HHsearch results for GI: 254780764 and protein with PDBid: 2i0n_A

>2i0n_A Class VII unconventional myosin; beta-sheet loop, structural protein; NMR {Dictyostelium discoideum}
Probab=92.93  E-value=0.16  Score=26.84  Aligned_cols=33  Identities=15%  Similarity=0.054  Sum_probs=14.7

Q ss_pred             ECCCCEEEEEEE-ECCEEEE-EECCEEEEEECCCE
Q ss_conf             738988999952-0998999-98998999971412
Q gi|254780764|r  152 VEPGVLLTIREC-SGEWCFG-YNLDTEGWIKKQKI  184 (194)
Q Consensus       152 l~~g~~v~i~~~-~~~W~kV-~~~g~~GWV~k~~i  184 (194)
                      +.+|+.++|++. +++|+.. +.+|+.||+.++|+
T Consensus        29 f~~Gd~i~v~~~~~~~ww~~~~~~g~~G~~P~~yV   63 (80)
T 2i0n_A           29 FKRNDIITITFKDQENKWFMGQLNGKEGSFPVDHV   63 (80)
T ss_dssp             BCSSEEEEEEEESSSSSEEEEEETTEEEEEEGGGE
T ss_pred             CCCCCEEEEEEEECCCCEEEEEECCCEEEEEHHHE
T ss_conf             98999999989837898896895995838956578