HHsearch alignment for GI: 254780765 and conserved domain: cd06442

>cd06442 DPM1_like DPM1_like represents putative enzymes similar to eukaryotic DPM1. Proteins similar to eukaryotic DPM1, including enzymes from bacteria and archaea; DPM1 is the catalytic subunit of eukaryotic dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. In higher eukaryotes,the enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. In lower eukaryotes, such as Saccharomyces cerevisiae and Trypanosoma brucei, DPM synthase consists of a single component (Dpm1p and TbDpm1, respectively) that possesses one predicted transmembrane region near the C terminus for anchoring to the ER membrane. In contrast, the Dpm1 homologues of higher eukaryotes, namely fission yeast, fungi,
Probab=95.17  E-value=0.086  Score=31.46  Aligned_cols=188  Identities=21%  Similarity=0.227  Sum_probs=91.6

Q ss_pred             EEEECCCCCCCCCCCEECCCCCCCHHHHHHHHHHHC--CCC-EEEEEC----CC-CCHHH-HCCCC-CCCCCCCCCCCCC
Q ss_conf             998177678889885000006722668999999967--998-699986----83-30001-00012-2222222223456
Q gi|254780765|r   12 VIIPARLNSMRFPKKILADINGLPMILHTAIRARKA--NIG-RVIVAV----DD-TKINE-IVLQA-GFESVMTHTSHQS   81 (268)
Q Consensus        12 ~iIpAR~~S~Rlp~K~L~~i~gkplI~~v~~~a~~s--~~~-~viVaT----dd-~~I~~-~~~~~-g~~~i~t~~~~~~   81 (268)
T Consensus         1 IIIP~yNEe~~--------------i~~~l~~i~~~~~~~~~eIIvVdDgStD~T~~i~~~l~~~~~~~~~i~~~~--n~   64 (224)
T cd06442           1 IIIPTYNEREN--------------IPELIERLDAALKGIDYEIIVVDDNSPDGTAEIVRELAKEYPRVRLIVRPG--KR   64 (224)
T ss_pred             EEEEECCCHHH--------------HHHHHHHHHHHHCCCCEEEEEEECCCCCCCHHHHHHHHCCCCCEEEEECCC--CC
T ss_conf             39995487888--------------999999999860689949999989697371788865422477247863366--78


Q ss_pred             CCH-HHHHHHHHHCCCCCCCEEEECCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCCCCHHHCCCCCCCEEEEECCCCC
Q ss_conf             520-4899997422334521000015221010000012233321013443211111122011003754431465145444
Q gi|254780765|r   82 GSD-RIFEALNIIDSDKKSQIIVNMQADIPNIEPEILASVLLPLQNPIVDIGTLGTRIHGSTDPDDPNIVKIVVASPSEN  160 (268)
Q Consensus        82 GTd-Ri~ea~~~l~~~~~~d~vV~lqGD~Pli~~~~Id~~i~~~~~~~~dv~tl~~~~~~~~~~~d~n~vKvi~~~~~~~  160 (268)
T Consensus        65 G~g~Ai~~G~~~a----~~~~i~~~DaD~q-~~p~~i~~li~~~~~~~~d~V~G-sR~~~~~~~~~~~~~r~~~s~~---  135 (224)
T cd06442          65 GLGSAYIEGFKAA----RGDVIVVMDADLS-HPPEYIPELLEAQLEGGADLVIG-SRYVEGGGVEGWGLKRKLISRG---  135 (224)
T ss_pred             CHHHHHHHHHHHH----CCCCEEEECCCCC-CCHHHHHHHHHHHHCCCCCEEEE-EEECCCCCCCCCHHHHHHHHHH---
T ss_conf             7279999999860----1784688659997-62777899999987188724798-8762798635770666788888---


Q ss_pred             CCHHHHHCCCCCCCCCCCCCC-CCEEEEEEEHHHHHHHHCCCCCCCHHHCCHHH-HHHHHCCCEEEEEEECCCC
Q ss_conf             200111103577753111223-52013552002333332079982111208447-9899789626699845888
Q gi|254780765|r  161 GCFRALYFTRTKTPHGTGPFY-QHLGIYAYRREALKRFTQLSPSVLEQRESLEQ-LRALEARMRIDVKIVQSNA  232 (268)
Q Consensus       161 ~~~~alyfsR~~ip~~~~~~~-~hvGIy~f~~~~L~~~~~l~~t~lE~~E~lEq-LR~leng~~I~~~~~~~~~  232 (268)
T Consensus       136 ----~~~i~~~l--~~~-~i~D~~~gfr~~~~~~~~~i~~~~~~~-~f~~~~ei~~~~~~~~~ki~evpv~~~~  201 (224)
T cd06442         136 ----ANLLARLL--LGR-KVSDPTSGFRAYRREVLEKLIDSLVSK-GYKFQLELLVRARRLGYRIVEVPITFVD  201 (224)
T ss_pred             ----HHHHHHHC--CCC-EECCCCCCEEEEEHHHHHHHHHHCCCC-CCCCHHHHHHHHHHCCCEEEEEEEEECC
T ss_conf             ----88763230--584-243179963998899999887754566-6301899999999889989999727779