HHSEARCH alignment of GI: 254780764 and SCOP domain: d1uhfa_

Alignment
>d1uhfa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]}
Probab=96.19  E-value=0.0012  Score=38.40  Aligned_cols=35  Identities=20%  Similarity=0.308  Sum_probs=26.4

Q ss_pred             EECCCCEEEEEEEECCEEEEEECCEEEEEECCCEE
Q ss_conf             97389889999520998999989989999714122
Q gi|254780764|r  151 KVEPGVLLTIRECSGEWCFGYNLDTEGWIKKQKIW  185 (194)
Q Consensus       151 ~l~~g~~v~i~~~~~~W~kV~~~g~~GWV~k~~iw  185 (194)
                      .+.+|+.+.|++.+++|++++.+|++|||..+||-
T Consensus        26 s~~~Gd~v~vl~~~~~Ww~~~~~g~~G~vP~~yv~   60 (69)
T d1uhfa_          26 TFTEGEEILVTQKDGEWWTGSIGDRSGIFPSNYVK   60 (69)
T ss_dssp             CBCTTCEEEECEEETTEEEECSTTCCEEECGGGCE
T ss_pred             CCCCCCEEEEEEECCCEEEEEECCCEEEECHHHEE
T ss_conf             79799999998854997999989918898166689


SCOP domain information

class: All beta proteins
fold: SH3-like barrel
superfamily: SH3-domain
family: SH3-domain
domain: Intersectin 2 (KIAA1256)
species: Human (Homo sapiens) [TaxId: 9606]