HHsearch alignment for GI: 254780766 and conserved domain: COG0396

>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones].
Probab=96.60  E-value=0.027  Score=34.15  Aligned_cols=78  Identities=18%  Similarity=0.155  Sum_probs=57.1

Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHH---CCCCEEEEECCHHHHHHHHCCEE
Q ss_conf             220589999999999999999987089978998012201598999999999741---79809998069678543212600
Q gi|254780766|r  287 GSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTD---IGSQIFMTGTDKSVFDSLNETAK  363 (375)
Q Consensus       287 ~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~---~~~Qv~iTt~~~~~~~~~~~~~~  363 (375)
T Consensus       145 FSGGEkKR~EilQ~~~---------lePkl~ILDE~DSGLDIdalk~V~~~i~~lr~~~~~~liITHy~rll~~i~pD-~  214 (251)
T COG0396         145 FSGGEKKRNEILQLLL---------LEPKLAILDEPDSGLDIDALKIVAEGINALREEGRGVLIITHYQRLLDYIKPD-K  214 (251)
T ss_pred             CCCCHHHHHHHHHHHH---------CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHCCCCEEEEEECHHHHHHHCCCC-E
T ss_conf             4731577999999984---------59988995588767558999999999999865897299995579998426888-7


Q ss_pred             EEEECCCEEEE
Q ss_conf             79972896895
Q gi|254780766|r  364 FMRISNHQALC  374 (375)
Q Consensus       364 ~~~i~~g~~~~  374 (375)
T Consensus       215 vhvl~~GrIv~  225 (251)
T COG0396         215 VHVLYDGRIVK  225 (251)
T ss_pred             EEEEECCEEEE
T ss_conf             99998888983