HHsearch results for GI: 254780764 and protein with PDBid: 1r77_A

>1r77_A Cell WALL targeting domain of glycylglycine endopeptidase ALE-1; SH3B domain, lysostaphin, peptidoglycan hydrolase; 1.75A {Staphylococcus capitis}
Probab=94.98  E-value=0.14  Score=27.13  Aligned_cols=55  Identities=15%  Similarity=0.198  Sum_probs=41.4

Q ss_pred             CCEEEEC-CCCCCCCEEEEECCCCEEEEEEE--ECC--EEE-EEECCEEEEEECC----------CEEEEC
Q ss_conf             3113331-79987753799738988999952--099--899-9989989999714----------122056
Q gi|254780764|r  134 IYINLYK-KPDIQSIIVAKVEPGVLLTIREC--SGE--WCF-GYNLDTEGWIKKQ----------KIWGIY  188 (194)
Q Consensus       134 ~~lnvR~-~Ps~~s~iv~~l~~g~~v~i~~~--~~~--W~k-V~~~g~~GWV~k~----------~iwGv~  188 (194)
                      ..+++|. +|++++++++.+++|..|.--..  .++  |.. +.++|..+||.-.          .+||..
T Consensus        32 ~~i~~R~~~Ps~sap~~~~~~~G~~V~YD~~~~~dGyvWisy~~~sG~r~Yv~ir~~~~~~g~~~~~WGtf  102 (103)
T 1r77_A           32 TDIITRLTGPFRSMPQSGVLRKGLTIKYDEVMKQDGHVWVGYNTNSGKRVYLPVRTWNESTGELGPLWGTI  102 (103)
T ss_dssp             SCEEEESSSSCTTSCEEEEECTTCEEEEEEEEEETTEEEEEEECTTCCEEEEEEEEBCTTTCCBCCCSEEE
T ss_pred             CCEEEEECCCCCCCCEEEEECCCCEEEECEEEECCCEEEEEEECCCCEEEEEEEEECCCCCCCCCCCCEEE
T ss_conf             60799868987788468995899999939899759929999878899199999883578899635562661