HHsearch alignment for GI: 254780765 and conserved domain: cd06437

>cd06437 CESA_CaSu_A2 Cellulose synthase catalytic subunit A2 (CESA2) is a catalytic subunit or a catalytic subunit substitute of the cellulose synthase complex. Cellulose synthase (CESA) catalyzes the polymerization reaction of cellulose using UDP-glucose as the substrate. Cellulose is an aggregate of unbranched polymers of beta-1,4-linked glucose residues, which is an abundant polysaccharide produced by plants and in varying degrees by several other organisms including algae, bacteria, fungi, and even some animals. Genomes from higher plants harbor multiple CESA genes. There are ten in Arabidopsis. At least three different CESA proteins are required to form a functional complex. In Arabidopsis, CESA1, 3 and 6 and CESA4, 7 and 8, are required for cellulose biosynthesis during primary and secondary cell wall formation. CESA2 is very closely related to CESA6 and is viewed as a prime substitute for CESA6. They functionally compensate each other. The cesa2 and cesa6 double mutant plants we
Probab=96.68  E-value=0.017  Score=35.90  Aligned_cols=202  Identities=15%  Similarity=0.129  Sum_probs=101.5

Q ss_pred             CEEEEEECCCCCCCCCCCEECCCCCCCHHHHHHHHHHHCCC--C--EEEEECC---C--CCHHHHCCCC---CCCCCCCC
Q ss_conf             56999817767888988500000672266899999996799--8--6999868---3--3000100012---22222222
Q gi|254780765|r    9 KVLVIIPARLNSMRFPKKILADINGLPMILHTAIRARKANI--G--RVIVAVD---D--TKINEIVLQA---GFESVMTH   76 (268)
Q Consensus         9 ki~~iIpAR~~S~Rlp~K~L~~i~gkplI~~v~~~a~~s~~--~--~viVaTd---d--~~I~~~~~~~---g~~~i~t~   76 (268)
T Consensus         2 ~VSViIPa~NE~--------------~~I~~~l~sl~~q~YP~~~~~I~VvDdstD~t~~~~~~~~~~~~~~~~~~~~~~   67 (232)
T cd06437           2 MVTVQLPVFNEK--------------YVVERLIEAACALDYPKDRLEIQVLDDSTDETVRLAREIVEEYAAQGVNIKHVR   67 (232)
T ss_pred             EEEEEEECCCCH--------------HHHHHHHHHHHHCCCCCCEEEEEEEECCCCHHHHHHHHHHHHHHHCCCCEEEEE
T ss_conf             399999558988--------------999999999996799998089999979996699999999976664199689983


Q ss_pred             CCCCCCC--HHHHHHHHHHCCCCCCCEEEECCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCCCCHHHCCCCCCCEEEE
Q ss_conf             2345652--04899997422334521000015221010000012233321013443211111122011003754431465
Q gi|254780765|r   77 TSHQSGS--DRIFEALNIIDSDKKSQIIVNMQADIPNIEPEILASVLLPLQNPIVDIGTLGTRIHGSTDPDDPNIVKIVV  154 (268)
Q Consensus        77 ~~~~~GT--dRi~ea~~~l~~~~~~d~vV~lqGD~Pli~~~~Id~~i~~~~~~~~dv~tl~~~~~~~~~~~d~n~vKvi~  154 (268)
T Consensus        68 ~~~~~g~Ka~aln~gl~----~a~gd~i~~~DaD~-~~~~d~L~~~~~~f~~~~~g~v~~~~~~~n~~----~~~~---~  135 (232)
T cd06437          68 RADRTGYKAGALAEGMK----VAKGEYVAIFDADF-VPPPDFLQKTPPYFADPKLGFVQTRWGHINAN----YSLL---T  135 (232)
T ss_pred             CCCCCCCHHHHHHHHHH----HCCCCEEEEECCCC-CCCHHHHHHHHHHHCCCCEEEEECCCCCCCCC----CCHH---H
T ss_conf             69888866999999999----77898899977644-73847999999983199859996664325888----6799---9


Q ss_pred             ECCCCCCCHHHHHCC--CCCCCCCCCCCCCCEE-EEEEEHHHHHHHHCCCCCCCHHHCCHHH-HHHHHCCCEEEEEEECC
Q ss_conf             145444200111103--5777531112235201-3552002333332079982111208447-98997896266998458
Q gi|254780765|r  155 ASPSENGCFRALYFT--RTKTPHGTGPFYQHLG-IYAYRREALKRFTQLSPSVLEQRESLEQ-LRALEARMRIDVKIVQS  230 (268)
Q Consensus       155 ~~~~~~~~~~alyfs--R~~ip~~~~~~~~hvG-Iy~f~~~~L~~~~~l~~t~lE~~E~lEq-LR~leng~~I~~~~~~~  230 (268)
T Consensus       136 ~~~~--~-~~~~~~~~~~~~~-~~~~~~~~~~G~~~~~Rr~~l~~~Gg~~~~~--~~ED~~l~~r~~~~G~ri~~~~~a~  209 (232)
T cd06437         136 RVQA--M-SLDYHFTIEQVAR-SSTGLFFNFNGTAGVWRKECIEDAGGWNHDT--LTEDLDLSYRAQLKGWKFVYLDDVV  209 (232)
T ss_pred             HHHH--H-HHHHHHHHHHHHH-HHCCCCEECCCEEEEEEHHHHHHHCCCCCCC--CCHHHHHHHHHHHCCCEEEEECCCE
T ss_conf             9999--9-9999999999998-8259934126515877599999857998866--1018999999998799899806877


Q ss_pred             -CCCCCCCHHHHH
Q ss_conf             -888768999999
Q gi|254780765|r  231 -NAMSVDTTNDLE  242 (268)
Q Consensus       231 -~~~~IDt~~Dl~  242 (268)
T Consensus       210 ~~~~~P~t~~~~~  222 (232)
T cd06437         210 VPAELPASMSAYR  222 (232)
T ss_pred             EEEECCCCHHHHH
T ss_conf             9767778999999