BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780764|ref|YP_003065177.1| hypothetical protein CLIBASIA_03275 [Candidatus Liberibacter asiaticus str. psy62] (194 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780764|ref|YP_003065177.1| hypothetical protein CLIBASIA_03275 [Candidatus Liberibacter asiaticus str. psy62] Length = 194 Score = 397 bits (1021), Expect = e-113, Method: Compositional matrix adjust. Identities = 194/194 (100%), Positives = 194/194 (100%) Query: 1 MFTHAEKILYSLDLRKYMPKILQNSLIFTLAIYFYLAPILALSHEKEIFEKKPLPRFVTI 60 MFTHAEKILYSLDLRKYMPKILQNSLIFTLAIYFYLAPILALSHEKEIFEKKPLPRFVTI Sbjct: 1 MFTHAEKILYSLDLRKYMPKILQNSLIFTLAIYFYLAPILALSHEKEIFEKKPLPRFVTI 60 Query: 61 KASRANSRIGPGIMYTVVCTYLTKGLPVEVVKEYENWRQIRDFDGTIGWINKSLLSGKRS 120 KASRANSRIGPGIMYTVVCTYLTKGLPVEVVKEYENWRQIRDFDGTIGWINKSLLSGKRS Sbjct: 61 KASRANSRIGPGIMYTVVCTYLTKGLPVEVVKEYENWRQIRDFDGTIGWINKSLLSGKRS 120 Query: 121 AIVSPWNRKTNNPIYINLYKKPDIQSIIVAKVEPGVLLTIRECSGEWCFGYNLDTEGWIK 180 AIVSPWNRKTNNPIYINLYKKPDIQSIIVAKVEPGVLLTIRECSGEWCFGYNLDTEGWIK Sbjct: 121 AIVSPWNRKTNNPIYINLYKKPDIQSIIVAKVEPGVLLTIRECSGEWCFGYNLDTEGWIK 180 Query: 181 KQKIWGIYPGEVFK 194 KQKIWGIYPGEVFK Sbjct: 181 KQKIWGIYPGEVFK 194 >gi|254780294|ref|YP_003064707.1| N-acetyl-gamma-glutamyl-phosphate reductase [Candidatus Liberibacter asiaticus str. psy62] Length = 311 Score = 24.6 bits (52), Expect = 1.3, Method: Compositional matrix adjust. Identities = 13/31 (41%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Query: 5 AEKILYSLDL-RKYMPKILQNSLIFTLAIYF 34 + YSLDL K++P+I Q SLI T ++ Sbjct: 171 SNHFFYSLDLLHKHLPEITQYSLIKTSPMFL 201 >gi|254780692|ref|YP_003065105.1| hypothetical protein CLIBASIA_02895 [Candidatus Liberibacter asiaticus str. psy62] Length = 72 Score = 22.7 bits (47), Expect = 4.3, Method: Compositional matrix adjust. Identities = 7/18 (38%), Positives = 12/18 (66%) Query: 72 GIMYTVVCTYLTKGLPVE 89 GI++T++C Y+ G E Sbjct: 6 GIIFTIICLYMMNGYQKE 23 >gi|254781031|ref|YP_003065444.1| exsB protein [Candidatus Liberibacter asiaticus str. psy62] Length = 240 Score = 21.9 bits (45), Expect = 7.4, Method: Compositional matrix adjust. Identities = 14/53 (26%), Positives = 25/53 (47%), Gaps = 7/53 (13%) Query: 53 PLPRFVTIKASRANSRIGPGIMYTVVCTYLTKGLPVEVVKEYENWRQIRDFDG 105 P R TI+A +G + +++T P+ +K+YE W+ +D G Sbjct: 144 PDCRHDTIRAIETAINLG-------MESHVTVHTPLMWLKKYETWKLAQDIGG 189 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.322 0.140 0.441 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 128,058 Number of Sequences: 1233 Number of extensions: 5126 Number of successful extensions: 14 Number of sequences better than 100.0: 6 Number of HSP's better than 100.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 9 Number of HSP's gapped (non-prelim): 6 length of query: 194 length of database: 328,796 effective HSP length: 69 effective length of query: 125 effective length of database: 243,719 effective search space: 30464875 effective search space used: 30464875 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 36 (18.5 bits)