEITEGLPIPPGLKFPF 107
            K E   AT +  ++  +  P G+K PF
Sbjct: 80  AKAE---ATSSARLSSFM--PAGMKLPF 102


>gi|254796846|ref|YP_003081683.1| hypothetical protein NRI_0463 [Neorickettsia risticii str.
           Illinois]
 gi|254590082|gb|ACT69444.1| conserved hypothetical protein [Neorickettsia risticii str.
           Illinois]
          Length = 102

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 38/107 (35%), Positives = 57/107 (53%), Gaps = 12/107 (11%)

Query: 5   MKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNV 64
           M + G  K +Q KM  +K+   +    G A GGMV V I+G   L  + ID  L  E+++
Sbjct: 1   MDIQGMLKGMQKKMSDIKQKKDNARYTGEAAGGMVKVIIDGNFDLKEIIIDEKL--EEDM 58

Query: 65  EILEDLIIAAHSDAHKKIEDLVATKTQE-----ITEGLPIPPGLKFP 106
            IL DLIIAA++ A       +A+K +E     + +G P+P  +K P
Sbjct: 59  CILSDLIIAAYNHAKD-----LASKDEESFEDNLLKGFPMPFDMKKP 100


>gi|326383524|ref|ZP_08205210.1| hypothetical protein SCNU_11325 [Gordonia neofelifaecis NRRL
           B-59395]
 gi|326197608|gb|EGD54796.1| hypothetical protein SCNU_11325 [Gordonia neofelifaecis NRRL
           B-59395]
          Length = 128

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 49/83 (59%)

Query: 7   MVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEI 66
           ++ Q +++Q +ME   E I++    G AG G+V++  +G   +  V+I R ++  +++E 
Sbjct: 32  LMAQVQQMQSQMEAAHEVISATAVVGTAGNGLVTLTGDGTGAIKSVEISRDVVDPEDIET 91

Query: 67  LEDLIIAAHSDAHKKIEDLVATK 89
           L+DL++ A +D     + LVA K
Sbjct: 92  LQDLVVGAFADFAANRDALVADK 114


>gi|229823582|ref|ZP_04449651.1| hypothetical protein GCWU000282_00880 [Catonella morbi ATCC 51271]
 gi|229787026|gb|EEP23140.1| hypothetical protein GCWU000282_00880 [Catonella morbi ATCC 51271]
          Length = 125

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 60/103 (58%), Gaps = 3/103 (2%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEA---EGNAGGGMVSVRINGKNMLTGVKIDRS 57
           M N+  M G  ++IQ   ++M +   ++EA   +      +V+V++NGK  L  + +   
Sbjct: 22  MGNMGNMQGMMQKIQKMQKEMTKEQAAIEATIFQAQDVNQLVTVKVNGKKELVELDLAPD 81

Query: 58  LLFEDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           L+  D++E+L+DL+IA  +DA K+++    ++  + T+G+ +P
Sbjct: 82  LVDPDDIEMLQDLVIATVNDALKQVDQATESRLGKYTQGMNLP 124


>gi|302669597|ref|YP_003829557.1| hypothetical protein bpr_I0226 [Butyrivibrio proteoclasticus
          B316]
 gi|302394070|gb|ADL32975.1| hypothetical protein bpr_I0226 [Butyrivibrio proteoclasticus
          B316]
          Length = 118

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 30/84 (35%), Positives = 51/84 (60%), Gaps = 3/84 (3%)

Query: 1  MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
          MSN+MK   Q + +Q +ME+ ++ + + E    AGGG V V + G   L  V I    + 
Sbjct: 16 MSNLMK---QAQRMQRQMEESQKELETKEFTAKAGGGAVEVTVFGNKSLKSVTISPEAVD 72

Query: 61 EDNVEILEDLIIAAHSDAHKKIED 84
           D+VE+L+D+I+AA ++A K+ ++
Sbjct: 73 PDDVEMLQDMIVAAVNEAMKQADE 96


>gi|227510686|ref|ZP_03940735.1| conserved hypothetical protein [Lactobacillus brevis subsp.
           gravesensis ATCC 27305]
 gi|227513702|ref|ZP_03943751.1| conserved hypothetical protein [Lactobacillus buchneri ATCC 11577]
 gi|227522508|ref|ZP_03952557.1| conserved hypothetical protein [Lactobacillus hilgardii ATCC 8290]
 gi|227083021|gb|EEI18333.1| conserved hypothetical protein [Lactobacillus buchneri ATCC 11577]
 gi|227090330|gb|EEI25642.1| conserved hypothetical protein [Lactobacillus hilgardii ATCC 8290]
 gi|227189807|gb|EEI69874.1| conserved hypothetical protein [Lactobacillus brevis subsp.
           gravesensis ATCC 27305]
          Length = 103

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 46/77 (59%)

Query: 22  KESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKK 81
           ++++   E  G+A   MV V  NG+ ++T +KI    +  D+ E+L DLI+AA +DA KK
Sbjct: 25  QDNLNKQEFTGSAPDDMVVVTFNGERIMTDIKIKPEAIDPDDPEMLSDLIVAAVNDAMKK 84

Query: 82  IEDLVATKTQEITEGLP 98
           I+D   +   +  +G+P
Sbjct: 85  IKDTTQSTMGKYAKGIP 101


>gi|118465573|ref|YP_879672.1| hypothetical protein MAV_0387 [Mycobacterium avium 104]
 gi|254773391|ref|ZP_05214907.1| hypothetical protein MaviaA2_01751 [Mycobacterium avium subsp.
          avium ATCC 25291]
 gi|118166860|gb|ABK67757.1| conserved hypothetical protein [Mycobacterium avium 104]
          Length = 108

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 39/61 (63%)

Query: 22 KESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKK 81
          ++ + + E  G AGGG+V V + G   +  VKID S++   +VE L+DL++ A +DA K+
Sbjct: 19 QQQLANAEVHGQAGGGLVKVVVKGSGEVVAVKIDPSVVDPSDVETLQDLVVGAMADASKQ 78

Query: 82 I 82
          +
Sbjct: 79 V 79


>gi|189346404|ref|YP_001942933.1| hypothetical protein Clim_0875 [Chlorobium limicola DSM 245]
 gi|238692212|sp|B3EIC4|Y875_CHLL2 RecName: Full=UPF0133 protein Clim_0875
 gi|189340551|gb|ACD89954.1| conserved hypothetical protein [Chlorobium limicola DSM 245]
          Length = 111

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 50/78 (64%), Gaps = 2/78 (2%)

Query: 1  MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
          M N+  M+ Q ++   KM+ ++  +  L A G +GGGMV V ++GK  L  ++ID  ++ 
Sbjct: 3  MPNLGDMMKQIQKAGEKMQDVQNQLEKLVAHGESGGGMVKVSVSGKQKLLSLRIDPEIM- 61

Query: 61 EDNVEILEDLIIAAHSDA 78
           D+ E+++DL+IAA ++A
Sbjct: 62 -DDAEMVQDLVIAAVNNA 78


>gi|329939342|ref|ZP_08288678.1| hypothetical protein SGM_4170 [Streptomyces griseoaurantiacus
          M045]
 gi|329301571|gb|EGG45465.1| hypothetical protein SGM_4170 [Streptomyces griseoaurantiacus
          M045]
          Length = 113

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 49/87 (56%)

Query: 3  NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
          N+ +++ Q +++Q  + + +E +   E +G +GGG+V   + G   L  +KID   +  +
Sbjct: 9  NMQQLLQQAQKMQQDLARAQEELARTEVDGQSGGGLVKATVTGAGELRALKIDPKAVDPE 68

Query: 63 NVEILEDLIIAAHSDAHKKIEDLVATK 89
          + E L DL++AA   A++  ++L   K
Sbjct: 69 DTETLADLVVAAVQAANENAQNLQQQK 95


>gi|329767045|ref|ZP_08258573.1| hypothetical protein HMPREF0428_00270 [Gemella haemolysans M341]
 gi|328837770|gb|EGF87395.1| hypothetical protein HMPREF0428_00270 [Gemella haemolysans M341]
          Length = 105

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 54/100 (54%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+ +M+ + +++Q  M   +E +     EG   GGMV+   NG   +  +KI   ++ 
Sbjct: 4   MGNMQQMMRKMQKMQKDMLAAQEGLKDQTVEGTVSGGMVTAIANGDGKILDIKIKEEVVD 63

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
            +++E+L+D+I+ A +DA +K   L      + T GL IP
Sbjct: 64  PEDIEMLQDMILTAVNDALEKSTQLKEETLGKFTNGLNIP 103


>gi|284989077|ref|YP_003407631.1| hypothetical protein Gobs_0478 [Geodermatophilus obscurus DSM
          43160]
 gi|284062322|gb|ADB73260.1| conserved hypothetical protein [Geodermatophilus obscurus DSM
          43160]
          Length = 111

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 38/58 (65%)

Query: 32 GNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKKIEDLVATK 89
          G AGG +VSV + G+  +T V I  + +  D+VE L+DLI+AA  DA + + +L A++
Sbjct: 37 GTAGGNLVSVTMTGQGEVTAVTIAPAAVDPDDVESLQDLIVAAFRDASRAVNELTASR 94


>gi|160945466|ref|ZP_02092692.1| hypothetical protein FAEPRAM212_02991 [Faecalibacterium prausnitzii
           M21/2]
 gi|158443197|gb|EDP20202.1| hypothetical protein FAEPRAM212_02991 [Faecalibacterium prausnitzii
           M21/2]
          Length = 121

 Score = 50.8 bits (120), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 55/91 (60%)

Query: 10  QFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILED 69
           Q +++Q  M+  +  + + E  G+A G MV+V++NGK+ +  + I    +  D++E+LED
Sbjct: 29  QAQKMQEDMKSKQAELEAAEYTGSAAGEMVTVKMNGKHEVLSITIKPEAVDPDDIEMLED 88

Query: 70  LIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           ++ AA +   K++++    +  ++T GL IP
Sbjct: 89  MVAAAINATVKQVDETAEAEMGKLTGGLNIP 119


>gi|295105373|emb|CBL02917.1| conserved hypothetical protein TIGR00103 [Faecalibacterium
           prausnitzii SL3/3]
          Length = 112

 Score = 50.8 bits (120), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 55/91 (60%)

Query: 10  QFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILED 69
           Q +++Q  M+  +  + + E  G+A G MV+V++NGK+ +  + I    +  D++E+LED
Sbjct: 20  QAQKMQEDMKSKQAELEAAEYTGSAAGEMVTVKMNGKHEVLSITIKPEAVDPDDIEMLED 79

Query: 70  LIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           ++ AA +   K++++    +  ++T GL IP
Sbjct: 80  MVAAAINATVKQVDETAEAEMGKLTGGLNIP 110


>gi|313114017|ref|ZP_07799571.1| conserved hypothetical protein TIGR00103 [Faecalibacterium cf.
           prausnitzii KLE1255]
 gi|310623637|gb|EFQ07038.1| conserved hypothetical protein TIGR00103 [Faecalibacterium cf.
           prausnitzii KLE1255]
          Length = 112

 Score = 50.4 bits (119), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 55/91 (60%)

Query: 10  QFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILED 69
           Q +++Q  M+  +  + + E  G+A G MV+V++NGK+ +  + I    +  D+VE+LED
Sbjct: 20  QAQKMQEDMKAKQAELEAAEYTGSAAGEMVTVKMNGKHEVLSINIKPEAVDPDDVEMLED 79

Query: 70  LIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           ++ AA +   K++++    +  ++T G+ IP
Sbjct: 80  MVAAAINATVKQVDETAEAEMGKLTGGMNIP 110


>gi|227529516|ref|ZP_03959565.1| conserved hypothetical protein [Lactobacillus vaginalis ATCC 49540]
 gi|227350601|gb|EEJ40892.1| conserved hypothetical protein [Lactobacillus vaginalis ATCC 49540]
          Length = 102

 Score = 50.4 bits (119), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 47/90 (52%)

Query: 8   VGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEIL 67
           V Q KE+Q KM    E +   +  G A  GMV+    G N L  ++I    +  D++++L
Sbjct: 11  VKQAKEMQKKMMAEHEELAKQQFVGQAPDGMVTATFTGDNKLVNLEIKPEAVDPDDIDML 70

Query: 68  EDLIIAAHSDAHKKIEDLVATKTQEITEGL 97
            DL++AA +D  KK+ D   +   + T GL
Sbjct: 71  SDLVLAAVNDGMKKVNDATQSTLGKYTRGL 100


>gi|78189157|ref|YP_379495.1| hypothetical protein Cag_1190 [Chlorobium chlorochromatii CaD3]
 gi|123579731|sp|Q3ARC3|Y1190_CHLCH RecName: Full=UPF0133 protein Cag_1190
 gi|78171356|gb|ABB28452.1| conserved hypothetical protein [Chlorobium chlorochromatii CaD3]
          Length = 111

 Score = 50.4 bits (119), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 57/100 (57%), Gaps = 2/100 (2%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+  M+ Q ++   KM+++++ +  L A G AGGGMV   ++GK  L  + ID  ++ 
Sbjct: 3   MPNLGDMMKQIQQAGEKMQEVQKQLERLVAHGEAGGGMVKATVSGKQKLLSLAIDPEIM- 61

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
            D+ E+++DL++AA + A      L   +  ++T G+  P
Sbjct: 62  -DDYEMVQDLVVAAVNSALDASLKLAQDEIGKVTGGMMNP 100


>gi|323140457|ref|ZP_08075385.1| DNA-binding protein, YbaB/EbfC family [Phascolarctobacterium sp.
           YIT 12067]
 gi|322415025|gb|EFY05816.1| DNA-binding protein, YbaB/EbfC family [Phascolarctobacterium sp.
           YIT 12067]
          Length = 108

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 65/100 (65%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+  M+ + +++Q  M KM+E + S   E + GGG V+V ++GK  L  +KI+ + + 
Sbjct: 6   MGNMQAMMKKVQKMQADMAKMQEDLKSRTVETSVGGGAVTVVVSGKKELKSIKINPTAVD 65

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
            ++VE+LED+I+ A +DA K+I++L   +  ++T G+ +P
Sbjct: 66  PEDVEMLEDMILTAVNDAMKQIDELTEKEMAKVTGGMKLP 105


>gi|116622272|ref|YP_824428.1| hypothetical protein Acid_3166 [Candidatus Solibacter usitatus
          Ellin6076]
 gi|116225434|gb|ABJ84143.1| conserved hypothetical protein 103 [Candidatus Solibacter
          usitatus Ellin6076]
          Length = 102

 Score = 50.4 bits (119), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 43/65 (66%), Gaps = 2/65 (3%)

Query: 25 ITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKKIED 84
          I  +  E  AGGGM++V+++G+  L GVKID  +    +VE+L+D+I+AA  +A K++E 
Sbjct: 25 IALIRVEATAGGGMITVKMDGQKNLLGVKIDPEV--AGDVEMLQDMIVAACGEAVKQVEA 82

Query: 85 LVATK 89
           +  K
Sbjct: 83 QIQQK 87


>gi|304414790|ref|ZP_07395749.1| hypothetical protein REG_1486 [Candidatus Regiella insecticola
           LSR1]
 gi|304283142|gb|EFL91555.1| hypothetical protein REG_1486 [Candidatus Regiella insecticola
           LSR1]
          Length = 106

 Score = 50.4 bits (119), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 51/102 (50%), Gaps = 3/102 (2%)

Query: 7   MVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED-NVE 65
           M    K  Q  +EK++  I   EA G +G G+V V ING      + ID SL+  D + +
Sbjct: 7   MASAIKGAQKNIEKIQAEIQQAEAIGESGAGLVKVTINGAYKCLKISIDPSLITGDVDKK 66

Query: 66  ILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           +LEDLI  A+ +A +KI  +   K   I+       G K PF
Sbjct: 67  MLEDLICVAYDNAVEKIAAIQKEKLGVISN--VFQSGFKMPF 106


>gi|120406471|ref|YP_956300.1| hypothetical protein Mvan_5528 [Mycobacterium vanbaalenii PYR-1]
 gi|166227326|sp|A1TGJ4|Y5528_MYCVP RecName: Full=UPF0133 protein Mvan_5528
 gi|119959289|gb|ABM16294.1| conserved hypothetical protein 103 [Mycobacterium vanbaalenii
          PYR-1]
          Length = 110

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 39/61 (63%)

Query: 22 KESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKK 81
          +E++ + E  G AGGG+V V + G   +  V+ID  ++   +VE L+DLI+ A +DA K+
Sbjct: 27 QEALANAEVNGQAGGGLVQVTMRGSGEVVAVRIDPKVVDPSDVETLQDLIVGAVADAAKQ 86

Query: 82 I 82
          +
Sbjct: 87 V 87


>gi|3925824|dbj|BAA34649.1| dnaX-recR junction region~orf-12 [Deinococcus radiodurans]
          Length = 111

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 52/83 (62%), Gaps = 1/83 (1%)

Query: 3  NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
          ++ K++ Q ++ Q    K+++ + +   EG A G +V+V++NG   +T +KI    +  D
Sbjct: 2  DMKKLMKQMQQAQVAAGKIQDELAAQSVEGTASG-LVTVQMNGHGKVTSLKIKPEAVDGD 60

Query: 63 NVEILEDLIIAAHSDAHKKIEDL 85
          +VE LEDLI+AA +DA +K E L
Sbjct: 61 DVEALEDLILAAINDAAEKAEGL 83


>gi|319441766|ref|ZP_07990922.1| hypothetical protein CvarD4_08381 [Corynebacterium variabile DSM
          44702]
          Length = 99

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 46/81 (56%)

Query: 17 KMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHS 76
          K+++ +  I +   EG AG G+V V I+G   +  + ID  ++  D+VE L+DL+I A  
Sbjct: 14 KLQEAQAEIVTSTVEGTAGNGLVKVSISGAGEVQSLNIDPQVVDPDDVETLQDLVIGAFQ 73

Query: 77 DAHKKIEDLVATKTQEITEGL 97
           A+  ++ L   K   +++GL
Sbjct: 74 AANDNLQQLSQEKMGPLSQGL 94


>gi|291006688|ref|ZP_06564661.1| hypothetical protein SeryN2_19376 [Saccharopolyspora erythraea
          NRRL 2338]
          Length = 108

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 49/85 (57%), Gaps = 3/85 (3%)

Query: 1  MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
          M  IM+   Q +++Q ++   ++ +   E  G+AGGG+V+  ++G   L  V ID   + 
Sbjct: 1  MQQIME---QAQKMQQQLMTAQQELAEAEVSGSAGGGLVTAVVSGSGELKSVAIDPKAVD 57

Query: 61 EDNVEILEDLIIAAHSDAHKKIEDL 85
           D+ + L DL++AA  DA++  ++L
Sbjct: 58 PDDTDTLSDLVVAAVRDANRAAQEL 82


>gi|19551494|ref|NP_599496.1| hypothetical protein NCgl0240 [Corynebacterium glutamicum ATCC
          13032]
 gi|62389141|ref|YP_224543.1| hypothetical protein cg0297 [Corynebacterium glutamicum ATCC
          13032]
 gi|145294360|ref|YP_001137181.1| hypothetical protein cgR_0315 [Corynebacterium glutamicum R]
 gi|25009587|sp|Q8NTQ9|Y243_CORGL RecName: Full=UPF0133 protein Cgl0243/cg0297
 gi|166229395|sp|A4QAN2|Y315_CORGB RecName: Full=UPF0133 protein cgR_0315
 gi|21323007|dbj|BAB97636.1| Uncharacterized BCR [Corynebacterium glutamicum ATCC 13032]
 gi|41324474|emb|CAF18814.1| Uncharacterized BCR, YbaB family COG0718 [Corynebacterium
          glutamicum ATCC 13032]
 gi|140844280|dbj|BAF53279.1| hypothetical protein [Corynebacterium glutamicum R]
          Length = 103

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 42/66 (63%)

Query: 32 GNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKKIEDLVATKTQ 91
          GNAG G+V+V + G   ++ V +D  ++  ++VE L+DL++ A  DAH K+ ++   K  
Sbjct: 34 GNAGNGLVTVTMAGNGEVSAVTVDPKVVDPEDVETLQDLLLGAFKDAHNKVANVAEEKMG 93

Query: 92 EITEGL 97
           +++G+
Sbjct: 94 PLSQGM 99


>gi|163740345|ref|ZP_02147739.1| hypothetical protein RG210_09597 [Phaeobacter gallaeciensis 2.10]
 gi|161386203|gb|EDQ10578.1| hypothetical protein RG210_09597 [Phaeobacter gallaeciensis 2.10]
          Length = 99

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 45/74 (60%)

Query: 1  MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
          + ++ KM+   +E+Q KM +M+E + ++   G AG G+V    + K  L  + ID S+  
Sbjct: 8  LGDMAKMMKSAQELQTKMAQMQEDLHNVMVTGEAGAGLVKATASAKGDLKALDIDPSIFN 67

Query: 61 EDNVEILEDLIIAA 74
           D+ E++EDLI+AA
Sbjct: 68 GDDKEVVEDLILAA 81


>gi|256419877|ref|YP_003120530.1| hypothetical protein Cpin_0831 [Chitinophaga pinensis DSM 2588]
 gi|256034785|gb|ACU58329.1| conserved hypothetical protein [Chitinophaga pinensis DSM 2588]
          Length = 103

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 45/78 (57%)

Query: 7  MVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEI 66
          + G+ +E Q KM++ KE ++ +  +G AG G V V + G   +  + +   LL +DN E 
Sbjct: 5  LFGKLQEAQSKMKESKERLSHITVDGEAGDGAVKVVVTGNREVKSIDVAEHLLEKDNKEE 64

Query: 67 LEDLIIAAHSDAHKKIED 84
          LEDL+I A + A K  E+
Sbjct: 65 LEDLLITALNRALKNAEN 82


>gi|88608370|ref|YP_506374.1| hypothetical protein NSE_0490 [Neorickettsia sennetsu str.
           Miyayama]
 gi|88600539|gb|ABD46007.1| conserved hypothetical protein TIGR00103 [Neorickettsia sennetsu
           str. Miyayama]
          Length = 105

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 37/103 (35%), Positives = 53/103 (51%), Gaps = 12/103 (11%)

Query: 9   GQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILE 68
           G  K +Q KM  +K+   +    G A GGMV V I+G   L  + ID  L  E+++ ++ 
Sbjct: 8   GMLKGMQKKMSDIKQKKDNARYTGEAAGGMVKVIIDGNFDLKEITIDEKL--EEDMCVIS 65

Query: 69  DLIIAAHSDAHKKIEDLVATKTQEITEG-----LPIPPGLKFP 106
           DLIIAA++ A       +A K +E  EG      PIP  +K P
Sbjct: 66  DLIIAAYNHAKD-----LAAKDEESLEGNLLKDFPIPFDIKKP 103


>gi|23097485|ref|NP_690951.1| hypothetical protein OB0030 [Oceanobacillus iheyensis HTE831]
 gi|30316228|sp|Q8EU59|Y030_OCEIH RecName: Full=UPF0133 protein OB0030
 gi|22775708|dbj|BAC11986.1| hypothetical conserved protein [Oceanobacillus iheyensis HTE831]
          Length = 104

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 49/79 (62%)

Query: 22  KESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKK 81
           ++ +  +  E  AGGGMV+V+ +GK  +  V+I   ++  D++++L+DLI+AA +D   +
Sbjct: 23  QDELHEMTFEATAGGGMVTVKASGKKEIIDVEIKEEVVDPDDIDMLQDLILAATNDVLNQ 82

Query: 82  IEDLVATKTQEITEGLPIP 100
           I++       + T+G+ +P
Sbjct: 83  IDEKTNDTMGQFTKGMNMP 101


>gi|253682747|ref|ZP_04863543.1| conserved hypothetical protein [Clostridium botulinum D str. 1873]
 gi|253561069|gb|EES90522.1| conserved hypothetical protein [Clostridium botulinum D str. 1873]
          Length = 114

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 46/72 (63%)

Query: 29  EAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKKIEDLVAT 88
           E E +AGGG V+V+ NGK  +  + I+  ++  D+VE+L+DLI+AA +   K  ++    
Sbjct: 40  EFEASAGGGAVTVKANGKKEIISINIEPDVVDPDDVEMLQDLILAACNQVLKTADEETNK 99

Query: 89  KTQEITEGLPIP 100
           + +++T GL +P
Sbjct: 100 EMKKLTGGLNMP 111


>gi|256786879|ref|ZP_05525310.1| hypothetical protein SlivT_20529 [Streptomyces lividans TK24]
          Length = 106

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 48/86 (55%)

Query: 4  IMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDN 63
          + +++ Q +++Q  + K +E +   E +G AGGG+V   + G   L G+ ID   +  ++
Sbjct: 1  MQQLLQQAQKMQQDLAKAQEELARTEVDGQAGGGLVKATVTGSGELRGLVIDPKAVDPED 60

Query: 64 VEILEDLIIAAHSDAHKKIEDLVATK 89
           E L DL++AA   A++  ++L   K
Sbjct: 61 TETLADLVVAAVQAANENAQNLQQQK 86


>gi|261400851|ref|ZP_05986976.1| conserved hypothetical protein [Neisseria lactamica ATCC 23970]
 gi|269209321|gb|EEZ75776.1| conserved hypothetical protein [Neisseria lactamica ATCC 23970]
          Length = 129

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 50/100 (50%), Gaps = 2/100 (2%)

Query: 10  QFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFE--DNVEIL 67
           Q +++Q  M+K +  +   E EG AG G+V + +   + +  + I   L+ E  D+ E+L
Sbjct: 13  QAQQMQENMKKAQAKLAETEIEGEAGNGLVKITMTCAHEVRKIDISPDLIQEAADDKEML 72

Query: 68  EDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
           EDLI+AA   A  K E+         T+GLP   G   P 
Sbjct: 73  EDLILAALKSARGKAEETANKTMGAFTQGLPPRRGRLLPL 112


>gi|309775005|ref|ZP_07670020.1| valyl-tRNA synthetase, class Ia [Erysipelotrichaceae bacterium
           3_1_53]
 gi|308917223|gb|EFP62948.1| valyl-tRNA synthetase, class Ia [Erysipelotrichaceae bacterium
           3_1_53]
          Length = 102

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 36/106 (33%), Positives = 54/106 (50%), Gaps = 11/106 (10%)

Query: 5   MKMVGQFKEIQGKMEKMKESITSLEAEGNA-------GGGMVSVRINGKNMLTGVKIDRS 57
           M M G  K+ Q    KM++ +T LE E N        GGG++   + G   +  + ID S
Sbjct: 1   MNMQGLLKQAQ----KMQKELTKLEDELNEKVYESTMGGGVIKAEVKGNMSVESITIDES 56

Query: 58  LLFEDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGL 103
           LL +DN E LE+++ AA +DA  K  +       +IT G+ +P G 
Sbjct: 57  LLEKDNKEDLEEMLKAALNDAFAKAVEDKEKNMNQITGGVKMPGGF 102


>gi|168700664|ref|ZP_02732941.1| hypothetical protein GobsU_14162 [Gemmata obscuriglobus UQM 2246]
          Length = 117

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 53/87 (60%)

Query: 4  IMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDN 63
          +M ++G   +IQ +++K +  +  + AE ++G G V+V++NGK  +  V+I    +  ++
Sbjct: 8  MMSLLGNQGKIQEEVQKFQTQVGQITAEASSGAGYVTVKVNGKMEVLSVRISEEAMKLND 67

Query: 64 VEILEDLIIAAHSDAHKKIEDLVATKT 90
           E+LEDLI AA + A  K+   +A ++
Sbjct: 68 REMLEDLISAATNQALTKVRQQLAEES 94


>gi|313680266|ref|YP_004058005.1| hypothetical protein Ocepr_1376 [Oceanithermus profundus DSM
          14977]
 gi|313152981|gb|ADR36832.1| Uncharacterized protein family UPF0133 [Oceanithermus profundus
          DSM 14977]
          Length = 104

 Score = 49.7 bits (117), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 44/83 (53%)

Query: 3  NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
          N  K++ + K+ Q K  +++E +  +   G A GG+V V  NG   +  + +    +  D
Sbjct: 2  NFQKLLKEAKKAQQKAAEIQEKLAGMTVVGTAAGGLVEVTANGHGQIVAISLKPEAVDPD 61

Query: 63 NVEILEDLIIAAHSDAHKKIEDL 85
          +VE LEDL++ A  DA  K  +L
Sbjct: 62 DVEALEDLLLVAVQDAQAKAAEL 84


>gi|313885629|ref|ZP_07819379.1| DNA-binding protein, YbaB/EbfC family [Eremococcus coleocola
           ACS-139-V-Col8]
 gi|312619359|gb|EFR30798.1| DNA-binding protein, YbaB/EbfC family [Eremococcus coleocola
           ACS-139-V-Col8]
          Length = 107

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 56/103 (54%), Gaps = 3/103 (2%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEA---EGNAGGGMVSVRINGKNMLTGVKIDRS 57
           M N+  M G  K++Q   ++M+    +LEA   E      +V V++NGK  +  + I   
Sbjct: 4   MPNMGNMQGMMKQMQKVQKEMQAEQANLEASVFEAQDTNRLVQVKVNGKKEIIELNIAAD 63

Query: 58  LLFEDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           L+  D++++L+DL+IA  +DA  +++     +    T+GL +P
Sbjct: 64  LVDPDDIDMLQDLVIATVNDALGQVDRATEQRMGRFTQGLNLP 106


>gi|22298265|ref|NP_681512.1| hypothetical protein tlr0723 [Thermosynechococcus elongatus BP-1]
 gi|30316306|sp|Q8DKX6|Y723_THEEB RecName: Full=UPF0133 protein tlr0723
 gi|22294444|dbj|BAC08274.1| tlr0723 [Thermosynechococcus elongatus BP-1]
          Length = 115

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 54/100 (54%), Gaps = 1/100 (1%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M  +   + + +++Q   +K++E +  ++ EG A GG V V ++G      V+I   LL 
Sbjct: 14  MKELAAAIQKAQQVQEGAKKLQEDLERMDIEGQAAGGAVKVIMSGTQEPRRVEISPDLLS 73

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           E   E+L DL+ AA  DA++K    +  + +E+T  L +P
Sbjct: 74  E-GAEVLSDLVTAAMRDAYQKSTATMRERMEELTGSLNVP 112


>gi|326802966|ref|YP_004320784.1| DNA-binding protein, YbaB/EbfC family [Aerococcus urinae
           ACS-120-V-Col10a]
 gi|326650303|gb|AEA00486.1| DNA-binding protein, YbaB/EbfC family [Aerococcus urinae
           ACS-120-V-Col10a]
          Length = 104

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/98 (24%), Positives = 56/98 (57%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+ KM+ + K++Q K+E+ ++ +     EG    GM++ ++ G   +  + +D +++ 
Sbjct: 5   MMNMQKMLKEAKKMQAKLEESQKDLEKQVFEGKEPSGMITAKVGGDRRVKAITMDPAVID 64

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLP 98
            ++ ++L DL+IAA +D   K++    +    +++G P
Sbjct: 65  PEDPDMLSDLLIAAVNDGLSKVDSAQESNMGSLSKGFP 102


>gi|291543056|emb|CBL16166.1| conserved hypothetical protein TIGR00103 [Ruminococcus bromii
           L2-63]
          Length = 116

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 57/99 (57%)

Query: 2   SNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFE 61
           +NI ++  Q +++Q  ME   + + + E E  AGGG V V + GK  LT V+I   ++  
Sbjct: 15  NNIQQLARQAQKLQDDMEAASKELETKEYEATAGGGAVKVTVTGKMELTKVEISPEVVDP 74

Query: 62  DNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           ++VE+L DL++AA ++A +        K + I+ GL IP
Sbjct: 75  EDVEMLSDLVMAAANEAIRAAAKEKEDKMETISGGLNIP 113


>gi|197124084|ref|YP_002136035.1| hypothetical protein AnaeK_3694 [Anaeromyxobacter sp. K]
 gi|238689853|sp|B4UDA8|Y3694_ANASK RecName: Full=UPF0133 protein AnaeK_3694
 gi|196173933|gb|ACG74906.1| conserved hypothetical protein [Anaeromyxobacter sp. K]
          Length = 103

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 52/98 (53%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           +I  ++ Q K+++  M   KE +  +  E  +GGG+V V +NGK  +T + +D   +  +
Sbjct: 2   DIQYLMRQAKKLEKAMADAKEKLAEIAVEAESGGGLVKVAMNGKCEITRLTVDPKAIDPN 61

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           +  +LEDL+ AA + A +K          + T G+ IP
Sbjct: 62  DKALLEDLVTAAVNAAVEKARTAADESMSKATGGIKIP 99


>gi|86160054|ref|YP_466839.1| hypothetical protein Adeh_3636 [Anaeromyxobacter dehalogenans
           2CP-C]
 gi|123496733|sp|Q2IFP3|Y3636_ANADE RecName: Full=UPF0133 protein Adeh_3636
 gi|85776565|gb|ABC83402.1| conserved hypothetical protein [Anaeromyxobacter dehalogenans
           2CP-C]
          Length = 103

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 52/98 (53%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           +I  ++ Q K+++  M   KE +  +  E  +GGG+V V +NGK  +T + +D   +  +
Sbjct: 2   DIQYLMRQAKKLEKAMADAKEKLAEIAVEAESGGGLVKVAMNGKCEVTRLTVDPKAIDPN 61

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           +  +LEDLI AA + A +K          + T G+ IP
Sbjct: 62  DKAMLEDLITAAVNAAVEKARTAADESMSKATGGIKIP 99


>gi|215424959|ref|ZP_03422878.1| hypothetical protein MtubT9_00629 [Mycobacterium tuberculosis
          T92]
 gi|215432695|ref|ZP_03430614.1| hypothetical protein MtubE_19003 [Mycobacterium tuberculosis
          EAS054]
 gi|219559799|ref|ZP_03538875.1| hypothetical protein MtubT1_21747 [Mycobacterium tuberculosis
          T17]
 gi|260198761|ref|ZP_05766252.1| hypothetical protein MtubT4_01119 [Mycobacterium tuberculosis
          T46]
 gi|289441152|ref|ZP_06430896.1| conserved hypothetical protein [Mycobacterium tuberculosis T46]
 gi|289571960|ref|ZP_06452187.1| conserved hypothetical protein [Mycobacterium tuberculosis T17]
 gi|289748234|ref|ZP_06507612.1| conserved hypothetical protein [Mycobacterium tuberculosis T92]
 gi|289755847|ref|ZP_06515225.1| predicted protein [Mycobacterium tuberculosis EAS054]
 gi|289414071|gb|EFD11311.1| conserved hypothetical protein [Mycobacterium tuberculosis T46]
 gi|289545714|gb|EFD49362.1| conserved hypothetical protein [Mycobacterium tuberculosis T17]
 gi|289688821|gb|EFD56250.1| conserved hypothetical protein [Mycobacterium tuberculosis T92]
 gi|289696434|gb|EFD63863.1| predicted protein [Mycobacterium tuberculosis EAS054]
          Length = 130

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 38/61 (62%)

Query: 22 KESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKK 81
          ++ + + E  G AGGG+V V + G   + GV ID  ++  D++E L+DLI+ A  DA ++
Sbjct: 25 QQQLANSEVHGQAGGGLVKVVVKGSGEVIGVTIDPKVVDPDDIETLQDLIVGAMRDASQQ 84

Query: 82 I 82
          +
Sbjct: 85 V 85


>gi|284051261|ref|ZP_06381471.1| hypothetical protein AplaP_07287 [Arthrospira platensis str.
           Paraca]
 gi|291566622|dbj|BAI88894.1| hypothetical protein [Arthrospira platensis NIES-39]
          Length = 117

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 55/100 (55%), Gaps = 1/100 (1%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M  + +   + + +Q   ++++E +  LE  G AGGG+V V ++G      V++   LL 
Sbjct: 17  MKELAQAFQKAQAVQEGAKRLQEDLDELEVLGEAGGGLVKVYLSGNQQPRRVEVSPDLLG 76

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           ED  +++ DLI+ A  +A+     ++  + +E+T GL +P
Sbjct: 77  EDP-DVVSDLILTAMKEAYNNSTSIMRERMEELTGGLNLP 115


>gi|240171026|ref|ZP_04749685.1| hypothetical protein MkanA1_17074 [Mycobacterium kansasii ATCC
          12478]
          Length = 126

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 38/61 (62%)

Query: 22 KESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKK 81
          +  + + E  G AGGG+V VR+ G   + GV ID  ++  +++E L+DLI+ A  DA ++
Sbjct: 19 QHQLANSEVHGQAGGGLVQVRVKGSGEVIGVTIDPKVVDPNDIETLQDLIVGAMRDASQQ 78

Query: 82 I 82
          +
Sbjct: 79 V 79


>gi|220918863|ref|YP_002494167.1| hypothetical protein A2cp1_3777 [Anaeromyxobacter dehalogenans
           2CP-1]
 gi|254803807|sp|B8J6X9|Y3777_ANAD2 RecName: Full=UPF0133 protein A2cp1_3777
 gi|219956717|gb|ACL67101.1| conserved hypothetical protein [Anaeromyxobacter dehalogenans
           2CP-1]
          Length = 103

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 52/98 (53%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           +I  ++ Q K+++  M   KE +  +  E  +GGG+V V +NGK  +T + +D   +  +
Sbjct: 2   DIQYLMRQAKKLEKAMADAKEKLAEIAVEAESGGGLVKVAMNGKCEITRLTVDPKAVDPN 61

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           +  +LEDL+ AA + A +K          + T G+ IP
Sbjct: 62  DKALLEDLVTAAVNAAVEKARTAADESMSKATGGIKIP 99


>gi|320536107|ref|ZP_08036160.1| conserved hypothetical protein TIGR00103 [Treponema phagedenis
          F0421]
 gi|320147024|gb|EFW38587.1| conserved hypothetical protein TIGR00103 [Treponema phagedenis
          F0421]
          Length = 105

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 53/87 (60%)

Query: 3  NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
          N  +++   K IQ ++E ++  +  +  EG +GGG+V V+++G   L  + +D   +   
Sbjct: 4  NPFEIMKNAKNIQEQLENLQSELKQITVEGASGGGLVKVKLDGNFTLLEILLDPIAVDNR 63

Query: 63 NVEILEDLIIAAHSDAHKKIEDLVATK 89
          +V +L+DLI +AH+DA +K+++ +  K
Sbjct: 64 DVPMLQDLIRSAHADAIEKLKEAMKEK 90


>gi|307611625|emb|CBX01310.1| hypothetical protein LPW_30071 [Legionella pneumophila 130b]
          Length = 94

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 41/54 (75%), Gaps = 1/54 (1%)

Query: 25 ITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDA 78
          ++ L   G +GGGMV++++NG++ +T VKI  +L+ ED +E+LEDLI AA +DA
Sbjct: 28 LSQLVVSGESGGGMVTIKMNGRHDVTEVKIKPTLMDED-IEMLEDLIAAAVNDA 80


>gi|238061526|ref|ZP_04606235.1| hypothetical protein MCAG_02492 [Micromonospora sp. ATCC 39149]
 gi|237883337|gb|EEP72165.1| hypothetical protein MCAG_02492 [Micromonospora sp. ATCC 39149]
          Length = 110

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 43/70 (61%)

Query: 3  NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
          N+ +M+ Q +++Q ++ K +  +   E  G AGGG+V+  ++G   +  +KID   +  +
Sbjct: 8  NMQQMLKQAQKMQQQIAKAQAELAEAEVTGTAGGGLVTATVSGSGDVKSIKIDPKAVDPE 67

Query: 63 NVEILEDLII 72
          +VE LEDL++
Sbjct: 68 DVETLEDLVV 77


>gi|110598755|ref|ZP_01387016.1| conserved hypothetical protein [Chlorobium ferrooxidans DSM 13031]
 gi|110339619|gb|EAT58133.1| conserved hypothetical protein [Chlorobium ferrooxidans DSM 13031]
          Length = 111

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 55/103 (53%), Gaps = 2/103 (1%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N   M+ Q ++   KM+ +++ +  + A G AGGGMV V ++GK  L  + ID  ++ 
Sbjct: 3   MPNFGDMMKQIQQAGEKMQDVQKQLEKIVAHGEAGGGMVRVSVSGKQKLLSLTIDPDIM- 61

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGL 103
            D+ E+++DL++AA +    +   L   +    T G+  P  L
Sbjct: 62  -DDAEMVQDLVLAAVNSGLDESARLAQEEISRATGGMINPADL 103


>gi|332704008|ref|ZP_08424096.1| UPF0133 protein ybaB [Desulfovibrio africanus str. Walvis Bay]
 gi|332554157|gb|EGJ51201.1| UPF0133 protein ybaB [Desulfovibrio africanus str. Walvis Bay]
          Length = 103

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 62/100 (62%), Gaps = 3/100 (3%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M+++M+   Q + +Q K+ + ++++     E  +GGGMV+  + G   L  +KID++ + 
Sbjct: 4   MNDLMR---QAQVMQKKILESQKALDQKRVEATSGGGMVTAVVTGGLELVSIKIDKAAVD 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
            ++V++L+DLI+AA ++  KK + +   +  ++T G+ IP
Sbjct: 61  PNDVDMLQDLILAAINEGVKKAKAMKEEEMAKLTGGMNIP 100


>gi|15610852|ref|NP_218233.1| hypothetical protein Rv3716c [Mycobacterium tuberculosis H37Rv]
 gi|15843337|ref|NP_338374.1| hypothetical protein MT3819 [Mycobacterium tuberculosis CDC1551]
 gi|31794888|ref|NP_857381.1| hypothetical protein Mb3743c [Mycobacterium bovis AF2122/97]
 gi|121639632|ref|YP_979856.1| hypothetical protein BCG_3776c [Mycobacterium bovis BCG str.
          Pasteur 1173P2]
 gi|148663581|ref|YP_001285104.1| hypothetical protein MRA_3753 [Mycobacterium tuberculosis H37Ra]
 gi|167970871|ref|ZP_02553148.1| hypothetical protein MtubH3_23630 [Mycobacterium tuberculosis
          H37Ra]
 gi|215405768|ref|ZP_03417949.1| hypothetical protein Mtub0_19168 [Mycobacterium tuberculosis
          02_1987]
 gi|215413643|ref|ZP_03422311.1| hypothetical protein Mtub9_19790 [Mycobacterium tuberculosis
          94_M4241A]
 gi|215448055|ref|ZP_03434807.1| hypothetical protein MtubT_19684 [Mycobacterium tuberculosis T85]
 gi|218755500|ref|ZP_03534296.1| hypothetical protein MtubG1_19644 [Mycobacterium tuberculosis GM
          1503]
 gi|224992128|ref|YP_002646817.1| hypothetical protein JTY_3778 [Mycobacterium bovis BCG str. Tokyo
          172]
 gi|253800762|ref|YP_003033763.1| hypothetical protein TBMG_03760 [Mycobacterium tuberculosis KZN
          1435]
 gi|254233211|ref|ZP_04926537.1| conserved hypothetical protein [Mycobacterium tuberculosis C]
 gi|254366261|ref|ZP_04982305.1| conserved hypothetical protein [Mycobacterium tuberculosis str.
          Haarlem]
 gi|254552826|ref|ZP_05143273.1| hypothetical protein Mtube_20674 [Mycobacterium tuberculosis
          '98-R604 INH-RIF-EM']
 gi|260184637|ref|ZP_05762111.1| hypothetical protein MtubCP_01067 [Mycobacterium tuberculosis
          CPHL_A]
 gi|260202917|ref|ZP_05770408.1| hypothetical protein MtubK8_01172 [Mycobacterium tuberculosis
          K85]
 gi|289445315|ref|ZP_06435059.1| conserved hypothetical protein [Mycobacterium tuberculosis
          CPHL_A]
 gi|289555981|ref|ZP_06445191.1| conserved hypothetical protein [Mycobacterium tuberculosis KZN
          605]
 gi|289572367|ref|ZP_06452594.1| conserved hypothetical protein [Mycobacterium tuberculosis K85]
 gi|289747555|ref|ZP_06506933.1| conserved hypothetical protein [Mycobacterium tuberculosis
          02_1987]
 gi|289759876|ref|ZP_06519254.1| predicted protein [Mycobacterium tuberculosis T85]
 gi|289763897|ref|ZP_06523275.1| conserved hypothetical protein [Mycobacterium tuberculosis GM
          1503]
 gi|294995374|ref|ZP_06801065.1| hypothetical protein Mtub2_12896 [Mycobacterium tuberculosis 210]
 gi|297636394|ref|ZP_06954174.1| hypothetical protein MtubK4_19810 [Mycobacterium tuberculosis KZN
          4207]
 gi|297733388|ref|ZP_06962506.1| hypothetical protein MtubKR_19950 [Mycobacterium tuberculosis KZN
          R506]
 gi|298527193|ref|ZP_07014602.1| predicted protein [Mycobacterium tuberculosis 94_M4241A]
 gi|306778073|ref|ZP_07416410.1| hypothetical protein TMAG_00207 [Mycobacterium tuberculosis
          SUMu001]
 gi|306778605|ref|ZP_07416942.1| hypothetical protein TMBG_02255 [Mycobacterium tuberculosis
          SUMu002]
 gi|306805560|ref|ZP_07442228.1| hypothetical protein TMGG_01259 [Mycobacterium tuberculosis
          SUMu007]
 gi|306969957|ref|ZP_07482618.1| hypothetical protein TMIG_00067 [Mycobacterium tuberculosis
          SUMu009]
 gi|307081898|ref|ZP_07491068.1| hypothetical protein TMKG_00958 [Mycobacterium tuberculosis
          SUMu011]
 gi|307086511|ref|ZP_07495624.1| hypothetical protein TMLG_00206 [Mycobacterium tuberculosis
          SUMu012]
 gi|313660719|ref|ZP_07817599.1| hypothetical protein MtubKV_19945 [Mycobacterium tuberculosis KZN
          V2475]
 gi|61250944|sp|P0A654|Y3716_MYCTU RecName: Full=UPF0133 protein Rv3716c/MT3819
 gi|61250945|sp|P0A655|Y3743_MYCBO RecName: Full=UPF0133 protein Mb3743c
 gi|166232636|sp|A5U942|Y3753_MYCTA RecName: Full=UPF0133 protein MRA_3753
 gi|166232642|sp|A1KQ48|Y3776_MYCBP RecName: Full=UPF0133 protein BCG_3776c
 gi|254803808|sp|C1AIH0|Y3778_MYCBT RecName: Full=UPF0133 protein JTY_3778
 gi|2960140|emb|CAA18038.1| CONSERVED HYPOTHETICAL PROTEIN [Mycobacterium tuberculosis H37Rv]
 gi|13883699|gb|AAK48188.1| conserved hypothetical protein [Mycobacterium tuberculosis
          CDC1551]
 gi|31620486|emb|CAD95929.1| CONSERVED HYPOTHETICAL PROTEIN [Mycobacterium bovis AF2122/97]
 gi|121495280|emb|CAL73766.1| Conserved hypothetical protein [Mycobacterium bovis BCG str.
          Pasteur 1173P2]
 gi|124603004|gb|EAY61279.1| conserved hypothetical protein [Mycobacterium tuberculosis C]
 gi|134151773|gb|EBA43818.1| conserved hypothetical protein [Mycobacterium tuberculosis str.
          Haarlem]
 gi|148507733|gb|ABQ75542.1| hypothetical protein MRA_3753 [Mycobacterium tuberculosis H37Ra]
 gi|224775243|dbj|BAH28049.1| hypothetical protein JTY_3778 [Mycobacterium bovis BCG str. Tokyo
          172]
 gi|253322265|gb|ACT26868.1| conserved hypothetical protein [Mycobacterium tuberculosis KZN
          1435]
 gi|289418273|gb|EFD15474.1| conserved hypothetical protein [Mycobacterium tuberculosis
          CPHL_A]
 gi|289440613|gb|EFD23106.1| conserved hypothetical protein [Mycobacterium tuberculosis KZN
          605]
 gi|289536798|gb|EFD41376.1| conserved hypothetical protein [Mycobacterium tuberculosis K85]
 gi|289688083|gb|EFD55571.1| conserved hypothetical protein [Mycobacterium tuberculosis
          02_1987]
 gi|289711403|gb|EFD75419.1| conserved hypothetical protein [Mycobacterium tuberculosis GM
          1503]
 gi|289715440|gb|EFD79452.1| predicted protein [Mycobacterium tuberculosis T85]
 gi|298496987|gb|EFI32281.1| predicted protein [Mycobacterium tuberculosis 94_M4241A]
 gi|308213602|gb|EFO73001.1| hypothetical protein TMAG_00207 [Mycobacterium tuberculosis
          SUMu001]
 gi|308328335|gb|EFP17186.1| hypothetical protein TMBG_02255 [Mycobacterium tuberculosis
          SUMu002]
 gi|308347860|gb|EFP36711.1| hypothetical protein TMGG_01259 [Mycobacterium tuberculosis
          SUMu007]
 gi|308352513|gb|EFP41364.1| hypothetical protein TMIG_00067 [Mycobacterium tuberculosis
          SUMu009]
 gi|308360410|gb|EFP49261.1| hypothetical protein TMKG_00958 [Mycobacterium tuberculosis
          SUMu011]
 gi|308364106|gb|EFP52957.1| hypothetical protein TMLG_00206 [Mycobacterium tuberculosis
          SUMu012]
 gi|326905555|gb|EGE52488.1| hypothetical protein TBPG_03510 [Mycobacterium tuberculosis
          W-148]
 gi|328460490|gb|AEB05913.1| conserved hypothetical protein [Mycobacterium tuberculosis KZN
          4207]
          Length = 133

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 38/61 (62%)

Query: 22 KESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKK 81
          ++ + + E  G AGGG+V V + G   + GV ID  ++  D++E L+DLI+ A  DA ++
Sbjct: 25 QQQLANSEVHGQAGGGLVKVVVKGSGEVIGVTIDPKVVDPDDIETLQDLIVGAMRDASQQ 84

Query: 82 I 82
          +
Sbjct: 85 V 85


>gi|220906335|ref|YP_002481646.1| hypothetical protein Cyan7425_0899 [Cyanothece sp. PCC 7425]
 gi|254807264|sp|B8HWY2|Y899_CYAP4 RecName: Full=UPF0133 protein Cyan7425_0899
 gi|219862946|gb|ACL43285.1| conserved hypothetical protein [Cyanothece sp. PCC 7425]
          Length = 114

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 55/100 (55%), Gaps = 1/100 (1%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M  +   + + +++Q   +K++E +  +E EG A GG+V V ++G      V+I   L+ 
Sbjct: 14  MKELAAAIQKAQQVQEGAKKLQEDLEKMEIEGVAAGGLVKVIMSGNQEPRRVEISPDLMS 73

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           E   E++ DL+ AA  DA+ K    +  + +E+T GL +P
Sbjct: 74  E-GAEVVADLVTAAMKDAYLKSTTTMRERMEELTGGLSLP 112


>gi|225075133|ref|ZP_03718332.1| hypothetical protein NEIFLAOT_00133 [Neisseria flavescens
           NRL30031/H210]
 gi|241760305|ref|ZP_04758400.1| conserved hypothetical protein [Neisseria flavescens SK114]
 gi|261379690|ref|ZP_05984263.1| putative cytoplasmic protein [Neisseria subflava NJ9703]
 gi|319637642|ref|ZP_07992408.1| hypothetical protein HMPREF0604_00031 [Neisseria mucosa C102]
 gi|224953617|gb|EEG34826.1| hypothetical protein NEIFLAOT_00133 [Neisseria flavescens
           NRL30031/H210]
 gi|241319183|gb|EER55661.1| conserved hypothetical protein [Neisseria flavescens SK114]
 gi|284797354|gb|EFC52701.1| putative cytoplasmic protein [Neisseria subflava NJ9703]
 gi|317400797|gb|EFV81452.1| hypothetical protein HMPREF0604_00031 [Neisseria mucosa C102]
          Length = 111

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 53/95 (55%), Gaps = 2/95 (2%)

Query: 10  QFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFE--DNVEIL 67
           Q +++Q  M+K +  +   E EG AG G+V V +   +++  ++I   L+ E  D+ E+L
Sbjct: 13  QAQQMQENMKKAQAKLAETEVEGEAGNGLVKVVMTCSHVVRKLEISPDLIQEAADDKEML 72

Query: 68  EDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPG 102
           EDL++AA + A +K E+         T+GLP   G
Sbjct: 73  EDLVLAAINAASEKAEETTNKTMGAFTQGLPAGMG 107


>gi|121534250|ref|ZP_01666075.1| conserved hypothetical protein 103 [Thermosinus carboxydivorans
           Nor1]
 gi|121307353|gb|EAX48270.1| conserved hypothetical protein 103 [Thermosinus carboxydivorans
           Nor1]
          Length = 111

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 61/105 (58%), Gaps = 6/105 (5%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           + +IM+MV   K+IQ  +E ++E++ +   E  + G ++ V ING+  +  ++++   L 
Sbjct: 10  LGSIMEMV---KKIQQNIENVQENLKNERIEV-SSGDVIKVVINGQQDIISIELNAKYLA 65

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP--PGL 103
            DN  +L+DL++A  ++A  K  DL  T   ++T  L +P  PGL
Sbjct: 66  PDNAALLQDLLVATINNALTKSRDLNQTAMNKLTSELNLPKIPGL 110


>gi|46446111|ref|YP_007476.1| hypothetical protein pc0477 [Candidatus Protochlamydia
          amoebophila UWE25]
 gi|81627518|sp|Q6MDZ8|Y477_PARUW RecName: Full=UPF0133 protein pc0477
 gi|46399752|emb|CAF23201.1| hypothetical protein pc0477 [Candidatus Protochlamydia
          amoebophila UWE25]
          Length = 98

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 45/71 (63%)

Query: 14 IQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIA 73
          IQ +M  ++  + +LE  G AG G+V++ + G   +  VKI    +  +++E LE LI A
Sbjct: 15 IQQQMSLVQNELQNLEVVGVAGSGLVTITLTGDGEMKQVKIKPECVDVEDLEGLEMLIRA 74

Query: 74 AHSDAHKKIED 84
          AH+DAHK++++
Sbjct: 75 AHADAHKRLKE 85


>gi|313668559|ref|YP_004048843.1| hypothetical protein NLA_12590 [Neisseria lactamica ST-640]
 gi|313006021|emb|CBN87480.1| conserved hypothetical protein [Neisseria lactamica 020-06]
          Length = 111

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 53/99 (53%), Gaps = 4/99 (4%)

Query: 7   MVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFE--DNV 64
           ++ Q +++Q  M+K +  +   E EG AG G+V + +   + +  + I   L+ E  D+ 
Sbjct: 10  LMKQAQQMQENMKKAQAKLAETEIEGEAGNGLVKITMTCAHEVRKINISPDLIQEAADDK 69

Query: 65  EILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGL 103
           E+LEDLI+AA   A  K E+         T+GL  PPG+
Sbjct: 70  EMLEDLILAALKSARDKAEETANKTMGAFTQGL--PPGV 106


>gi|28209848|ref|NP_780792.1| hypothetical protein CTC00074 [Clostridium tetani E88]
 gi|47117552|sp|Q899U2|Y074_CLOTE RecName: Full=UPF0133 protein CTC_00074
 gi|28202283|gb|AAO34729.1| transcriptional regulatory protein [Clostridium tetani E88]
          Length = 113

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 45/70 (64%)

Query: 31  EGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKKIEDLVATKT 90
           + + GGG V+   NGK  +  ++I   ++  D+VE+LEDLI++A ++A KK E   A + 
Sbjct: 41  QASVGGGAVTAIANGKKEIVDIRIKPEVVDPDDVEMLEDLILSACNEALKKAEHETANEM 100

Query: 91  QEITEGLPIP 100
           +++T G+ +P
Sbjct: 101 KKLTGGMNLP 110


>gi|226303879|ref|YP_002763837.1| hypothetical protein RER_03900 [Rhodococcus erythropolis PR4]
 gi|229492594|ref|ZP_04386397.1| conserved hypothetical protein [Rhodococcus erythropolis SK121]
 gi|259647026|sp|C0ZN46|Y390_RHOE4 RecName: Full=UPF0133 protein RER_03900
 gi|226182994|dbj|BAH31098.1| conserved hypothetical protein [Rhodococcus erythropolis PR4]
 gi|229320580|gb|EEN86398.1| conserved hypothetical protein [Rhodococcus erythropolis SK121]
          Length = 112

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 38/61 (62%)

Query: 29 EAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKKIEDLVAT 88
          E  G AGGG+V   + G   + G++ID  ++  ++VE L+DL+I A  DA +K +++ A 
Sbjct: 34 EVTGQAGGGLVVATVKGTGEVVGLQIDPKVVDPEDVETLQDLVIGAIEDASRKAQEVAAE 93

Query: 89 K 89
          K
Sbjct: 94 K 94


>gi|255066246|ref|ZP_05318101.1| putative cytoplasmic protein [Neisseria sicca ATCC 29256]
 gi|261365755|ref|ZP_05978638.1| putative cytoplasmic protein [Neisseria mucosa ATCC 25996]
 gi|255049456|gb|EET44920.1| putative cytoplasmic protein [Neisseria sicca ATCC 29256]
 gi|288565715|gb|EFC87275.1| putative cytoplasmic protein [Neisseria mucosa ATCC 25996]
          Length = 111

 Score = 48.9 bits (115), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 53/95 (55%), Gaps = 2/95 (2%)

Query: 10  QFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFE--DNVEIL 67
           Q +++Q  M+K +  +   E EG AG G+V V +   +++  ++I   L+ E  D+ E+L
Sbjct: 13  QAQQMQENMKKAQAKLAETEVEGEAGNGLVKVVMTCAHVVRKLEISPDLIQEAADDKEML 72

Query: 68  EDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPG 102
           EDL++AA + A +K E+         T+GLP   G
Sbjct: 73  EDLVLAAINAASEKAEETTNKTMGAFTQGLPAGMG 107


>gi|256374359|ref|YP_003098019.1| hypothetical protein Amir_0202 [Actinosynnema mirum DSM 43827]
 gi|255918662|gb|ACU34173.1| conserved hypothetical protein [Actinosynnema mirum DSM 43827]
          Length = 115

 Score = 48.9 bits (115), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 39/68 (57%)

Query: 22 KESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKK 81
          ++ +T  E  G AGGG+V   + G   L  + ID   +  ++VE L DL++AA  DA++ 
Sbjct: 26 QQELTEAEVTGTAGGGLVRAVVTGGGELKSLAIDPRAVDPEDVETLSDLVVAAVRDANRA 85

Query: 82 IEDLVATK 89
           ++L A K
Sbjct: 86 AQELAAQK 93


>gi|148824921|ref|YP_001289675.1| hypothetical protein TBFG_13748 [Mycobacterium tuberculosis F11]
 gi|306786628|ref|ZP_07424950.1| hypothetical protein TMCG_01220 [Mycobacterium tuberculosis
          SUMu003]
 gi|306974190|ref|ZP_07486851.1| hypothetical protein TMJG_00968 [Mycobacterium tuberculosis
          SUMu010]
 gi|308372632|ref|ZP_07429316.2| hypothetical protein TMDG_01452 [Mycobacterium tuberculosis
          SUMu004]
 gi|308372719|ref|ZP_07429615.2| hypothetical protein TMEG_00211 [Mycobacterium tuberculosis
          SUMu005]
 gi|308373797|ref|ZP_07433680.2| hypothetical protein TMFG_01949 [Mycobacterium tuberculosis
          SUMu006]
 gi|308376203|ref|ZP_07438017.2| hypothetical protein TMHG_02780 [Mycobacterium tuberculosis
          SUMu008]
 gi|148723448|gb|ABR08073.1| conserved hypothetical protein [Mycobacterium tuberculosis F11]
 gi|308328739|gb|EFP17590.1| hypothetical protein TMCG_01220 [Mycobacterium tuberculosis
          SUMu003]
 gi|308332581|gb|EFP21432.1| hypothetical protein TMDG_01452 [Mycobacterium tuberculosis
          SUMu004]
 gi|308340072|gb|EFP28923.1| hypothetical protein TMEG_00211 [Mycobacterium tuberculosis
          SUMu005]
 gi|308344062|gb|EFP32913.1| hypothetical protein TMFG_01949 [Mycobacterium tuberculosis
          SUMu006]
 gi|308351848|gb|EFP40699.1| hypothetical protein TMHG_02780 [Mycobacterium tuberculosis
          SUMu008]
 gi|308356463|gb|EFP45314.1| hypothetical protein TMJG_00968 [Mycobacterium tuberculosis
          SUMu010]
 gi|323717580|gb|EGB26782.1| hypothetical protein TMMG_00207 [Mycobacterium tuberculosis
          CDC1551A]
          Length = 127

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 38/61 (62%)

Query: 22 KESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKK 81
          ++ + + E  G AGGG+V V + G   + GV ID  ++  D++E L+DLI+ A  DA ++
Sbjct: 19 QQQLANSEVHGQAGGGLVKVVVKGSGEVIGVTIDPKVVDPDDIETLQDLIVGAMRDASQQ 78

Query: 82 I 82
          +
Sbjct: 79 V 79


>gi|78187145|ref|YP_375188.1| hypothetical protein Plut_1285 [Chlorobium luteolum DSM 273]
 gi|123582927|sp|Q3B3D6|Y1285_PELLD RecName: Full=UPF0133 protein Plut_1285
 gi|78167047|gb|ABB24145.1| conserved hypothetical protein [Chlorobium luteolum DSM 273]
          Length = 109

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 47/78 (60%), Gaps = 2/78 (2%)

Query: 1  MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
          M N   M+ Q ++   KM+ +++ +  L   G AGGGMV V +NGK  +  + ID  ++ 
Sbjct: 3  MPNFGDMMKQIQQAGEKMQDVQKQLEKLVTSGEAGGGMVKVTVNGKQRVLSLWIDPEIM- 61

Query: 61 EDNVEILEDLIIAAHSDA 78
           D+ E+++DL++AA + A
Sbjct: 62 -DDAEMVQDLVLAAVNSA 78


>gi|218768447|ref|YP_002342959.1| hypothetical protein NMA1657 [Neisseria meningitidis Z2491]
 gi|304387171|ref|ZP_07369414.1| conserved hypothetical protein [Neisseria meningitidis ATCC 13091]
 gi|12644639|sp|Q9JTS0|Y1657_NEIMA RecName: Full=UPF0133 protein NMA1657
 gi|121052455|emb|CAM08791.1| conserved hypothetical protein [Neisseria meningitidis Z2491]
 gi|254670264|emb|CBA05527.1| conserved hypothetical protein [Neisseria meningitidis alpha153]
 gi|304338738|gb|EFM04849.1| conserved hypothetical protein [Neisseria meningitidis ATCC 13091]
 gi|325142630|gb|EGC65021.1| hypothetical protein TIGR00103 [Neisseria meningitidis 961-5945]
 gi|325204431|gb|ADY99884.1| conserved hypothetical protein TIGR00103 [Neisseria meningitidis
           M01-240355]
          Length = 111

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 53/99 (53%), Gaps = 4/99 (4%)

Query: 7   MVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFE--DNV 64
           ++ Q +++Q  M+K +  +   E EG AG G+V + +   + +  + I   L+ E  D+ 
Sbjct: 10  LMKQAQQMQENMKKAQAKLAETEIEGEAGNGLVKITMTCAHEVRKIDISPDLIQEAADDK 69

Query: 65  EILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGL 103
           E+LEDLI+AA   A  K E+         T+GL  PPG+
Sbjct: 70  EMLEDLILAALKSARDKAEETANKTMGAFTQGL--PPGV 106


>gi|297538151|ref|YP_003673920.1| hypothetical protein M301_0959 [Methylotenera sp. 301]
 gi|297257498|gb|ADI29343.1| conserved hypothetical protein [Methylotenera sp. 301]
          Length = 102

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 49/88 (55%), Gaps = 7/88 (7%)

Query: 20  KMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAH 79
           K +E + +++ EG A  G+V V +  KN +  V +D S++  D+ E LEDL++ A  DA 
Sbjct: 22  KAQEELANIDVEGIAANGLVKVLMTCKNEVKRVTLDDSVM--DDKETLEDLLVIALKDAT 79

Query: 80  KKIEDLVATKTQEITEGLPIPPGLKFPF 107
            K E   AT +  +   +  P G+K PF
Sbjct: 80  AKAE---ATSSARMANYM--PAGMKLPF 102


>gi|291303585|ref|YP_003514863.1| hypothetical protein Snas_6147 [Stackebrandtia nassauensis DSM
           44728]
 gi|290572805|gb|ADD45770.1| conserved hypothetical protein [Stackebrandtia nassauensis DSM
           44728]
          Length = 116

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 52/95 (54%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           N+ +++ Q +++Q      ++ +   E   ++GGG+V+V + G     G+KID   +  +
Sbjct: 10  NMQELLKQAQQMQQDYVAAQQELVESEVSASSGGGLVTVTVTGAGEFRGIKIDPKAVDPE 69

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGL 97
           +VE LEDL+ AA   A ++ + L   K   +T+ L
Sbjct: 70  DVETLEDLVGAAVLAAGEEAKKLAEAKLGPVTQAL 104


>gi|298490186|ref|YP_003720363.1| hypothetical protein Aazo_0817 ['Nostoc azollae' 0708]
 gi|298232104|gb|ADI63240.1| conserved hypothetical protein ['Nostoc azollae' 0708]
          Length = 116

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 51/89 (57%), Gaps = 1/89 (1%)

Query: 12  KEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLI 71
           +++Q   ++++E +  +E +G +GGG+V V ++G      V+I    L E   ++L DLI
Sbjct: 27  QQVQEGAKRLQEELEQMEIQGESGGGLVKVIVSGNQEPRRVEISPDALGE-GADVLSDLI 85

Query: 72  IAAHSDAHKKIEDLVATKTQEITEGLPIP 100
            AA  DA+ K    +  + +++T GL +P
Sbjct: 86  TAAMKDAYNKSTATMRERMEDLTSGLELP 114


>gi|116493221|ref|YP_804956.1| hypothetical protein PEPE_1483 [Pediococcus pentosaceus ATCC 25745]
 gi|122265315|sp|Q03E58|Y1483_PEDPA RecName: Full=UPF0133 protein PEPE_1483
 gi|116103371|gb|ABJ68514.1| hypothetical protein PEPE_1483 [Pediococcus pentosaceus ATCC 25745]
          Length = 104

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 54/98 (55%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+  M+ Q +++Q K+ + +E +   E  G A   MV V   G + +  + I+   + 
Sbjct: 5   MGNMQSMMRQMQKMQKKVTEEQEKLNQTEFTGVAPDDMVKVVFTGDHRMKDIVINPEAID 64

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLP 98
           ED+ ++L+DLI+AA +DA  +++        + T+G+P
Sbjct: 65  EDDPDMLQDLIVAAVNDAMNRVDSETNKTMGKYTKGIP 102


>gi|257869779|ref|ZP_05649432.1| conserved hypothetical protein [Enterococcus gallinarum EG2]
 gi|257803943|gb|EEV32765.1| conserved hypothetical protein [Enterococcus gallinarum EG2]
          Length = 104

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 55/98 (56%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+  M+ Q +++Q +M K +E++ S E  G +  G V     G   L  + ID++++ 
Sbjct: 5   MGNMQGMMKQVQKMQKEMVKEQEALNSKEFIGESTNGYVKATFTGDKKLRDLSIDQAIVD 64

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLP 98
            ++V++L+D++I A +D   KIE        + T+G+P
Sbjct: 65  PEDVDMLQDMLILAVNDGLTKIEKETERTMGKYTKGIP 102


>gi|296166810|ref|ZP_06849228.1| conserved hypothetical protein [Mycobacterium parascrofulaceum
          ATCC BAA-614]
 gi|295897826|gb|EFG77414.1| conserved hypothetical protein [Mycobacterium parascrofulaceum
          ATCC BAA-614]
          Length = 113

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 38/61 (62%)

Query: 22 KESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDAHKK 81
          ++ + + E  G AGGG+V V + G   +  V+ID  ++   +VE L+DLI+ A +DA K+
Sbjct: 25 QQQLANAEIHGQAGGGLVKVTVKGSGEVVAVQIDPQVVDPADVETLQDLIVGAMADASKQ 84

Query: 82 I 82
          +
Sbjct: 85 V 85


>gi|295397254|ref|ZP_06807350.1| transcriptional regulatory protein [Aerococcus viridans ATCC 11563]
 gi|294974501|gb|EFG50232.1| transcriptional regulatory protein [Aerococcus viridans ATCC 11563]
          Length = 104

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 59/98 (60%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M+N+ +M+ + +++Q +ME  +++I + E +G    GMV+V + G   +  + I    + 
Sbjct: 5   MANMQQMMRKMQKMQQEMESEQKNIETKEFQGTEPSGMVNVTVTGDRRVKAINIKPDAVD 64

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLP 98
            ++V++L+DL+I A ++  +K++   A    + T+G+P
Sbjct: 65  PEDVDMLQDLLIEAVNNGLEKVDTETANVMGKYTKGIP 102


>gi|145219841|ref|YP_001130550.1| hypothetical protein Cvib_1034 [Prosthecochloris vibrioformis DSM
          265]
 gi|189038548|sp|A4SEY9|Y1034_PROVI RecName: Full=UPF0133 protein Cvib_1034
 gi|145206005|gb|ABP37048.1| conserved hypothetical protein 103 [Chlorobium phaeovibrioides
          DSM 265]
          Length = 109

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 47/78 (60%), Gaps = 2/78 (2%)

Query: 1  MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
          M N+  M+ Q ++   KM+ +++ +      G AGGGMV V +NG+  L  + ID  ++ 
Sbjct: 3  MPNLGDMMKQIQQAGAKMQDVQKQLEKTVTHGEAGGGMVKVSVNGRQRLLSLAIDPDIM- 61

Query: 61 EDNVEILEDLIIAAHSDA 78
           D+ E+++DL++AA + A
Sbjct: 62 -DDREMVQDLVLAAVNSA 78


>gi|284028400|ref|YP_003378331.1| hypothetical protein Kfla_0408 [Kribbella flavida DSM 17836]
 gi|283807693|gb|ADB29532.1| conserved hypothetical protein [Kribbella flavida DSM 17836]
          Length = 154

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 51/85 (60%)

Query: 3  NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
          ++ +++ Q + +Q ++ + + ++ + E EG AGGG+V+  ++G   L  + I+   +  D
Sbjct: 13 DMSELLAQAQAMQNQLMEAQANLENQEVEGTAGGGLVTAMVSGTGELLSLTINPKAVDPD 72

Query: 63 NVEILEDLIIAAHSDAHKKIEDLVA 87
          + E L DLI+AA  DA +  +++ A
Sbjct: 73 DTETLADLIVAAVRDASENAKEVAA 97


>gi|302559464|ref|ZP_07311806.1| conserved hypothetical protein [Streptomyces griseoflavus Tu4000]
 gi|302477082|gb|EFL40175.1| conserved hypothetical protein [Streptomyces griseoflavus Tu4000]
          Length = 114

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 48/87 (55%)

Query: 3  NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
          N+ +++ Q +++Q  + K +E +   E +G +GGG+V   + G   L  + ID   +  +
Sbjct: 9  NMQQLLQQAQKMQQDLAKAQEELARTEVDGQSGGGLVKATVTGSGELRALVIDPKAVDPE 68

Query: 63 NVEILEDLIIAAHSDAHKKIEDLVATK 89
          + E L DL++AA   A++  ++L   K
Sbjct: 69 DTETLADLVVAAVQAANENAQNLQQQK 95


>gi|29831099|ref|NP_825733.1| hypothetical protein SAV_4556 [Streptomyces avermitilis MA-4680]
 gi|47117509|sp|Q82EQ8|Y4556_STRAW RecName: Full=UPF0133 protein SAV_4556
 gi|29608213|dbj|BAC72268.1| hypothetical protein [Streptomyces avermitilis MA-4680]
          Length = 113

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 46/87 (52%)

Query: 3  NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
          N+ +++ Q +++Q  +   +E +   E EG AGGG+V   + G   L  + ID   +  +
Sbjct: 9  NMQQLLQQAQKMQQDLANAQEELARTEVEGQAGGGLVKATVTGSGELRALVIDPKAVDPE 68

Query: 63 NVEILEDLIIAAHSDAHKKIEDLVATK 89
          + E L DL++AA   A++  + L   K
Sbjct: 69 DTETLADLVVAAVQAANENAQALQQQK 95


>gi|15677301|ref|NP_274456.1| hypothetical protein NMB1444 [Neisseria meningitidis MC58]
 gi|121635132|ref|YP_975377.1| hypothetical protein NMC1380 [Neisseria meningitidis FAM18]
 gi|12644642|sp|Q9JYT1|Y1444_NEIMB RecName: Full=UPF0133 protein NMB1444
 gi|166200385|sp|A1KUP8|Y1380_NEIMF RecName: Full=UPF0133 protein NMC1380
 gi|7226685|gb|AAF41804.1| conserved hypothetical protein [Neisseria meningitidis MC58]
 gi|120866838|emb|CAM10596.1| conserved hypothetical protein [Neisseria meningitidis FAM18]
 gi|254672431|emb|CBA05795.1| conserved hypothetical protein [Neisseria meningitidis alpha275]
 gi|308389549|gb|ADO31869.1| hypothetical protein NMBB_1604 [Neisseria meningitidis alpha710]
 gi|309379704|emb|CBX21693.1| unnamed protein product [Neisseria lactamica Y92-1009]
 gi|316984571|gb|EFV63536.1| conserved hypothetical protein [Neisseria meningitidis H44/76]
 gi|319410692|emb|CBY91071.1| conserved hypothetical protein [Neisseria meningitidis WUE 2594]
 gi|325130514|gb|EGC53269.1| hypothetical protein TIGR00103 [Neisseria meningitidis OX99.30304]
 gi|325132375|gb|EGC55068.1| hypothetical protein TIGR00103 [Neisseria meningitidis M6190]
 gi|325134575|gb|EGC57219.1| hypothetical protein TIGR00103 [Neisseria meningitidis M13399]
 gi|325136512|gb|EGC59116.1| hypothetical protein TIGR00103 [Neisseria meningitidis M0579]
 gi|325138444|gb|EGC61010.1| hypothetical protein TIGR00103 [Neisseria meningitidis ES14902]
 gi|325140611|gb|EGC63131.1| hypothetical protein TIGR00103 [Neisseria meningitidis CU385]
 gi|325144736|gb|EGC67031.1| hypothetical protein TIGR00103 [Neisseria meningitidis M01-240013]
 gi|325198578|gb|ADY94034.1| conserved hypothetical protein TIGR00103 [Neisseria meningitidis
           G2136]
 gi|325199940|gb|ADY95395.1| conserved hypothetical protein TIGR00103 [Neisseria meningitidis
           H44/76]
 gi|325201858|gb|ADY97312.1| conserved hypothetical protein TIGR00103 [Neisseria meningitidis
           M01-240149]
 gi|325205802|gb|ADZ01255.1| conserved hypothetical protein TIGR00103 [Neisseria meningitidis
           M04-240196]
 gi|325208390|gb|ADZ03842.1| conserved hypothetical protein TIGR00103 [Neisseria meningitidis
           NZ-05/33]
          Length = 111

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 51/96 (53%), Gaps = 4/96 (4%)

Query: 10  QFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFE--DNVEIL 67
           Q +++Q  M+K +  +   E EG AG G+V + +   + +  + I   L+ E  D+ E+L
Sbjct: 13  QAQQMQENMKKAQAKLAETEIEGEAGNGLVKITMTCAHEVRKIDISPDLIQEAADDKEML 72

Query: 68  EDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGL 103
           EDLI+AA   A  K E+         T+GL  PPG+
Sbjct: 73  EDLILAALKSARGKAEETANKTMGAFTQGL--PPGV 106


>gi|237738353|ref|ZP_04568834.1| conserved hypothetical protein [Fusobacterium mortiferum ATCC 9817]
 gi|229420233|gb|EEO35280.1| conserved hypothetical protein [Fusobacterium mortiferum ATCC 9817]
          Length = 118

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 51/82 (62%), Gaps = 2/82 (2%)

Query: 21  MKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFE--DNVEILEDLIIAAHSDA 78
           ++E +   E   + GGG V+V++NG+  L  VK+   ++ E  D+ E+LEDLI++A  +A
Sbjct: 34  VQEGLKEKELTSSVGGGAVTVKVNGQKELLEVKLTDDIIKEAADDKEMLEDLIVSAVREA 93

Query: 79  HKKIEDLVATKTQEITEGLPIP 100
            ++ ++L   +  ++T G+ IP
Sbjct: 94  MRQADELAEAEMGKVTGGINIP 115


>gi|254805225|ref|YP_003083446.1| hypothetical protein NMO_1277 [Neisseria meningitidis alpha14]
 gi|254668767|emb|CBA06663.1| conserved hypothetical protein [Neisseria meningitidis alpha14]
          Length = 111

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 50/94 (53%), Gaps = 2/94 (2%)

Query: 7   MVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFE--DNV 64
           ++ Q +++Q  M+K +  +   E EG AG G+V + +   + +  + I   L+ E  D+ 
Sbjct: 10  LMKQAQQMQENMKKAQAKLAETEIEGEAGNGLVKITMTCAHEVRKIDISPDLIQEAADDK 69

Query: 65  EILEDLIIAAHSDAHKKIEDLVATKTQEITEGLP 98
           E+LEDLI+AA   A  K E+         T+GLP
Sbjct: 70  EMLEDLILAALKSARDKAEETANKTMGAFTQGLP 103


>gi|116510937|ref|YP_808153.1| hypothetical protein LACR_0106 [Lactococcus lactis subsp.
          cremoris SK11]
 gi|125623007|ref|YP_001031490.1| hypothetical protein llmg_0128 [Lactococcus lactis subsp.
          cremoris MG1363]
 gi|123025670|sp|Q032Z1|Y106_LACLS RecName: Full=UPF0133 protein LACR_0106
 gi|166200331|sp|A2RHJ9|Y128_LACLM RecName: Full=UPF0133 protein llmg_0128
 gi|116106591|gb|ABJ71731.1| hypothetical protein LACR_0106 [Lactococcus lactis subsp.
          cremoris SK11]
 gi|124491815|emb|CAL96735.1| conserved hypothetical protein [Lactococcus lactis subsp.
          cremoris MG1363]
 gi|300069751|gb|ADJ59151.1| hypothetical protein LLNZ_00655 [Lactococcus lactis subsp.
          cremoris NZ9000]
          Length = 99

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 54/99 (54%)

Query: 1  MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
          M N+  M+ Q +++Q +M+  +E I +    G +   +V+V  +G   L  + I+  ++ 
Sbjct: 1  MMNMQSMMKQAQKLQKQMQVSQEEIANTTFVGKSAQDLVTVEFSGDRTLKSLNINPDVID 60

Query: 61 EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPI 99
           ++ E L+D++  A +DA  +IE +   K  + T+GLP 
Sbjct: 61 PEDPETLQDMVTDAVNDALSQIEKVTEQKLGKFTKGLPF 99


>gi|89892858|ref|YP_516345.1| hypothetical protein DSY0112 [Desulfitobacterium hafniense Y51]
 gi|219666121|ref|YP_002456556.1| hypothetical protein Dhaf_0051 [Desulfitobacterium hafniense DCB-2]
 gi|89332306|dbj|BAE81901.1| hypothetical protein [Desulfitobacterium hafniense Y51]
 gi|219536381|gb|ACL18120.1| conserved hypothetical protein [Desulfitobacterium hafniense DCB-2]
          Length = 110

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 36/91 (39%), Positives = 60/91 (65%)

Query: 10  QFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILED 69
           Q +++Q +M K +E + +   E + GGG V V +NGKN L  +KI    +  D+VE+LED
Sbjct: 17  QAQKLQEEMAKAQEELKTRTVEASVGGGAVQVVVNGKNELVELKIKPEAVDPDDVEMLED 76

Query: 70  LIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           L+ AA ++  +K+E+LV+++  ++T GL IP
Sbjct: 77  LVKAAVNEGLRKVEELVSSEMGKLTNGLKIP 107


>gi|160871685|ref|ZP_02061817.1| conserved hypothetical protein [Rickettsiella grylli]
 gi|159120484|gb|EDP45822.1| conserved hypothetical protein [Rickettsiella grylli]
          Length = 113

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 51/88 (57%), Gaps = 1/88 (1%)

Query: 7  MVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEI 66
          ++ Q +++Q KM+  K  +  +   G AGGGMV V ++G++ +  V +D + L E   E 
Sbjct: 10 LLKQAQDMQSKMQSAKAELDQIVVTGEAGGGMVHVEMDGQHRVKSVWLDPASLKEPK-EF 68

Query: 67 LEDLIIAAHSDAHKKIEDLVATKTQEIT 94
          +E+L++AA + A K IE     K  ++T
Sbjct: 69 IEELLVAAFNAALKDIEKASRQKLNDLT 96


>gi|303232523|ref|ZP_07319209.1| DNA-binding protein, YbaB/EbfC family [Atopobium vaginae
           PB189-T1-4]
 gi|302481310|gb|EFL44384.1| DNA-binding protein, YbaB/EbfC family [Atopobium vaginae
           PB189-T1-4]
          Length = 102

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 51/98 (52%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           N+ +M+ Q + +Q ++   +  +  +    +AGGGMV V       +T + +D   L  +
Sbjct: 2   NMQQMMKQAQTMQKRLMDAQSKLKEIPVSASAGGGMVKVEGTADGHITSIVLDPDALNPE 61

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           +VE+L+D I+AA S+   + +     +   IT G+ IP
Sbjct: 62  DVELLQDSILAAVSECLTRAQQTADQQMGAITGGMNIP 99


>gi|169335257|ref|ZP_02862450.1| hypothetical protein ANASTE_01665 [Anaerofustis stercorihominis
          DSM 17244]
 gi|169257995|gb|EDS71961.1| hypothetical protein ANASTE_01665 [Anaerofustis stercorihominis
          DSM 17244]
          Length = 115

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 45/72 (62%)

Query: 10 QFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILED 69
          Q +++Q  ME+M++ +     E  +GGG V   ++G+ ++  +++D  +L E++ EI+ D
Sbjct: 20 QMQKMQADMERMQKELEETNYEATSGGGAVKAVVSGEKLVQSIEVDPDMLKEEDAEIICD 79

Query: 70 LIIAAHSDAHKK 81
          +I AA ++A  K
Sbjct: 80 MIAAAVNEALNK 91


>gi|119511607|ref|ZP_01630714.1| hypothetical protein N9414_23163 [Nodularia spumigena CCY9414]
 gi|119463768|gb|EAW44698.1| hypothetical protein N9414_23163 [Nodularia spumigena CCY9414]
          Length = 115

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 50/89 (56%), Gaps = 1/89 (1%)

Query: 12  KEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLI 71
           +++Q   ++++E +  +E +G +GGG+V V ++G      V+I    L E   E+L DL+
Sbjct: 26  QQVQEGAKQLQEELEQMEIQGESGGGLVKVIVSGNQEPKRVEISPEAL-EQGAELLSDLV 84

Query: 72  IAAHSDAHKKIEDLVATKTQEITEGLPIP 100
             A  DA+ K    +  + +++T GL +P
Sbjct: 85  TVAMKDAYNKSTTTMRERMEDLTSGLELP 113


>gi|323340131|ref|ZP_08080395.1| transcriptional regulatory protein [Lactobacillus ruminis ATCC
          25644]
 gi|323092322|gb|EFZ34930.1| transcriptional regulatory protein [Lactobacillus ruminis ATCC
          25644]
          Length = 103

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 49/81 (60%)

Query: 3  NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
          N+  M+ Q +++Q  M+K +E +     EG+A    V V+  G + +  ++I    +  D
Sbjct: 6  NMQGMMKQMQKLQKNMQKDQEELQKTVFEGHAPDDAVVVKFTGDHKMQDIEIKEEAVDPD 65

Query: 63 NVEILEDLIIAAHSDAHKKIE 83
          +V++L+DL+IAA +DA KK++
Sbjct: 66 DVDMLQDLVIAAVNDAIKKVD 86


>gi|302336480|ref|YP_003801687.1| hypothetical protein Olsu_1719 [Olsenella uli DSM 7084]
 gi|301320320|gb|ADK68807.1| conserved hypothetical protein [Olsenella uli DSM 7084]
          Length = 102

 Score = 47.8 bits (112), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 25/98 (25%), Positives = 51/98 (52%)

Query: 3   NIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFED 62
           N+ +M+ Q +++Q ++   ++ +  +    +AGGGMV V       +T + ID       
Sbjct: 2   NMQQMMKQAQKMQRQLADAQDRLADIPVSASAGGGMVKVEGTADMRITSITIDPDACDPA 61

Query: 63  NVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
           +VE+L+D ++AA ++     +D    +   +T G+ IP
Sbjct: 62  DVELLQDSLLAAVNECLSSAQDAANQQLGSVTGGMNIP 99


>gi|116333250|ref|YP_794777.1| hypothetical protein LVIS_0601 [Lactobacillus brevis ATCC 367]
 gi|116098597|gb|ABJ63746.1| hypothetical protein LVIS_0601 [Lactobacillus brevis ATCC 367]
          Length = 105

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 54/100 (54%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+  M+ Q +++Q KME+ + ++ +    G +   +V     G+  +T + I    + 
Sbjct: 4   MGNMGNMMKQMRQMQKKMEEDRANLNAQSFTGVSPDSLVQATFTGERKMTDLTIKPEAID 63

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
            D+ ++L DL++AA +DA  +++D       + T+G+ IP
Sbjct: 64  PDDPDMLADLVLAAVNDALGQVDDATKQSLGKYTQGMNIP 103


>gi|296141676|ref|YP_003648919.1| hypothetical protein Tpau_4009 [Tsukamurella paurometabola DSM
          20162]
 gi|296029810|gb|ADG80580.1| conserved hypothetical protein [Tsukamurella paurometabola DSM
          20162]
          Length = 96

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 50/98 (51%), Gaps = 3/98 (3%)

Query: 1  MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
          M ++M  VG  ++   ++   +  + +   EG AGGG+V V   G   +T + ID  ++ 
Sbjct: 1  MEDLMAQVGAMQQ---QLMAAQAELQATTIEGQAGGGLVKVIGTGDGQVTSLVIDPKVVD 57

Query: 61 EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLP 98
           ++VE L+DL++ A +D      +L   K   +  GLP
Sbjct: 58 PEDVETLQDLVLGALTDLSNNTAELAQQKMGPLAGGLP 95


>gi|317486262|ref|ZP_07945095.1| hypothetical protein HMPREF0179_02453 [Bilophila wadsworthia 3_1_6]
 gi|316922508|gb|EFV43761.1| hypothetical protein HMPREF0179_02453 [Bilophila wadsworthia 3_1_6]
          Length = 103

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 53/100 (53%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M N+  +V Q   +Q K+ KM++ +     E ++GGGMV V    K  +  + ID   L 
Sbjct: 1   MRNMNDLVRQAGVMQNKIAKMQQEMAERTVEASSGGGMVKVVATCKQDIVSITIDPKALE 60

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIP 100
             +VE+L+DL++ A ++A +     +  +   IT G+ +P
Sbjct: 61  GGDVEMLQDLVLTAVNEAVRIGRATMDREVSAITGGIKLP 100


>gi|167748329|ref|ZP_02420456.1| hypothetical protein ANACAC_03073 [Anaerostipes caccae DSM 14662]
 gi|317472132|ref|ZP_07931464.1| hypothetical protein HMPREF1011_01814 [Anaerostipes sp. 3_2_56FAA]
 gi|167652321|gb|EDR96450.1| hypothetical protein ANACAC_03073 [Anaerostipes caccae DSM 14662]
 gi|316900536|gb|EFV22518.1| hypothetical protein HMPREF1011_01814 [Anaerostipes sp. 3_2_56FAA]
          Length = 117

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 68/107 (63%), Gaps = 3/107 (2%)

Query: 1   MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
           M+N+MK   Q +++Q +ME+  + +   E E  AGGG+V V ++GK  +  V +D  ++ 
Sbjct: 14  MNNLMK---QAQKMQKQMEETTKQLEETEYEATAGGGVVKVVVSGKKEVVSVSLDEEVVD 70

Query: 61  EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLPIPPGLKFPF 107
            D++E+LEDLI+AA ++A +K+E+   +K  +IT GL    G  FPF
Sbjct: 71  PDDIEMLEDLIVAATNEALRKMEEDSQSKMGKITGGLGGGMGGGFPF 117


>gi|94969001|ref|YP_591049.1| hypothetical protein Acid345_1974 [Candidatus Koribacter
          versatilis Ellin345]
 gi|187479906|sp|Q1IQ75|Y1974_ACIBL RecName: Full=UPF0133 protein Acid345_1974
 gi|94551051|gb|ABF40975.1| conserved hypothetical protein 103 [Candidatus Koribacter
          versatilis Ellin345]
          Length = 101

 Score = 47.4 bits (111), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 43/65 (66%)

Query: 19 EKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLFEDNVEILEDLIIAAHSDA 78
          E++++ +     E  AGGG V+V++NG+  L  +KID  ++   +VE+L+DL+ AA ++ 
Sbjct: 18 EELQKKMAQTVIEATAGGGSVTVKMNGQKQLLSIKIDPEVVKSGDVEMLQDLVTAAVNEG 77

Query: 79 HKKIE 83
           ++++
Sbjct: 78 SRRVD 82


>gi|255971825|ref|ZP_05422411.1| conserved hypothetical protein [Enterococcus faecalis T1]
 gi|255962843|gb|EET95319.1| conserved hypothetical protein [Enterococcus faecalis T1]
          Length = 100

 Score = 47.4 bits (111), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 53/98 (54%)

Query: 1  MSNIMKMVGQFKEIQGKMEKMKESITSLEAEGNAGGGMVSVRINGKNMLTGVKIDRSLLF 60
          M N+  M+ Q +++Q +M K +E++   E  G A   +V+    G   +  + I   ++ 
Sbjct: 1  MGNMQGMMKQVQKMQKEMAKAQEALNEKEFIGEATNQLVTATFTGDRTMKDLTIKEDVVD 60

Query: 61 EDNVEILEDLIIAAHSDAHKKIEDLVATKTQEITEGLP 98
           ++VE+L+DL+I A +DA  KIE        + T+G+P
Sbjct: 61 PEDVEMLQDLVIMAVNDALVKIEKETEATLGKYTKGMP 98


>gi|229549106|ref|ZP_04437831.1| conserved hypothetical protein [Enterococcus faecalis ATCC 29200]
 gi|312951952|ref|ZP_07770840.1| conserved hypothetical protein TIGR00103 [Enterococcus faecalis
           TX0102]
 gi|229305731|gb|EEN71727.1| conserved hypothetical protein [Enterococcus faecalis ATCC 29200]
 gi|310630141|gb|EFQ13424.1| conserved hypothetical protein TIGR00103 [Enterococcus faecalis
           TX0102]
 gi|315154259|gb|EFT98275.1| conserved hypothetical protein TIGR00103 [Enterococcus faecalis
           TX0031]
 gi|315159650|gb|EFU03667.1| conserved hypothetical protein TIGR00103 [Enterococcus faecalis
           TX0312]
 gi|323481701|gb|ADX81140.1| conserved hypothetical protein [Enterococcus faecalis